Citrus Sinensis ID: 043908

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460--
MSCCGHHSSTSVIVIDEIDEKALPALLLVLFGTSHRNLARIIEAAAAATGPPFMVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVKAFKSHRPVGDYVELSERVLKDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVDGRNKLQMHDLLQELGQLIVTRQFPEEPGKRSRIWREEEVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSFRGCNGPPSSASCYLLFPINLMLRSSDLGALMLPSLSELEDCKRLQSQPQLPPNVTEVRVNGCASLVTLLGALKLRKSSRTIIDCVDSLKLLGKNGLAISMLREYLEAVSDPDDKLSIVVPGSEIPKWFTYQNEGSSITVTRPSYLYNMNKVVGYAVCYVFHVPKHSTGIRRLLWNPDPTFMLVIDSSICDLNSKRFSI
cccccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccHHcccccccccccccHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHccccccccHHHHcccccEEEEcccEEEcccHHHHHHHHHHHHHcccccccccccccccccHHHHHcccccEEEccccccccccccccccccccccEEEEEccccccccccEEccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccccccHHHHHHHHHHHHcccccccEEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEEEccccccccccccccccccEEEEccccEEEcccccccc
cccccccccEEEEHHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHcccccHHHHHHEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHcEEEEEcccccEEHHHHHHHHHHHHHHcccccccccccEcccHHHHHHHHHHccccEEEEccccccHcccHHHHHHcHcccEEEEccccHHcccccHccccccccccHcHHHccccccHHHcccHHHHHHcccEEEccccccccccccccccccEEEcccccccEEccccccccccEEEEcccccHHccccHHHHHHHHHHHHcccccccccccEEEcccccccHHEEEcccccEEEEEcccccccccccccEEEEEEEEcccccccccEEEEccccccEEEEcccccccccccccc
msccghhsstsvIVIDEIDEKALPALLLVLFGTSHRNLARIIEAAAaatgppfmvedrSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLvahevdeehildldvlnndeALQFFSVkafkshrpvgdyvELSERVLKDRDYVAKILegcgfspviGIEVLIEksrltvdgrNKLQMHDLLQELGQLIvtrqfpeepgkrsriwreeevplsiEHLSGLVQLTLKgcknlsslpatISSLKSLRTLELSGCSKLKNLKalsfrgcngppssascyllfpinlmlrssdlgalmlpslseledckrlqsqpqlppnvtevRVNGCASLVTLLGALklrkssrtIIDCVDSLKLLGKNGLAISMLREYLEavsdpddklsivvpgseipkwftyqnegssitvtrpsylynmnKVVGYAVCYVFhvpkhstgirrllwnpdptfmLVIDSsicdlnskrfsi
MSCCGHHSSTSVIVIDEIDEKALPALLLVLFGTSHRNLARIIEAAaaatgppfmVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVkafkshrpvgdyvelservLKDRDYVAKILegcgfspviGIEVLIEKSRLTVDGRNKLQMHDLLQELgqlivtrqfpeepgkrsriwreeEVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSFRGCNGPPSSASCYLLFPINLMLRSSDLGALMLPSLSELEDCKRLQSQPQLPPNVTEVRVNGCASLVTLLGalklrkssrtiIDCVDSLKLLGKNGLAISMLREYLEavsdpddklsIVVPGseipkwftyqnegssitvTRPSYLYNMNKVVGYAVCYVFHVPKHSTGIRRLLWNPDPTFMLVIdssicdlnskrfsi
MSCCGHHSSTSVIVIDEIDEKALPALLLVLFGTSHRNLARIIEaaaaaTGPPFMVEDRSDRILTLFTTLKVAPIMaaaaaGILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVKAFKSHRPVGDYVELSERVLKDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVDGRNKLQMHDLLQELGQLIVTRQFPEEPGKRSRIWREEEVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSFRGCNGPPSSASCYLLFPINLMLRSSDLGALMLPSLSELEDCKRLQSQPQLPPNVTEVRVNGCASLVTLLGALKLRKSSRTIIDCVDSLKLLGKNGLAISMLREYLEAVSDPDDKLSIVVPGSEIPKWFTYQNEGSSITVTRPSYLYNMNKVVGYAVCYVFHVPKHSTGIRRLLWNPDPTFMLVIDSSICDLNSKRFSI
*********TSVIVIDEIDEKALPALLLVLFGTSHRNLARIIEAAAAATGPPFMVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVKAFKSHRPVGDYVELSERVLKDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVDGRNKLQMHDLLQELGQLIVTRQF********RIWREEEVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSFRGCNGPPSSASCYLLFPINLMLRSSDLGALMLPSL******************VTEVRVNGCASLVTLLGALKLRKSSRTIIDCVDSLKLLGKNGLAISMLREYLEAVSDPDDKLSIVVPGSEIPKWFTYQNEGSSITVTRPSYLYNMNKVVGYAVCYVFHVPKHSTGIRRLLWNPDPTFMLVIDSSICDL*******
*SC****SSTSVIVIDEIDEKALPALLLVLFGTSHRNLARIIEAAAAATGPPFMVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVKAFKSHRPVGDYVELSERVLKDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVDGRNKLQMHDLLQELGQLIVTRQFPEEPGKRSRIWREEEVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSFRGCNGPPSSASCYLLFPINLMLRSSDLGALMLPSLSELEDCKRLQSQPQLPPNVTEVRVNGCASLVTLLGALKLRKSSRTIIDCVDSLKLLG******SMLREYLEAVSDPDDKLSIVVPGSEIPKWFTYQNEGSSITVTRPSYLYNMNKVVGYAVCYVFHVPKHSTGIRRLLWNPDPTFMLVIDSSICDLNSKRFSI
*********TSVIVIDEIDEKALPALLLVLFGTSHRNLARIIEAAAAATGPPFMVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVKAFKSHRPVGDYVELSERVLKDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVDGRNKLQMHDLLQELGQLIVTRQFPEEPGKRSRIWREEEVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSFRGCNGPPSSASCYLLFPINLMLRSSDLGALMLPSLSELEDCKRLQSQPQLPPNVTEVRVNGCASLVTLLGALKLRKSSRTIIDCVDSLKLLGKNGLAISMLREYLEAVSDPDDKLSIVVPGSEIPKWFTYQNEGSSITVTRPSYLYNMNKVVGYAVCYVFHVPKHSTGIRRLLWNPDPTFMLVIDSSICDLNSKRFSI
*****HHSSTSVIVIDEIDEKALPALLLVLFGTSHRNLARIIEAAAAATGPPFMVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVKAFKSHRPVGDYVELSERVLKDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVDGRNKLQMHDLLQELGQLIVTRQFPEEPGKRSRIWREEEVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSFRGCNGPPSSASCYLLFPINLMLRSSDLGALMLPSLSELEDCKRLQSQPQLPPNVTEVRVNGCASLVTLLGALKLRKSSRTIIDCVDSLKLLGKNGLAISMLREYLEAVSDPDDKLSIVVPGSEIPKWFTYQNEGSSITVTRPSYLYNMNKVVGYAVCYVFHVPKHSTGIRRLLWNPDPTFMLVIDSSICDLNSKRF**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCCGHHSSTSVIVIDEIDEKALPALLLVLFGTSHRNLARIIEAAAAATGPPFMVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVKAFKSHRPVGDYVELSERVLKDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVDGRNKLQMHDLLQELGQLIVTRQFPEEPGKRSRIWREEEVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSFRGCNGPPSSASCYLLFPINLMLRSSDLGALMLPSLSELEDCKRLQSQPQLPPNVTEVRVNGCASLVTLLGALKLRKSSRTIIDCVDSLKLLGKNGLAISMLREYLEAVSDPDDKLSIVVPGSEIPKWFTYQNEGSSITVTRPSYLYNMNKVVGYAVCYVFHVPKHSTGIRRLLWNPDPTFMLVIDSSICDLNSKRFSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query462 2.2.26 [Sep-21-2011]
Q40392 1144 TMV resistance protein N N/A no 0.402 0.162 0.297 5e-14
Q9FL92 1372 Probable WRKY transcripti no no 0.201 0.067 0.362 8e-12
Q9SZ67 1895 Probable WRKY transcripti no no 0.257 0.062 0.325 1e-09
O82500 1095 Putative disease resistan no no 0.458 0.193 0.258 2e-06
Q9FH83 1288 Probable WRKY transcripti no no 0.261 0.093 0.284 7e-06
O23530 1301 Protein SUPPRESSOR OF npr no no 0.543 0.192 0.256 4e-05
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 105/212 (49%), Gaps = 26/212 (12%)

Query: 140 KDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVDGRNKLQMHDLLQELGQLIVTRQFPEEP 199
           +++DY+ +ILE C      G+ +LI+KS + +   N++QMHDL+Q++G+ IV   F ++P
Sbjct: 448 EEKDYILQILESCHIGAEYGLRILIDKSLVFISEYNQVQMHDLIQDMGKYIVN--FQKDP 505

Query: 200 GKRSRIWREEEVPLSIEHLSGLVQLTLKGCKNLSSL----PATISSLKSLRTLELSGCSK 255
           G+RSR+W  +EV   + + +G + +      + SS        + ++K LR   +   S 
Sbjct: 506 GERSRLWLAKEVEEVMSNNTGTMAMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSST 565

Query: 256 LKNLKAL-----SFRGCNGP----PSSASCYLLFPINLMLRSSDLGALM-----LPSLS- 300
              +  L      F   N P    PS+    +L  ++L LR + L  L      LPSL  
Sbjct: 566 HYAIDYLPNNLRCFVCTNYPWESFPSTFELKML--VHLQLRHNSLRHLWTETKHLPSLRR 623

Query: 301 -ELEDCKRLQSQPQLP--PNVTEVRVNGCASL 329
            +L   KRL   P     PN+  V +  C++L
Sbjct: 624 IDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNL 655
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query462
147778859 784 hypothetical protein VITISV_038484 [Viti 0.699 0.411 0.298 1e-33
224127726 1203 tir-nbs-lrr resistance protein [Populus 0.525 0.201 0.302 9e-28
224146780540 predicted protein [Populus trichocarpa] 0.495 0.424 0.312 8e-27
255569044 642 hypothetical protein RCOM_0740700 [Ricin 0.528 0.380 0.328 1e-26
224104273 1033 tir-nbs-lrr resistance protein [Populus 0.454 0.203 0.331 7e-26
105922631 1336 TIR-NBS-LRR-TIR type disease resistance 0.454 0.157 0.331 8e-26
224114295350 predicted protein [Populus trichocarpa] 0.515 0.68 0.328 5e-25
224114331 1119 tir-nbs-lrr resistance protein [Populus 0.454 0.187 0.319 7e-25
224108373 1279 tir-nbs-lrr resistance protein [Populus 0.437 0.157 0.328 1e-24
224116210 1017 tir-nbs-lrr resistance protein [Populus 0.458 0.208 0.327 1e-24
>gi|147778859|emb|CAN73697.1| hypothetical protein VITISV_038484 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  150 bits (379), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 125/419 (29%), Positives = 187/419 (44%), Gaps = 96/419 (22%)

Query: 82  ILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVKAFKSHRPVGDYVELSERVL-- 139
           I+ITTR++QLLV H V+E  + +++ LN+D A++ FS  AFK   P+ DYVELS+ ++  
Sbjct: 315 IIITTRNKQLLVTHGVNE--VYEVEKLNDDNAVELFSRYAFKKAHPIDDYVELSQCIVVY 372

Query: 140 ---------------------------KDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVD 172
                                       D+ YV +I   CGF P IGI VLIEKS ++V 
Sbjct: 373 AQGLPLALQVLDNERDIFLDIACFFQGHDKXYVMEIFRSCGFFPDIGIRVLIEKSLISV- 431

Query: 173 GRNKLQMHDLLQELGQLIVTRQFPEEPGKRSRIWREEEVPLSIEHLSGL-----VQLTLK 227
             NKL +H+LLQ++G+ IV    P+EPGK SR+W  ++V   +   +G      + L L 
Sbjct: 432 VENKLMIHNLLQKMGREIVREASPKEPGKXSRLWIHDDVNHVLTKNTGTKDVEGISLDLS 491

Query: 228 GCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSF----------------------- 264
             K ++      + +  LR L++    K  NLK   F                       
Sbjct: 492 SLKEINFTNEAFAPMNRLRLLKVLENLKFMNLKHSKFLTETLDFSRVTNLERLSSLKTLS 551

Query: 265 -RGCN----------GPPSSASCYLLFPINLMLRSSDLGALMLPSLSELEDCKRLQSQPQ 313
              CN          G  SS     L   N +   S++  L    +  LE+CKRLQ+ P+
Sbjct: 552 LSACNISDGATLDSLGFLSSLEDLDLSENNFVTLPSNIXRLPXLKMLGLENCKRLQALPE 611

Query: 314 LPPNVTEVRVNGCASLVTL----LGALKLRKSSRTIIDCVDSLKLLGKNGLAISMLREYL 369
           LP ++  +    C SL T+     G+L +    +  I C      + ++GL +       
Sbjct: 612 LPTSIRSIMARNCTSLETISNQSFGSLLMTVRLKEHIYCP-----INRDGLLVP------ 660

Query: 370 EAVSDPDDKLSIVVPGSEIPKWFTYQNEGSSITVTRPSYLYNMNKVVGYAVCYVFHVPK 428
                    LS V  GS IP W  YQ+ G  +    P   +B N  +G A+C V  VP+
Sbjct: 661 --------ALSAVXFGSRIPDWIRYQSSGXEVKAELPPNWFBSN-FLGLALC-VVTVPR 709

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224146780|ref|XP_002336335.1| predicted protein [Populus trichocarpa] gi|222834747|gb|EEE73210.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255569044|ref|XP_002525491.1| hypothetical protein RCOM_0740700 [Ricinus communis] gi|223535170|gb|EEF36849.1| hypothetical protein RCOM_0740700 [Ricinus communis] Back     alignment and taxonomy information
>gi|224104273|ref|XP_002333965.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222839252|gb|EEE77603.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|105922631|gb|ABF81427.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114295|ref|XP_002332392.1| predicted protein [Populus trichocarpa] gi|222832715|gb|EEE71192.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114331|ref|XP_002332400.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832723|gb|EEE71200.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224108373|ref|XP_002333401.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222836441|gb|EEE74848.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116210|ref|XP_002331988.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832112|gb|EEE70589.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query462
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.389 0.151 0.290 3.1e-17
TAIR|locus:2155347 1372 TTR1 "TOLERANT TO TOBACCO RING 0.151 0.051 0.447 2.1e-15
TAIR|locus:2153072 1229 AT5G51630 [Arabidopsis thalian 0.112 0.042 0.471 3.8e-15
TAIR|locus:2115870 1234 AT4G08450 [Arabidopsis thalian 0.458 0.171 0.268 1.2e-14
TAIR|locus:2122199 1607 AT4G36140 [Arabidopsis thalian 0.103 0.029 0.448 1.9e-14
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.170 0.050 0.329 2.1e-14
TAIR|locus:2175075 1068 AT5G41750 [Arabidopsis thalian 0.383 0.165 0.248 1e-13
TAIR|locus:2153368697 AT5G45210 [Arabidopsis thalian 0.151 0.100 0.346 1.2e-13
TAIR|locus:2167457 1191 AT5G36930 [Arabidopsis thalian 0.361 0.140 0.343 1.2e-13
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.261 0.099 0.330 2e-13
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 173 (66.0 bits), Expect = 3.1e-17, Sum P(3) = 3.1e-17
 Identities = 57/196 (29%), Positives = 99/196 (50%)

Query:   210 EVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLKNLKALSFRGCNG 269
             E+P +IE+ + L  L L GC NL  LP++I ++ +L++L L+GCS LK L +L     N 
Sbjct:   862 ELPFTIENATNLDTLYLDGCSNLLELPSSIWNITNLQSLYLNGCSSLKELPSLVENAINL 921

Query:   270 PPSSA-SCYLLFPI-NLMLRSSDLGALMLPSLSELEDCKRLQSQPQLPPNVTEVRVNGCA 327
                S   C  L  + + + R S+L  L + + S L +   L S P +P ++  +    C 
Sbjct:   922 QSLSLMKCSSLVELPSSIWRISNLSYLDVSNCSSLLELN-LVSHPVVPDSLI-LDAGDCE 979

Query:   328 SLVTLLGALKLRKSSRTIIDCVDSLKLLGKNGLAISMLREYLEAVSDPDDKLSIVVPGSE 387
             SLV  L      ++ + +++  +  KL   N       +E  + +       + ++PG +
Sbjct:   980 SLVQRLDCFF--QNPKIVLNFANCFKL---N-------QEARDLIIQTSACRNAILPGEK 1027

Query:   388 IPKWFTYQNEGSSITV 403
             +P +FTY+  G S+TV
Sbjct:  1028 VPAYFTYRATGDSLTV 1043
GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0042742 "defense response to bacterium" evidence=IMP
TAIR|locus:2155347 TTR1 "TOLERANT TO TOBACCO RINGSPOT NEPOVIRUS 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122199 AT4G36140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153368 AT5G45210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01250006
tir-nbs-lrr resistance protein (1203 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query462
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-07
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.004
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 52.2 bits (125), Expect = 4e-07
 Identities = 56/225 (24%), Positives = 86/225 (38%), Gaps = 70/225 (31%)

Query: 210 EVPLSIEHLSGLVQLTLKGCKNLSSLPATISSLKSLRTLELSGCSKLK------------ 257
           E+P SI++L  L  L ++ C NL +LP  I +L+SL +L+LSGCS+L+            
Sbjct: 793 ELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDISTNISDL 851

Query: 258 ------------------NLKALSFRGCNGPPSSASCYLLFPINLMLRSSDLGALMLPSL 299
                             NL  L   GCN              NL   S ++  L     
Sbjct: 852 NLSRTGIEEVPWWIEKFSNLSFLDMNGCN--------------NLQRVSLNISKLKHLET 897

Query: 300 SELEDCKRLQSQPQLPPNVTEVRVNGCASLVTLLGALKLRKSSRTI-IDCVDSLKLLGKN 358
            +  DC  L          TE   NG  S V +       K   T+ I+ ++   L    
Sbjct: 898 VDFSDCGAL----------TEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNL---- 943

Query: 359 GLAISMLREYLEAVSDPD-DKLSIVVPGSEIPKWFTYQNEGSSIT 402
                      EA+         +++ G E+P +FT++  G+S+T
Sbjct: 944 ---------DQEALLQQQSIFKQLILSGEEVPSYFTHRTTGASLT 979

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 462
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.97
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.51
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.58
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.3
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.29
KOG0617264 consensus Ras suppressor protein (contains leucine 98.07
PRK15386 426 type III secretion protein GogB; Provisional 97.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.87
PRK15386 426 type III secretion protein GogB; Provisional 97.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.7
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.6
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.59
KOG0617264 consensus Ras suppressor protein (contains leucine 97.52
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.41
PLN03150623 hypothetical protein; Provisional 97.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.27
PLN03150623 hypothetical protein; Provisional 97.26
KOG0472 565 consensus Leucine-rich repeat protein [Function un 97.14
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.14
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.9
PF05729166 NACHT: NACHT domain 96.85
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.46
PRK06893229 DNA replication initiation factor; Validated 96.11
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.75
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 95.56
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 95.51
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 95.48
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.6
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 94.59
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 94.57
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 94.56
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 94.42
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 94.24
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 93.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 93.31
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 92.48
KOG1259490 consensus Nischarin, modulator of integrin alpha5 92.4
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.13
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 90.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 90.62
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.86
KOG4237498 consensus Extracellular matrix protein slit, conta 89.61
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 88.83
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 88.5
PF13173128 AAA_14: AAA domain 88.42
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 86.06
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 85.69
PRK04841 903 transcriptional regulator MalT; Provisional 85.37
PRK09087226 hypothetical protein; Validated 85.18
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 84.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 83.95
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 83.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 82.87
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 80.84
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=1.3e-44  Score=415.30  Aligned_cols=178  Identities=26%  Similarity=0.400  Sum_probs=148.2

Q ss_pred             HHHHHHHhCCC---hhHHHHHHHHHHhcCCCcEEEEeCCCCcchhHHHhhcCCCCCCCCeEEEEEeCChhHHHHcCCCCc
Q 043908           24 PALLLVLFGTS---HRNLARIIEAAAAATGPPFMVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHEVDEE  100 (462)
Q Consensus        24 ~~~l~~~~~~~---~~~l~~i~~~~~~~~Kr~LLVLDDVw~~~~~~e~L~~~~~~~~~GSrIIvTTR~~~V~~~~~~~~~  100 (462)
                      ++++.+.++..   ..++..+. +.+. +||+||||||||+..+ |+.+++...|+++|||||||||+++|+..++++. 
T Consensus       269 ~~~l~~il~~~~~~~~~~~~~~-~~L~-~krvLLVLDdv~~~~~-l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~-  344 (1153)
T PLN03210        269 RAFLSEILDKKDIKIYHLGAME-ERLK-HRKVLIFIDDLDDQDV-LDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDH-  344 (1153)
T ss_pred             HHHHHHHhCCCCcccCCHHHHH-HHHh-CCeEEEEEeCCCCHHH-HHHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCe-
Confidence            44455554432   22333343 3444 7999999999999998 9999999999999999999999999999998887 


Q ss_pred             ceEecCCCCHHHHHHHHHHhhhCCCCCCccHHHHHHHHh-----------------------------------------
Q 043908          101 HILDLDVLNNDEALQFFSVKAFKSHRPVGDYVELSERVL-----------------------------------------  139 (462)
Q Consensus       101 ~~y~v~~L~~~es~~LF~~~af~~~~~~~~~~~l~~~Iv-----------------------------------------  139 (462)
                       +|+|+.|+++|||+||+++||++..+++++++++++|+                                         
T Consensus       345 -~~~v~~l~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I~  423 (1153)
T PLN03210        345 -IYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIE  423 (1153)
T ss_pred             -EEEecCCCHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHHH
Confidence             99999999999999999999998878888999999988                                         


Q ss_pred             ----------------------------cChhHHHHHHHhCCCCCcccHHHHhccCceeEeCCCeEeecHHHHHHHHHHh
Q 043908          140 ----------------------------KDRDYVAKILEGCGFSPVIGIEVLIEKSRLTVDGRNKLQMHDLLQELGQLIV  191 (462)
Q Consensus       140 ----------------------------~~~~~l~~il~~~g~~~~~~i~~L~~~sLi~~~~~~~~~MHdLl~~~~~~i~  191 (462)
                                                  .+.+++..++..+|+.+..+++.|+++||++++ .++++|||++|+||++++
T Consensus       424 ~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~-~~~~~MHdLl~~~~r~i~  502 (1153)
T PLN03210        424 KTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVR-EDIVEMHSLLQEMGKEIV  502 (1153)
T ss_pred             HHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEc-CCeEEhhhHHHHHHHHHH
Confidence                                        334555566666777778889999999999998 689999999999999999


Q ss_pred             ccCCCCCCCcccccccc
Q 043908          192 TRQFPEEPGKRSRIWRE  208 (462)
Q Consensus       192 ~~e~~~~~~~~~rL~~~  208 (462)
                      ++++ .+|++++|+|..
T Consensus       503 ~~~~-~~~~~r~~l~~~  518 (1153)
T PLN03210        503 RAQS-NEPGEREFLVDA  518 (1153)
T ss_pred             Hhhc-CCCCcceeEeCH
Confidence            8886 578888887764

syringae 6; Provisional
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query462
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 81.4 bits (200), Expect = 2e-16
 Identities = 74/448 (16%), Positives = 141/448 (31%), Gaps = 112/448 (25%)

Query: 101 HILDLDV----LNNDEALQFFSVKAFKSHRPVGDYVELSERVLKDRDYVAKILEGCGFSP 156
           H +D +         + L  F   AF  +    D  ++ + +L   + +  I+       
Sbjct: 5   HHMDFETGEHQYQYKDILSVF-EDAFVDNFDCKDVQDMPKSILSKEE-IDHIIMSK--DA 60

Query: 157 VIGIEVLIEKSRLTVDGRNKLQ--MHDLLQELGQLIVT--RQFPEEPG--------KRSR 204
           V G   L     L       +Q  + ++L+   + +++  +    +P         +R R
Sbjct: 61  VSGTLRLFWT--LLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDR 118

Query: 205 IWREEEV--PLSIEHLSGLVQLTLKGCKNLSSL-PATISSL-------KSLRTLELSGCS 254
           ++ + +V    ++  L   ++L     + L  L PA    +       K+   + L  C 
Sbjct: 119 LYNDNQVFAKYNVSRLQPYLKLR----QALLELRPAKNVLIDGVLGSGKT--WVALDVCL 172

Query: 255 KLKNLKA-------LSFRGCNGPPS-----SASCYLLFPINLMLRSSDLGALMLPSLSEL 302
             K           L+ + CN P +         Y + P N   RS     + L   S  
Sbjct: 173 SYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDP-NWTSRSDHSSNIKLRIHSIQ 231

Query: 303 EDCKRLQSQPQLPP------NVTEVRV-----NGCASLVT-----LLGALKLRKSSRTII 346
            + +RL              NV   +        C  L+T     +   L    ++   +
Sbjct: 232 AELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISL 291

Query: 347 DCV-------DSLKLLGKN-GLAISMLREYLEAVS-DPDDKLSIVVPGSEIPK------- 390
           D         +   LL K        L    E ++ +P     + +    I         
Sbjct: 292 DHHSMTLTPDEVKSLLLKYLDCRPQDLPR--EVLTTNP---RRLSIIAESIRDGLATWDN 346

Query: 391 WFTYQNE------GSSITVTRPSYLYNMNKVVGYAVCYVF----HVPKHSTGIRRLLWNP 440
           W     +       SS+ V  P+    M     +    VF    H+P   T +  L+W  
Sbjct: 347 WKHVNCDKLTTIIESSLNVLEPAEYRKM-----FDRLSVFPPSAHIP---TILLSLIWFD 398

Query: 441 DPTF--MLVID----SSICDLNSKRFSI 462
                 M+V++     S+ +   K  +I
Sbjct: 399 VIKSDVMVVVNKLHKYSLVEKQPKESTI 426
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query462
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.76
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.54
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.41
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.1
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.02
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.6
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.49
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.48
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.46
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.45
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.45
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.44
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.44
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.42
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.37
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.37
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.35
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.34
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.33
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.33
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.33
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.32
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.3
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.3
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.3
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.29
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.26
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.25
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.24
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.2
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.2
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.2
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.2
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.17
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.15
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.1
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.1
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.1
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.02
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.02
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.02
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.01
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.01
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.01
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.01
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.99
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.99
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.98
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.98
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.97
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.97
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.97
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.96
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.96
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.96
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 97.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.95
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.94
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.93
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.92
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.9
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.9
1o6v_A 466 Internalin A; bacterial infection, extracellular r 97.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.88
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.84
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.83
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.8
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.79
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.77
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.71
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.65
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.62
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.6
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.58
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.48
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.42
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.16
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 96.66
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.65
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 96.59
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 96.12
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 95.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 95.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 95.69
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 95.46
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.17
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.9
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 94.88
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 94.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 94.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.94
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 93.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 93.3
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 92.86
2fna_A357 Conserved hypothetical protein; structural genomic 92.69
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 92.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 91.64
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 90.39
2chg_A226 Replication factor C small subunit; DNA-binding pr 90.1
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 89.14
2v1u_A387 Cell division control protein 6 homolog; DNA repli 87.72
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 87.33
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 86.14
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 83.72
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 82.79
4fdw_A401 Leucine rich hypothetical protein; putative cell s 81.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 80.71
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.76  E-value=2.5e-18  Score=182.90  Aligned_cols=147  Identities=16%  Similarity=0.132  Sum_probs=107.3

Q ss_pred             HHHHHHHHHhcCC-CcEEEEeCCCCcchhHHHhhcCCCCCCCCeEEEEEeCChhHHHHcC-CCCcceEecCCCCHHHHHH
Q 043908           38 LARIIEAAAAATG-PPFMVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHE-VDEEHILDLDVLNNDEALQ  115 (462)
Q Consensus        38 l~~i~~~~~~~~K-r~LLVLDDVw~~~~~~e~L~~~~~~~~~GSrIIvTTR~~~V~~~~~-~~~~~~y~v~~L~~~es~~  115 (462)
                      +...++..+. +| ||||||||||+.++ + .+..     .+|||||||||++.|+..++ ...  +|+|++|+.+|||+
T Consensus       231 l~~~l~~~L~-~~kr~LlVLDdv~~~~~-~-~~~~-----~~gs~ilvTTR~~~v~~~~~~~~~--~~~l~~L~~~ea~~  300 (549)
T 2a5y_B          231 LKRMICNALI-DRPNTLFVFDDVVQEET-I-RWAQ-----ELRLRCLVTTRDVEISNAASQTCE--FIEVTSLEIDECYD  300 (549)
T ss_dssp             HHHHHHHHHT-TSTTEEEEEEEECCHHH-H-HHHH-----HTTCEEEEEESBGGGGGGCCSCEE--EEECCCCCHHHHHH
T ss_pred             HHHHHHHHHc-CCCcEEEEEECCCCchh-h-cccc-----cCCCEEEEEcCCHHHHHHcCCCCe--EEECCCCCHHHHHH
Confidence            4555555555 64 99999999999886 4 2221     27999999999999999886 334  89999999999999


Q ss_pred             HHHHhhhCCCCCCccHHHHHHHHh--------------------------------------------------------
Q 043908          116 FFSVKAFKSHRPVGDYVELSERVL--------------------------------------------------------  139 (462)
Q Consensus       116 LF~~~af~~~~~~~~~~~l~~~Iv--------------------------------------------------------  139 (462)
                      ||.++||+... .+++.+++++|+                                                        
T Consensus       301 Lf~~~a~~~~~-~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~w~~~~~l~~~l~~~~~~~i~~~l~~Sy~~L~~~lk  379 (549)
T 2a5y_B          301 FLEAYGMPMPV-GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQ  379 (549)
T ss_dssp             HHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHH
T ss_pred             HHHHHhcCCCC-chhHHHHHHHHHHHhCCChHHHHHHHHHhccchHHHHHHhHHHhhcccHHHHHHHHhcccccccHHHH
Confidence            99999997532 356777777777                                                        


Q ss_pred             -------------------cChhH--HHHHHHhC--CCCCccc-----------HHHHhccCceeEeCC---CeEeecHH
Q 043908          140 -------------------KDRDY--VAKILEGC--GFSPVIG-----------IEVLIEKSRLTVDGR---NKLQMHDL  182 (462)
Q Consensus       140 -------------------~~~~~--l~~il~~~--g~~~~~~-----------i~~L~~~sLi~~~~~---~~~~MHdL  182 (462)
                                         +.+++  -+.+|.++  ||+...+           +++|+++||++....   ++++|||+
T Consensus       380 ~~f~~Ls~~er~l~~~ls~fp~~~~i~i~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~~~~~mHdl  459 (549)
T 2a5y_B          380 RCVEVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHI  459 (549)
T ss_dssp             HHHHTSCHHHHHHTTGGGSSCTTCCEEHHHHHHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEECSSSCEEECCHH
T ss_pred             HHHhccchhhhhHhhheeeeCCCCeeeeeeeeeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCceEEEeChH
Confidence                               00000  04566666  6665332           889999999998643   46999999


Q ss_pred             HHHHHHHHhccCC
Q 043908          183 LQELGQLIVTRQF  195 (462)
Q Consensus       183 l~~~~~~i~~~e~  195 (462)
                      +|++|++++.+++
T Consensus       460 v~~~a~~~~~~~~  472 (549)
T 2a5y_B          460 IHMFLKHVVDAQT  472 (549)
T ss_dssp             HHHHHHTTSCTHH
T ss_pred             HHHHHHHHHHHHH
Confidence            9999999887664
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 462
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 40.5 bits (93), Expect = 3e-04
 Identities = 11/63 (17%), Positives = 23/63 (36%), Gaps = 13/63 (20%)

Query: 226 LKGCKNLSSLPATISSLKSLRTLELSGC---------SKLKNLKALSFRG----CNGPPS 272
           L+  +   +LP  ++ LK L +L +S             L+     ++      C  P  
Sbjct: 251 LRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP 310

Query: 273 SAS 275
           + +
Sbjct: 311 ACT 313

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query462
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.49
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.38
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.28
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.23
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.22
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.21
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.11
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.07
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.91
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.87
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.86
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.86
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.85
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.8
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.78
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.69
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.63
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.46
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.44
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.18
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 96.78
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.45
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 88.42
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 88.2
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 87.96
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 81.72
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.49  E-value=5.3e-14  Score=134.30  Aligned_cols=88  Identities=16%  Similarity=0.134  Sum_probs=69.2

Q ss_pred             HHHHHhcCCCcEEEEeCCCCcchhHHHhhcCCCCCCCCeEEEEEeCChhHHHHcCCCCcceEecCCCCHHHHHHHHHHhh
Q 043908           42 IEAAAAATGPPFMVEDRSDRILTLFTTLKVAPIMAAAAAGILITTRDRQLLVAHEVDEEHILDLDVLNNDEALQFFSVKA  121 (462)
Q Consensus        42 ~~~~~~~~Kr~LLVLDDVw~~~~~~e~L~~~~~~~~~GSrIIvTTR~~~V~~~~~~~~~~~y~v~~L~~~es~~LF~~~a  121 (462)
                      ++..+. +||+|+||||||+.++ |+.+.      ..|||||||||+++|+..+..+. ++|+|++|+.+|||+||+++|
T Consensus       128 ~~~~L~-~kr~LlVLDDv~~~~~-~~~~~------~~~srilvTTR~~~v~~~~~~~~-~~~~l~~L~~~ea~~Lf~~~~  198 (277)
T d2a5yb3         128 CNALID-RPNTLFVFDDVVQEET-IRWAQ------ELRLRCLVTTRDVEISNAASQTC-EFIEVTSLEIDECYDFLEAYG  198 (277)
T ss_dssp             HHHHTT-STTEEEEEEEECCHHH-HHHHH------HTTCEEEEEESBGGGGGGCCSCE-EEEECCCCCHHHHHHHHHHTS
T ss_pred             HHHHhc-cCCeeEecchhhHHhh-hhhhc------ccCceEEEEeehHHHHHhcCCCC-ceEECCCCCHHHHHHHHHHHh
Confidence            333443 8999999999999998 87664      34899999999999999886652 389999999999999999999


Q ss_pred             hCCCCCCccHHHHHHHHh
Q 043908          122 FKSHRPVGDYVELSERVL  139 (462)
Q Consensus       122 f~~~~~~~~~~~l~~~Iv  139 (462)
                      |....+ +..++++++|+
T Consensus       199 ~~~~~~-~~~~~~~~~iv  215 (277)
T d2a5yb3         199 MPMPVG-EKEEDVLNKTI  215 (277)
T ss_dssp             CCCC---CHHHHHHHHHH
T ss_pred             CCccCc-hhhHHHHHHHH
Confidence            975443 34567766444
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure