Citrus Sinensis ID: 043877

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSKFQSPKIF
ccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccc
cccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHcccccEcHHHHHcHHHHHHHHHHHHHcccHccc
NRSNLVQTSWAMMALIHAgqmergptplHHAAKLLINsqlgegdfpqqELTRAFMgncmshyptyrnifpTWALAEYrskfqspkif
NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSkfqspkif
NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSKFQSPKIF
*******TSWAMMALIHAGQM****TPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYR*********
**SNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSKFQSP*I*
NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSKFQSPKIF
**SNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSKFQSPK**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSKFQSPKIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
P0C8Y0769 Camelliol C synthase OS=A yes no 0.954 0.107 0.746 2e-31
A8CDT2759 Beta-amyrin synthase OS=B N/A no 0.965 0.110 0.714 3e-31
Q9LRH8758 Beta-amyrin synthase OS=P N/A no 0.965 0.110 0.702 2e-30
E2IUA9765 Lupeol synthase OS=Kalanc N/A no 0.942 0.107 0.731 2e-30
Q8RWT0763 Amyrin synthase LUP2 OS=A no no 0.908 0.103 0.759 3e-30
Q8W3Z1779 Beta-amyrin synthase OS=B N/A no 0.965 0.107 0.702 3e-30
Q9MB42765 Beta-amyrin synthase OS=G N/A no 0.965 0.109 0.678 1e-29
O82140763 Beta-Amyrin Synthase 1 OS N/A no 0.988 0.112 0.662 3e-29
A8C980759 Germanicol synthase OS=Rh N/A no 0.965 0.110 0.690 4e-29
O82146761 Beta-Amyrin Synthase 2 OS N/A no 0.965 0.110 0.702 4e-29
>sp|P0C8Y0|LUP3_ARATH Camelliol C synthase OS=Arabidopsis thaliana GN=CAMS1 PE=1 SV=1 Back     alignment and function desciption
 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 62/83 (74%), Positives = 67/83 (80%)

Query: 2   RSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSH 61
           RSNLVQTSWAMM L+HAGQ ER P+PLH AAKLLINSQL  GDFPQQE+T AFM NC+ H
Sbjct: 677 RSNLVQTSWAMMGLLHAGQAERDPSPLHRAAKLLINSQLENGDFPQQEITGAFMKNCLLH 736

Query: 62  YPTYRNIFPTWALAEYRSKFQSP 84
           Y  YRNIFP WALAEYR +   P
Sbjct: 737 YAAYRNIFPVWALAEYRRRVPLP 759
Converts oxidosqualene to camelliol C. Minor production of achilleol and beta-amyrin.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 3EC: 8
>sp|A8CDT2|BAS_BRUGY Beta-amyrin synthase OS=Bruguiera gymnorhiza GN=BAS PE=1 SV=1 Back     alignment and function description
>sp|Q9LRH8|BAMS_PEA Beta-amyrin synthase OS=Pisum sativum GN=OSCPSY PE=2 SV=1 Back     alignment and function description
>sp|E2IUA9|LUPS_KALDA Lupeol synthase OS=Kalanchoe daigremontiana PE=1 SV=1 Back     alignment and function description
>sp|Q8RWT0|LUP2_ARATH Amyrin synthase LUP2 OS=Arabidopsis thaliana GN=LUP2 PE=1 SV=1 Back     alignment and function description
>sp|Q8W3Z1|BAMS_BETPL Beta-amyrin synthase OS=Betula platyphylla GN=OSCBPY PE=1 SV=1 Back     alignment and function description
>sp|Q9MB42|BAMS_GLYGL Beta-amyrin synthase OS=Glycyrrhiza glabra GN=GgbAS1 PE=1 SV=1 Back     alignment and function description
>sp|O82140|BAMS1_PANGI Beta-Amyrin Synthase 1 OS=Panax ginseng GN=OSCPNY1 PE=1 SV=1 Back     alignment and function description
>sp|A8C980|GERS_RHISY Germanicol synthase OS=Rhizophora stylosa GN=M1 PE=1 SV=1 Back     alignment and function description
>sp|O82146|BAMS2_PANGI Beta-Amyrin Synthase 2 OS=Panax ginseng GN=OSCPNY2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
297842681 1556 hypothetical protein ARALYDRAFT_316793 [ 0.965 0.053 0.738 9e-30
3152599 1565 Strong similarity to lupeol synthase gb| 0.954 0.053 0.746 9e-30
22330736 769 camelliol C synthase 1 [Arabidopsis thal 0.954 0.107 0.746 9e-30
353678016 759 RecName: Full=Beta-amyrin synthase; Shor 0.965 0.110 0.714 1e-29
392621787 763 lupeol synthase [Eleutherococcus trifoli 0.988 0.112 0.697 2e-29
73991374 762 beta-amyrin synthase [Euphorbia tirucall 0.965 0.110 0.726 2e-29
62320984 362 putative lupeol synthase [Arabidopsis th 0.896 0.215 0.769 4e-29
83016474 762 beta-amyrin synthase [Lotus japonicus] 0.965 0.110 0.702 4e-29
28194506 750 putative beta-amyrin synthase [Lotus jap 0.965 0.112 0.702 5e-29
75264204 758 RecName: Full=Beta-amyrin synthase gi|89 0.965 0.110 0.702 7e-29
>gi|297842681|ref|XP_002889222.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. lyrata] gi|297335063|gb|EFH65481.1| hypothetical protein ARALYDRAFT_316793 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 62/84 (73%), Positives = 67/84 (79%)

Query: 1   NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMS 60
           +RSNLVQTSWAMM L+HAGQ ER P PLH AAKLLINSQL  GDFPQQE+T AFM NC+ 
Sbjct: 676 DRSNLVQTSWAMMGLLHAGQAERDPAPLHRAAKLLINSQLENGDFPQQEITGAFMKNCLL 735

Query: 61  HYPTYRNIFPTWALAEYRSKFQSP 84
           HY  YRNIFP WALAEYR +   P
Sbjct: 736 HYAAYRNIFPVWALAEYRRRVPLP 759

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|3152599|gb|AAC17080.1| Strong similarity to lupeol synthase gb|U49919 and cycloartenol synthase gb|U02555 from A. thaliana (the third gene with similar homology) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22330736|ref|NP_683508.1| camelliol C synthase 1 [Arabidopsis thaliana] gi|224493121|sp|P0C8Y0.1|LUP3_ARATH RecName: Full=Camelliol C synthase; AltName: Full=Lupeol synthase 3; Short=AtLUP3 gi|332198063|gb|AEE36184.1| camelliol C synthase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|353678016|sp|A8CDT2.1|BAS_BRUGY RecName: Full=Beta-amyrin synthase; Short=BgbAS gi|157679391|dbj|BAF80443.1| beta amyrin synthase [Bruguiera gymnorhiza] Back     alignment and taxonomy information
>gi|392621787|gb|AFM82492.1| lupeol synthase [Eleutherococcus trifoliatus] Back     alignment and taxonomy information
>gi|73991374|dbj|BAE43642.1| beta-amyrin synthase [Euphorbia tirucalli] Back     alignment and taxonomy information
>gi|62320984|dbj|BAD94022.1| putative lupeol synthase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|83016474|dbj|BAE53429.1| beta-amyrin synthase [Lotus japonicus] Back     alignment and taxonomy information
>gi|28194506|gb|AAO33579.1|AF478454_1 putative beta-amyrin synthase [Lotus japonicus] Back     alignment and taxonomy information
>gi|75264204|sp|Q9LRH8.1|BAMS_PEA RecName: Full=Beta-amyrin synthase gi|8918271|dbj|BAA97558.1| beta-amyrin synthase [Pisum sativum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
UNIPROTKB|A8CDT2759 BAS "Beta-amyrin synthase" [Br 0.965 0.110 0.714 2.7e-29
TAIR|locus:504956092769 CAMS1 "AT1G78955" [Arabidopsis 0.954 0.107 0.746 2.8e-29
UNIPROTKB|E2IUA9765 E2IUA9 "Lupeol synthase" [Kala 0.942 0.107 0.731 2e-28
UNIPROTKB|Q8W3Z1779 OSCBPY "Beta-amyrin synthase" 0.965 0.107 0.702 2.7e-28
TAIR|locus:2207300763 LUP2 "lupeol synthase 2" [Arab 0.896 0.102 0.769 3.3e-28
TAIR|locus:2207310757 LUP1 "lupeol synthase 1" [Arab 0.885 0.101 0.766 8.2e-27
UNIPROTKB|Q9LRH7764 OSCPSM "Mixed-amyrin synthase" 0.988 0.112 0.670 1.4e-26
UNIPROTKB|Q2XPU7769 Q2XPU7 "Lupeol synthase" [Rici 0.896 0.101 0.743 2.9e-26
UNIPROTKB|E2IUA8767 E2IUA8 "Friedelin synthase" [K 0.954 0.108 0.690 3.7e-26
UNIPROTKB|E2IUA6779 E2IUA6 "Taraxerol synthase" [K 0.965 0.107 0.654 6.3e-26
UNIPROTKB|A8CDT2 BAS "Beta-amyrin synthase" [Bruguiera gymnorhiza (taxid:39984)] Back     alignment and assigned GO terms
 Score = 334 (122.6 bits), Expect = 2.7e-29, P = 2.7e-29
 Identities = 60/84 (71%), Positives = 69/84 (82%)

Query:     1 NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMS 60
             NRSNLV T+WA+MALIHAGQM+R PTPLH AA+L+INSQL +GDFPQQE+T  FM NCM 
Sbjct:   675 NRSNLVHTAWALMALIHAGQMDRDPTPLHRAARLMINSQLEDGDFPQQEITGVFMKNCML 734

Query:    61 HYPTYRNIFPTWALAEYRSKFQSP 84
             HY  YRNI+P WALAEYR +   P
Sbjct:   735 HYAAYRNIYPLWALAEYRRRVPLP 758
GO:0016104 "triterpenoid biosynthetic process" evidence=IDA
GO:0042300 "beta-amyrin synthase activity" evidence=IDA
TAIR|locus:504956092 CAMS1 "AT1G78955" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2IUA9 E2IUA9 "Lupeol synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
UNIPROTKB|Q8W3Z1 OSCBPY "Beta-amyrin synthase" [Betula platyphylla (taxid:78630)] Back     alignment and assigned GO terms
TAIR|locus:2207300 LUP2 "lupeol synthase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207310 LUP1 "lupeol synthase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9LRH7 OSCPSM "Mixed-amyrin synthase" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
UNIPROTKB|Q2XPU7 Q2XPU7 "Lupeol synthase" [Ricinus communis (taxid:3988)] Back     alignment and assigned GO terms
UNIPROTKB|E2IUA8 E2IUA8 "Friedelin synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
UNIPROTKB|E2IUA6 E2IUA6 "Taraxerol synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C8Y0LUP3_ARATH5, ., 4, ., 9, 9, ., 3, 80.74690.95400.1079yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh1_pm.C_scaffold_2001826
annotation not avaliable (1556 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
PLN02993763 PLN02993, PLN02993, lupeol synthase 1e-42
PLN03012759 PLN03012, PLN03012, Camelliol C synthase 9e-39
cd02892634 cd02892, SQCY_1, Squalene cyclase (SQCY) domain su 7e-31
cd02889348 cd02889, SQCY, Squalene cyclase (SQCY) domain; fou 1e-30
TIGR01787621 TIGR01787, squalene_cyclas, squalene/oxidosqualene 3e-24
TIGR03463634 TIGR03463, osq_cycl, 2,3-oxidosqualene cyclase 4e-11
cd00688300 cd00688, ISOPREN_C2_like, This group contains clas 9e-08
TIGR01507635 TIGR01507, hopene_cyclase, squalene-hopene cyclase 1e-07
COG1657517 COG1657, SqhC, Squalene cyclase [Lipid metabolism] 0.001
>gnl|CDD|215537 PLN02993, PLN02993, lupeol synthase Back     alignment and domain information 
 Score =  146 bits (369), Expect = 1e-42
 Identities = 58/78 (74%), Positives = 61/78 (78%)

Query: 1   NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMS 60
           NRSNLVQT+WAMM LIHAGQ ER   PLH AAKL+I SQL  GDFPQQE+  AFM  CM 
Sbjct: 676 NRSNLVQTAWAMMGLIHAGQAERDLIPLHRAAKLIITSQLENGDFPQQEILGAFMNTCML 735

Query: 61  HYPTYRNIFPTWALAEYR 78
           HY TYRN FP WALAEYR
Sbjct: 736 HYATYRNTFPLWALAEYR 753

Length = 763
>gnl|CDD|166653 PLN03012, PLN03012, Camelliol C synthase Back     alignment and domain information
>gnl|CDD|239222 cd02892, SQCY_1, Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>gnl|CDD|239219 cd02889, SQCY, Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>gnl|CDD|233578 TIGR01787, squalene_cyclas, squalene/oxidosqualene cyclases Back     alignment and domain information
>gnl|CDD|234220 TIGR03463, osq_cycl, 2,3-oxidosqualene cyclase Back     alignment and domain information
>gnl|CDD|238362 cd00688, ISOPREN_C2_like, This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>gnl|CDD|233442 TIGR01507, hopene_cyclase, squalene-hopene cyclase Back     alignment and domain information
>gnl|CDD|224571 COG1657, SqhC, Squalene cyclase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
PLN03012759 Camelliol C synthase 99.97
PLN02993763 lupeol synthase 99.97
TIGR01507635 hopene_cyclase squalene-hopene cyclase. SHC is an 99.94
TIGR03463634 osq_cycl 2,3-oxidosqualene cyclase. This model ide 99.93
TIGR01787621 squalene_cyclas squalene/oxidosqualene cyclases. T 99.93
KOG0497760 consensus Oxidosqualene-lanosterol cyclase and rel 99.91
cd02892634 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; 99.89
cd02889348 SQCY Squalene cyclase (SQCY) domain; found in clas 99.67
COG1657517 SqhC Squalene cyclase [Lipid metabolism] 99.45
PLN03012759 Camelliol C synthase 99.01
cd02897292 A2M_2 Proteins similar to alpha2-macroglobulin (al 98.9
PLN02993763 lupeol synthase 98.86
PF13243109 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 98.72
cd02896297 complement_C3_C4_C5 Proteins similar to C3, C4 and 98.58
TIGR03463634 osq_cycl 2,3-oxidosqualene cyclase. This model ide 98.57
PF13249113 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 98.52
cd00688300 ISOPREN_C2_like This group contains class II terpe 98.5
PF13249113 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 98.49
cd02897 292 A2M_2 Proteins similar to alpha2-macroglobulin (al 98.38
TIGR01787 621 squalene_cyclas squalene/oxidosqualene cyclases. T 98.31
TIGR01507 635 hopene_cyclase squalene-hopene cyclase. SHC is an 98.27
cd02889 348 SQCY Squalene cyclase (SQCY) domain; found in clas 98.22
KOG0497760 consensus Oxidosqualene-lanosterol cyclase and rel 98.14
cd02896 297 complement_C3_C4_C5 Proteins similar to C3, C4 and 98.11
cd00688300 ISOPREN_C2_like This group contains class II terpe 97.98
cd02892 634 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; 97.92
PF07678246 A2M_comp: A-macroglobulin complement component; In 97.83
TIGR02474 290 pec_lyase pectate lyase, PelA/Pel-15E family. Memb 97.79
cd02891 282 A2M_like Proteins similar to alpha2-macroglobulin 97.66
PF07678 246 A2M_comp: A-macroglobulin complement component; In 97.52
PF09492 289 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 97.29
TIGR01577 616 oligosac_amyl oligosaccharide amylase. The name of 97.1
cd02890286 PTase Protein prenyltransferase (PTase) domain, be 97.03
) (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF00432">PF0043244 Prenyltrans: Prenyltransferase and squalene oxidas 96.91
cd02894287 GGTase-II Geranylgeranyltransferase type II (GGTas 96.9
PF13243109 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 96.65
cd02890 286 PTase Protein prenyltransferase (PTase) domain, be 96.62
PLN02592 800 ent-copalyl diphosphate synthase 95.97
cd02891282 A2M_like Proteins similar to alpha2-macroglobulin 95.69
cd02894287 GGTase-II Geranylgeranyltransferase type II (GGTas 95.49
cd02895307 GGTase-I Geranylgeranyltransferase types I (GGTase 95.47
TIGR01535 648 glucan_glucosid glucan 1,4-alpha-glucosidase. Gluc 95.3
COG1657517 SqhC Squalene cyclase [Lipid metabolism] 95.29
PLN02279 784 ent-kaur-16-ene synthase 94.98
PLN03201 316 RAB geranylgeranyl transferase beta-subunit; Provi 93.76
PLN03201316 RAB geranylgeranyl transferase beta-subunit; Provi 93.65
cd02895307 GGTase-I Geranylgeranyltransferase types I (GGTase 93.51
cd02893 299 FTase Protein farnesyltransferase (FTase)_like pro 93.19
cd02893299 FTase Protein farnesyltransferase (FTase)_like pro 92.69
COG3387 612 SGA1 Glucoamylase and related glycosyl hydrolases 91.64
PLN02710 439 farnesyltranstransferase subunit beta 89.83
KOG0367347 consensus Protein geranylgeranyltransferase Type I 88.1
TIGR02474290 pec_lyase pectate lyase, PelA/Pel-15E family. Memb 87.77
PLN02710 439 farnesyltranstransferase subunit beta 85.66
PF01122326 Cobalamin_bind: Eukaryotic cobalamin-binding prote 85.14
KOG1366 1436 consensus Alpha-macroglobulin [Posttranslational m 85.13
KOG1366 1436 consensus Alpha-macroglobulin [Posttranslational m 82.03
>PLN03012 Camelliol C synthase Back     alignment and domain information 
Probab=99.97  E-value=1.4e-32  Score=227.70  Aligned_cols=82  Identities=70%  Similarity=1.149  Sum_probs=78.2

Q ss_pred             CchHhhHHHHHHHHHHhCCCCCCchHHHHHHHHHHHhcccCCCCCCccccccccccccccCCCchhHHhHHHHHHHHHhh
Q 043877            2 RSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSKF   81 (87)
Q Consensus         2 ~st~~qTaWAL~aLlaag~~~~~~~~i~Rgv~~Ll~~Q~~dG~W~e~~~~G~f~~~~~i~Y~~Y~~~fPl~ALg~y~~~~   81 (87)
                      .||++||||||+||+++|++++++++|+|||+||+++|++||+|+|++++|+||++|||+||+||++|||||||+|++..
T Consensus       677 ~S~~~qTaWAl~aLi~ag~~~~~~~~i~Rg~~~Ll~~Q~~dG~W~q~~~~G~F~~~~~i~Y~~Yr~~FPl~ALg~Y~~~~  756 (759)
T PLN03012        677 ISNLVQTAWALMGLIHAGQAERDPIPLHRAAKLIINSQLENGDFPQQEATGAFLKNCLLHYAAYRNIFPLWALAEYRARV  756 (759)
T ss_pred             CCcHHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHHcccCCCCCCCceeeeeeccceEEecCccchHHHHHHHHHHHHhc
Confidence            59999999999999999998777778999999999999999999999999999999999999999999999999999987


Q ss_pred             cC
Q 043877           82 QS   83 (87)
Q Consensus        82 ~~   83 (87)
                      +.
T Consensus       757 ~~  758 (759)
T PLN03012        757 PL  758 (759)
T ss_pred             cC
Confidence            64

>PLN02993 lupeol synthase Back     alignment and domain information
>TIGR01507 hopene_cyclase squalene-hopene cyclase Back     alignment and domain information
>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase Back     alignment and domain information
>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases Back     alignment and domain information
>KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>COG1657 SqhC Squalene cyclase [Lipid metabolism] Back     alignment and domain information
>PLN03012 Camelliol C synthase Back     alignment and domain information
>cd02897 A2M_2 Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>PLN02993 lupeol synthase Back     alignment and domain information
>PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A Back     alignment and domain information
>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement Back     alignment and domain information
>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase Back     alignment and domain information
>PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C Back     alignment and domain information
>cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C Back     alignment and domain information
>cd02897 A2M_2 Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases Back     alignment and domain information
>TIGR01507 hopene_cyclase squalene-hopene cyclase Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement Back     alignment and domain information
>cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>cd02891 A2M_like Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family Back     alignment and domain information
>PF09492 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 Members of this family are isozymes of pectate lyase (4 Back     alignment and domain information
>TIGR01577 oligosac_amyl oligosaccharide amylase Back     alignment and domain information
>cd02890 PTase Protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>PF00432 Prenyltrans: Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family Back     alignment and domain information
>cd02894 GGTase-II Geranylgeranyltransferase type II (GGTase-II)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A Back     alignment and domain information
>cd02890 PTase Protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>PLN02592 ent-copalyl diphosphate synthase Back     alignment and domain information
>cd02891 A2M_like Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>cd02894 GGTase-II Geranylgeranyltransferase type II (GGTase-II)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02895 GGTase-I Geranylgeranyltransferase types I (GGTase-I)-like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>TIGR01535 glucan_glucosid glucan 1,4-alpha-glucosidase Back     alignment and domain information
>COG1657 SqhC Squalene cyclase [Lipid metabolism] Back     alignment and domain information
>PLN02279 ent-kaur-16-ene synthase Back     alignment and domain information
>PLN03201 RAB geranylgeranyl transferase beta-subunit; Provisional Back     alignment and domain information
>PLN03201 RAB geranylgeranyl transferase beta-subunit; Provisional Back     alignment and domain information
>cd02895 GGTase-I Geranylgeranyltransferase types I (GGTase-I)-like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02893 FTase Protein farnesyltransferase (FTase)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02893 FTase Protein farnesyltransferase (FTase)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>COG3387 SGA1 Glucoamylase and related glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02710 farnesyltranstransferase subunit beta Back     alignment and domain information
>KOG0367 consensus Protein geranylgeranyltransferase Type I, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>PLN02710 farnesyltranstransferase subunit beta Back     alignment and domain information
>PF01122 Cobalamin_bind: Eukaryotic cobalamin-binding protein; InterPro: IPR002157 Cobalamin (Cbl or vitamin B12) is only accessible through diet in mammals Back     alignment and domain information
>KOG1366 consensus Alpha-macroglobulin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1366 consensus Alpha-macroglobulin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1w6j_A732 Structure Of Human Osc In Complex With Ro 48-8071 L 2e-08
1w6k_A732 Structure Of Human Osc In Complex With Lanosterol L 2e-08
3sqc_A631 Squalene-Hopene Cyclase Length = 631 3e-05
1gsz_A631 Crystal Structure Of A Squalene Cyclase In Complex 3e-05
2sqc_A631 Squalene-Hopene Cyclase From Alicyclobacillus Acido 3e-05
>pdb|1W6J|A Chain A, Structure Of Human Osc In Complex With Ro 48-8071 Length = 732 Back     alignment and structure 
Iteration: 1

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 40/81 (49%), Gaps = 12/81 (14%)
Query: 2   RSNLVQTSWAMMALIHAGQ-----MERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMG 56
           +S +  T WAMM L+          ERG        + L+  QL  GD+PQ+ +   F  
Sbjct: 646 QSQIHNTCWAMMGLMAVRHPDIEAQERG-------VRCLLEKQLPNGDWPQENIAGVFNK 698
Query: 57  NCMSHYPTYRNIFPTWALAEY 77
           +C   Y +YRNIFP WAL  +
Sbjct: 699 SCAISYTSYRNIFPIWALGRF 719
>pdb|1W6K|A Chain A, Structure Of Human Osc In Complex With Lanosterol Length = 732 Back     alignment and structure
>pdb|3SQC|A Chain A, Squalene-Hopene Cyclase Length = 631 Back     alignment and structure
>pdb|1GSZ|A Chain A, Crystal Structure Of A Squalene Cyclase In Complex With The Potential Anticholesteremic Drug Ro48-8071 Length = 631 Back     alignment and structure
>pdb|2SQC|A Chain A, Squalene-Hopene Cyclase From Alicyclobacillus Acidocaldarius Length = 631 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 5e-24
2sqc_A631 Squalene-hopene cyclase; isomerase, triterpene cyc 4e-22
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Length = 732 Back     alignment and structure
 Score = 93.0 bits (230), Expect = 5e-24
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 1   NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMS 60
            +S +  T WAMM L+     +          + L+  QL  GD+PQ+ +   F  +C  
Sbjct: 645 AQSQIHNTCWAMMGLMAVRHPDI--EAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAI 702

Query: 61  HYPTYRNIFPTWALAEYRSKFQSPKI 86
            Y +YRNIFP WAL  +   +    +
Sbjct: 703 SYTSYRNIFPIWALGRFSQLYPERAL 728
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Length = 631 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 99.89
2sqc_A631 Squalene-hopene cyclase; isomerase, triterpene cyc 99.89
2wy7_A310 Complement C3D fragment; immune system, immune res 99.15
1qqf_A277 Protein (complement C3DG); alpha-alpha barrel, imm 98.99
1hzf_A367 Complement factor C4A; alpha-alpha 6 barrel, immun 98.72
2pn5_A 1325 TEP1R, thioester-containing protein I; FULL-length 98.53
2hr0_B 915 Complement C3 alpha' chain; complement component C 98.42
2h6f_B 437 Protein farnesyltransferase beta subunit; ftase, f 98.39
3dss_B331 Geranylgeranyl transferase type-2 subunit beta; pr 98.27
2sqc_A 631 Squalene-hopene cyclase; isomerase, triterpene cyc 98.1
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 98.08
1gxm_A 332 Pectate lyase; mechanism, elimination; 1.32A {Cell 98.02
1r76_A408 Pectate lyase; A-helical structure; 2.65A {Azospir 97.88
2h6f_B 437 Protein farnesyltransferase beta subunit; ftase, f 97.85
4acq_A 1451 Alpha-2-macroglobulin; hydrolase inhibitor, protei 97.85
1r76_A 408 Pectate lyase; A-helical structure; 2.65A {Azospir 97.84
3dss_B 331 Geranylgeranyl transferase type-2 subunit beta; pr 97.83
1n4q_B377 Geranyltransferase type-I beta subunit; protein ge 97.76
1hzf_A 367 Complement factor C4A; alpha-alpha 6 barrel, immun 97.6
1qqf_A 277 Protein (complement C3DG); alpha-alpha barrel, imm 97.49
1n4q_B 377 Geranyltransferase type-I beta subunit; protein ge 97.39
2wy7_A 310 Complement C3D fragment; immune system, immune res 97.36
4fxk_B 767 Complement C4-A alpha chain; immune system, proteo 97.32
3cu7_A 1676 Complement C5; Mg domain, inflammation, anaphylato 97.16
4acq_A 1451 Alpha-2-macroglobulin; hydrolase inhibitor, protei 96.93
2b39_A 1661 C3; thioester, immune defense, immune system; HET: 96.86
3q7a_B 520 Farnesyltransferase beta subunit; protein prenyltr 96.64
2bb6_A 414 TCII, TC II, transcobalamin II; alpha_6 - alpha_6 96.53
3prx_B 1642 Cobra venom factor; immune system, complement, imm 96.13
3sdr_A 817 Alpha-bisabolene synthase; lyase, terpene synthase 96.12
3s9v_A 785 Abietadiene synthase, chloroplastic; alpha bundle/ 96.06
2hr0_B 915 Complement C3 alpha' chain; complement component C 95.92
3p5p_A 764 Taxadiene synthase; class I and II terpene cyclase 95.65
3pya_A 727 ENT-copalyl diphosphate synthase, chloroplastic; c 95.51
2pn5_A 1325 TEP1R, thioester-containing protein I; FULL-length 95.29
2bb6_A 414 TCII, TC II, transcobalamin II; alpha_6 - alpha_6 95.27
1gxm_A332 Pectate lyase; mechanism, elimination; 1.32A {Cell 95.14
4fxk_B 767 Complement C4-A alpha chain; immune system, proteo 94.58
3q7a_B 520 Farnesyltransferase beta subunit; protein prenyltr 94.56
2pmv_A 399 Gastric intrinsic factor; cobalamin transport prot 94.17
2b39_A 1661 C3; thioester, immune defense, immune system; HET: 93.14
3prx_B 1642 Cobra venom factor; immune system, complement, imm 93.11
2pmv_A 399 Gastric intrinsic factor; cobalamin transport prot 92.84
3cu7_A 1676 Complement C5; Mg domain, inflammation, anaphylato 92.56
1ulv_A 1020 Glucodextranase; GH family 15, (alpha-alpha)6-barr 91.75
2dna_A67 Unnamed protein product; ubiquitin associated doma 87.43
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 85.14
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 84.83
1lf6_A 684 Glucoamylase; (alpha/alpha) barrel, 6 alpha-helica 84.63
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 84.03
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 83.55
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 81.82
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 80.14
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Back     alignment and structure
Probab=99.89  E-value=2.2e-23  Score=170.39  Aligned_cols=83  Identities=31%  Similarity=0.679  Sum_probs=77.2

Q ss_pred             CchHhhHHHHHHHHHHhCCCCCCchHHHHHHHHHHHhcccCCCCCCccccccccccccccCCCchhHHhHHHHHHHHHhh
Q 043877            2 RSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSKF   81 (87)
Q Consensus         2 ~st~~qTaWAL~aLlaag~~~~~~~~i~Rgv~~Ll~~Q~~dG~W~e~~~~G~f~~~~~i~Y~~Y~~~fPl~ALg~y~~~~   81 (87)
                      .|++++|||||+||+++++.  ++++++|+|+||+++|++||+|.++.++|+||+.|||+|++|+++|||+||++|++++
T Consensus       646 ~s~v~~TAwALlALl~ag~~--~~~~i~r~v~wL~~~Q~~~Ggf~~~~~~g~f~~~~~i~Y~~y~~~fpl~AL~~y~~~~  723 (732)
T 1w6k_A          646 QSQIHNTCWAMMGLMAVRHP--DIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLY  723 (732)
T ss_dssp             SCCHHHHHHHHHHHHHTTCS--CHHHHHHHHHHHHHHCCTTSCCCCCSCCEEETTTEEECCTTHHHHHHHHHHHHHHHHC
T ss_pred             CCCHHHHHHHHHHHHHcCCC--ChHHHHHHHHHHHHhcCCCCCccCCcccccccchhhhcccchhHHHHHHHHHHHHHhc
Confidence            47999999999999999987  4468999999999999999999999999999999999999999999999999999998


Q ss_pred             cCCCC
Q 043877           82 QSPKI   86 (87)
Q Consensus        82 ~~~~~   86 (87)
                      +++++
T Consensus       724 ~~~~~  728 (732)
T 1w6k_A          724 PERAL  728 (732)
T ss_dssp             TTSGG
T ss_pred             chhhc
Confidence            87643
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Back     alignment and structure
>2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A Back     alignment and structure
>1qqf_A Protein (complement C3DG); alpha-alpha barrel, immune system; 1.45A {Rattus norvegicus} SCOP: a.102.4.4 PDB: 1qsj_A 3d5r_A 2noj_A 2gox_A 3d5s_A 1c3d_A 2xqw_A Back     alignment and structure
>1hzf_A Complement factor C4A; alpha-alpha 6 barrel, immune system; 2.30A {Homo sapiens} SCOP: a.102.4.4 Back     alignment and structure
>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} Back     alignment and structure
>2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... Back     alignment and structure
>2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... Back     alignment and structure
>3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* 4ehm_B* 4gts_B* 4gtt_B* 4gtv_B* Back     alignment and structure
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Back     alignment and structure
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Back     alignment and structure
>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Back     alignment and structure
>2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... Back     alignment and structure
>4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Back     alignment and structure
>3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* 4ehm_B* 4gts_B* 4gtt_B* 4gtv_B* Back     alignment and structure
>1n4q_B Geranyltransferase type-I beta subunit; protein geranylgeranyltransferase type-I, ggtase; HET: MGM GER; 2.40A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1n4p_B* 1n4r_B* 1n4s_B* 1s64_B* 1tnb_B* 1tno_B* 1tnu_B* 1tny_B* 1tnz_B* Back     alignment and structure
>1hzf_A Complement factor C4A; alpha-alpha 6 barrel, immune system; 2.30A {Homo sapiens} SCOP: a.102.4.4 Back     alignment and structure
>1qqf_A Protein (complement C3DG); alpha-alpha barrel, immune system; 1.45A {Rattus norvegicus} SCOP: a.102.4.4 PDB: 1qsj_A 3d5r_A 2noj_A 2gox_A 3d5s_A 1c3d_A 2xqw_A Back     alignment and structure
>1n4q_B Geranyltransferase type-I beta subunit; protein geranylgeranyltransferase type-I, ggtase; HET: MGM GER; 2.40A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1n4p_B* 1n4r_B* 1n4s_B* 1s64_B* 1tnb_B* 1tno_B* 1tnu_B* 1tny_B* 1tnz_B* Back     alignment and structure
>2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A Back     alignment and structure
>4fxk_B Complement C4-A alpha chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_B* Back     alignment and structure
>3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A Back     alignment and structure
>4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure
>3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* Back     alignment and structure
>2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* Back     alignment and structure
>3prx_B Cobra venom factor; immune system, complement, immune SYS complex; HET: NAG; 4.30A {Naja kaouthia} PDB: 3pvm_B* Back     alignment and structure
>3sdr_A Alpha-bisabolene synthase; lyase, terpene synthase; HET: 210; 1.86A {Abies grandis} PDB: 3sdq_A 3sae_A* 3sdt_A* 3sdu_A* 3sdv_A* Back     alignment and structure
>3s9v_A Abietadiene synthase, chloroplastic; alpha bundle/barrel, lyase, isomerase; 2.30A {Abies grandis} Back     alignment and structure
>2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... Back     alignment and structure
>3p5p_A Taxadiene synthase; class I and II terpene cyclase fold, diterpene cyclase, DDXX NSE/DTE motif, 3-azacopalyl diphosphate; HET: A3C; 1.82A {Taxus brevifolia} PDB: 3p5r_A* Back     alignment and structure
>3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A* Back     alignment and structure
>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} Back     alignment and structure
>2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* Back     alignment and structure
>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* Back     alignment and structure
>4fxk_B Complement C4-A alpha chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_B* Back     alignment and structure
>3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* Back     alignment and structure
>2pmv_A Gastric intrinsic factor; cobalamin transport protein alpha6-alpha6 motif two domain P transport protein; HET: NAG B12; 2.60A {Homo sapiens} PDB: 3kq4_A* Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure
>3prx_B Cobra venom factor; immune system, complement, immune SYS complex; HET: NAG; 4.30A {Naja kaouthia} PDB: 3pvm_B* Back     alignment and structure
>2pmv_A Gastric intrinsic factor; cobalamin transport protein alpha6-alpha6 motif two domain P transport protein; HET: NAG B12; 2.60A {Homo sapiens} PDB: 3kq4_A* Back     alignment and structure
>3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A Back     alignment and structure
>1ulv_A Glucodextranase; GH family 15, (alpha-alpha)6-barrel, SLH domain, hydrolase; HET: ACR; 2.42A {Arthrobacter globiformis} SCOP: a.102.1.5 b.1.18.2 b.1.9.3 b.30.5.5 PDB: 1ug9_A* Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1lf6_A Glucoamylase; (alpha/alpha) barrel, 6 alpha-helical hairpin torroid, super beta sandwich, carbohydrase family GH15; 2.10A {Thermoanaerobacteriumthermosaccharolyticum} SCOP: a.102.1.5 b.30.5.5 PDB: 1lf9_A* Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d1w6ka1448 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase { 3e-31
d2sqca1352 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cycla 2e-28
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 448 Back     information, alignment and structure

class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Terpenoid cyclases/Protein prenyltransferases
family: Terpene synthases
domain: Lanosterol synthase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  110 bits (277), Expect = 3e-31
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 1   NRSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMS 60
            +S +  T WAMM L+     +          + L+  QL  GD+PQ+ +   F  +C  
Sbjct: 361 AQSQIHNTCWAMMGLMAVRHPDI--EAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAI 418

Query: 61  HYPTYRNIFPTWALAEYRSKFQSPKI 86
            Y +YRNIFP WAL  +   +    +
Sbjct: 419 SYTSYRNIFPIWALGRFSQLYPERAL 444
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 352 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1w6ka1448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 99.97
d2sqca1352 Squalene-hopene cyclase {Alicyclobacillus acidocal 99.96
d2sqca1352 Squalene-hopene cyclase {Alicyclobacillus acidocal 98.65
d1w6ka1448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 98.35
d1c3da_294 C3D, a C3 fragment and ligand for complement recep 98.11
d1hzfa_326 C4adg fragment of complement factor C4a {Human (Ho 97.99
d2sqca2 271 Squalene-hopene cyclase {Alicyclobacillus acidocal 97.92
d1gxma_ 324 Polygalacturonic acid lyase (pectate lyase) {Cellv 97.91
d1r76a_ 408 Polygalacturonic acid lyase (pectate lyase) {Azosp 97.54
d2sqca2271 Squalene-hopene cyclase {Alicyclobacillus acidocal 97.39
d1w6ka2 279 Lanosterol synthase {Human (Homo sapiens) [TaxId: 96.92
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azosp 96.68
d3dssb1 325 Rab geranylgeranyltransferase, beta subunit {Rat ( 96.37
d1lf6a1 397 Bacterial glucoamylase, C-terminal domain {Thermoa 96.1
d3dssb1 325 Rab geranylgeranyltransferase, beta subunit {Rat ( 96.03
d1ulva1 413 Glucodextranase, domain A {Arthrobacter globiformi 95.95
d2h6fb1401 Protein farnesyltransferase, beta-subunit {Human ( 94.99
d1hzfa_ 326 C4adg fragment of complement factor C4a {Human (Ho 94.85
d1w6ka2 279 Lanosterol synthase {Human (Homo sapiens) [TaxId: 94.54
d2h6fb1 401 Protein farnesyltransferase, beta-subunit {Human ( 93.44
d1gxma_324 Polygalacturonic acid lyase (pectate lyase) {Cellv 93.36
d1n4qb_ 346 Protein farnesyltransferase, beta-subunit {Rat (Ra 89.34
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 89.25
d1n4qb_ 346 Protein farnesyltransferase, beta-subunit {Rat (Ra 87.77
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 85.96
d1fp3a_ 402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 85.72
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 85.59
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 84.54
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 84.13
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 83.88
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 83.53
d1c3da_ 294 C3D, a C3 fragment and ligand for complement recep 83.1
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Terpenoid cyclases/Protein prenyltransferases
family: Terpene synthases
domain: Lanosterol synthase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=7.6e-33  Score=214.64  Aligned_cols=83  Identities=31%  Similarity=0.689  Sum_probs=78.2

Q ss_pred             CchHhhHHHHHHHHHHhCCCCCCchHHHHHHHHHHHhcccCCCCCCccccccccccccccCCCchhHHhHHHHHHHHHhh
Q 043877            2 RSNLVQTSWAMMALIHAGQMERGPTPLHHAAKLLINSQLGEGDFPQQELTRAFMGNCMSHYPTYRNIFPTWALAEYRSKF   81 (87)
Q Consensus         2 ~st~~qTaWAL~aLlaag~~~~~~~~i~Rgv~~Ll~~Q~~dG~W~e~~~~G~f~~~~~i~Y~~Y~~~fPl~ALg~y~~~~   81 (87)
                      .|+++|||||||||+++++++  +++|+|||+||+++|++||+|+|+.++|+||++|||+||+|+++|||||||||++++
T Consensus       362 ~s~~~~TAwAl~aL~~ag~~~--~~~v~rgv~~L~~~Q~~~G~W~~~~~~g~f~~~~~l~Y~~Y~~~fpl~AL~ry~~~~  439 (448)
T d1w6ka1         362 QSQIHNTCWAMMGLMAVRHPD--IEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLY  439 (448)
T ss_dssp             SCCHHHHHHHHHHHHHTTCSC--HHHHHHHHHHHHHHCCTTSCCCCCSCCEEETTTEEECCTTHHHHHHHHHHHHHHHHC
T ss_pred             CCcHHHHHHHHHHHHhcCCCC--cHHHHHHHHHHHHccCCCCCCCCCceeeeecccceeecCCcchHHHHHHHHHHHHhC
Confidence            589999999999999999874  468999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCC
Q 043877           82 QSPKI   86 (87)
Q Consensus        82 ~~~~~   86 (87)
                      ++.++
T Consensus       440 ~~~~~  444 (448)
T d1w6ka1         440 PERAL  444 (448)
T ss_dssp             TTSGG
T ss_pred             Ccccc
Confidence            87653
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c3da_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lf6a1 a.102.1.5 (A:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} Back     information, alignment and structure
>d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Back     information, alignment and structure
>d1n4qb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4qb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c3da_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure