Citrus Sinensis ID: 043910


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
GTEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLKELDADHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMASTTRWKQLYENLEKISYPERRGYVYVP
ccccEEEEEEEcccccEEEEcHHHHHccccccEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccEEEccccccEEccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccHHcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHccccccccHHHccccccccccccccccccc
cccEEEEEEEEccccccccccHHHHHHccccEEEEEEcccccccccEEcccccccccHHcEEEEccccccccccccccHHHHEEEcccccHHHHccccccccccccEEEcccccccccccccccccccccccEEEccccccHccccHHHHHHHHccEEEccccccEEccccHHHHHHHHEEEccccHHHHcccHHHcccHcccEEEccccccEEccccHcccccccEEEccccccccccHHHHHHHcccEEEccccccccccccccccccEEcccccccccEcccccccccccccEEEEccccHHccHHHHHHHHHHHHHHHHHHcccccccccccccHHccccccccEEEcc
GTEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYnssingenkckvsniqdpvfpeIRYLfwhgyplkslpsithpaklvllevphsniqqlgdggqhhcKLSQIITAARNfvtktpnpsfirSLNKLTilnlsgcsqlkrlpaeilsagnmEEMILNgtaieelpSSIECLSRLLHLglrdckrlkslpkglcklkSLKFLILNgcgitqlpenlgqlfsleEFCLrktkfekiptnvihLSRLHSFCLSYCErlqslpklpcnlkeldaDHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMASTTRWKQLYENLEkisyperrgyvyvp
gteeiegicldmskveEIHLYSDTFTKMRKLRFLKFYNssingenkckvsnIQDPVFPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLKELDADHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMASTTRWKQLYenlekisyperrgyvyvp
GTEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLKELDADHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMASTTRWKQLYENLEKISYPERRGYVYVP
*****EGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLKELDADHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMASTTRWKQLYENLEKISYPERRGYVY**
GTEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVS*IQDPVFPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLKELDADHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMAS*TR****YENLEKISYPERRGYVYVP
GTEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLKELDADHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMASTTRWKQLYENLEKISYPERRGYVYVP
*TEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLKELDADHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMASTTRWKQLYENLEKISYPERRGYVYV*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GTEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLKELDADHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMASTTRWKQLYENLEKISYPERRGYVYVP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query353 2.2.26 [Sep-21-2011]
O82500 1095 Putative disease resistan no no 0.818 0.263 0.317 6e-25
Q9SZ67 1895 Probable WRKY transcripti no no 0.796 0.148 0.299 9e-20
Q40392 1144 TMV resistance protein N N/A no 0.450 0.138 0.375 1e-15
Q9FH83 1288 Probable WRKY transcripti no no 0.739 0.202 0.297 3e-15
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.807 0.176 0.254 3e-15
Q9FL92 1372 Probable WRKY transcripti no no 0.705 0.181 0.303 9e-13
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.538 0.185 0.293 1e-12
P0CB16 1201 Putative disease resistan no no 0.586 0.172 0.274 2e-12
O235301301 Protein SUPPRESSOR OF npr no no 0.643 0.174 0.271 8e-12
Q9V780 849 Protein lap1 OS=Drosophil yes no 0.461 0.191 0.343 1e-11
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function desciption
 Score =  115 bits (287), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 106/334 (31%), Positives = 167/334 (50%), Gaps = 45/334 (13%)

Query: 1   GTEEIEGICLDMSKV-EEIHLYSDTFTKMRKLRFLKFYNSS-INGENKCKVSNIQDPV-- 56
           GT  + GI LDM ++ EE+++   TF +MR L +LKFY SS I+ + K K+   ++ +  
Sbjct: 525 GTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSY 584

Query: 57  FPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQI-ITAARNF 115
            P++R L W  YPL+  PS   P  LV L + HS +++L  G Q    L  + + ++RN 
Sbjct: 585 LPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNL 644

Query: 116 VTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTA----IEELPSS 171
               PN   +    KL  L+L  C  L  LP+ I    N++ +IL   +    +E +P++
Sbjct: 645 EI-LPN---LMEATKLNRLDLGWCESLVELPSSI---KNLQHLILLEMSCCKKLEIIPTN 697

Query: 172 IECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQL--------- 222
           I  L  L  L  R C RL++ P+    ++ L  +   G  IT++P ++            
Sbjct: 698 IN-LPSLEVLHFRYCTRLQTFPEISTNIRLLNLI---GTAITEVPPSVKYWSKIDEICME 753

Query: 223 -----------FSLEEFCLRKTK-FEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLK 270
                      + LE+ CLR+ K  E IP  + +L RL    +SYC  + SLPKLP ++ 
Sbjct: 754 RAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLPGSVS 813

Query: 271 ELDADHCAALESLSDLF---SISYDYYIRCFELS 301
            L A +C +L+ L   F   SI  + +I C +L 
Sbjct: 814 ALTAVNCESLQILHGHFRNKSIHLN-FINCLKLG 846





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query353
255537139 1137 leucine-rich repeat-containing protein, 0.923 0.286 0.340 1e-45
224127913 467 predicted protein [Populus trichocarpa] 0.764 0.578 0.4 1e-40
224145028 709 nbs-lrr resistance protein [Populus tric 0.705 0.351 0.426 2e-40
359495221 1181 PREDICTED: TMV resistance protein N-like 0.804 0.240 0.368 1e-39
147822714 1254 hypothetical protein VITISV_015601 [Viti 0.804 0.226 0.368 1e-39
359486073 1296 PREDICTED: TMV resistance protein N-like 0.807 0.219 0.358 3e-38
359486075 1291 PREDICTED: TMV resistance protein N-like 0.807 0.220 0.355 3e-38
225460354 1174 PREDICTED: TMV resistance protein N-like 0.708 0.212 0.349 6e-38
255537137 1034 leucine-rich repeat containing protein, 0.841 0.287 0.365 3e-37
147834354 1284 hypothetical protein VITISV_019700 [Viti 0.813 0.223 0.355 4e-37
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 137/402 (34%), Positives = 206/402 (51%), Gaps = 76/402 (18%)

Query: 1   GTEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGE----NKCKVSNIQDPV 56
           GTE IEG+CL+ S + +I L S+ F +M  LRFLKFY S I+G      K ++    D +
Sbjct: 521 GTETIEGMCLNTSMINKIELNSNAFGRMYNLRFLKFYQSYIHGGFKECTKIRLPQGLDSL 580

Query: 57  FPEIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDG--------------GQHH 102
             E+RYL WHGYPLKSLP+  H   LV+L +P+S +++L  G               Q  
Sbjct: 581 SNELRYLHWHGYPLKSLPARIHLMNLVVLVLPYSKVKRLWKGCKDLKKLKVIDLSYSQAL 640

Query: 103 CKLSQIITAAR-----------------------------NFVTKTPN-PSFIRSLNKLT 132
            +++++ TA+                              N+ TK  + PS I  L  L 
Sbjct: 641 IRITELTTASNLSYMKLSGCKNLRSMPSTTRWKSLSTLEMNYCTKLESLPSSICKLKSLE 700

Query: 133 ILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSL 192
            L+L GCS L+  P  + S   ++ ++LNGTAI+ELPSSIE L  L  + L +C+ L  L
Sbjct: 701 SLSLCGCSNLQSFPEILESMDRLKVLVLNGTAIKELPSSIERLKGLSSIYLENCRNLAHL 760

Query: 193 PKGLCKLKSLKFLILNGC-GITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLS----- 246
           P+  C LK+L +L L  C  + +LPE L  L +LE+  +      K+P+++ HLS     
Sbjct: 761 PESFCNLKALYWLFLTFCPKLEKLPEKLSNLTTLEDLSVGVCNLLKLPSHMNHLSCISKL 820

Query: 247 --------RLHSF-------CL--SYCERLQSLPKLPCNLKELDADHCAALESLSDLFSI 289
                   +L SF       CL  S C RL+SLP++P +L ++DA  C +LE++S L  I
Sbjct: 821 DLSGNYFDQLPSFKYLLNLRCLDISSCRRLRSLPEVPHSLTDIDAHDCRSLETISGLKQI 880

Query: 290 -----SYDYYIRCFELSTNYKLDRNELRSILEDALQKIQDMA 326
                ++ +Y +    ++ +K+D +     L DA   IQ +A
Sbjct: 881 FQLKYTHTFYDKKIIFTSCFKMDESAWSDFLADAQFWIQKVA 922




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224127913|ref|XP_002329208.1| predicted protein [Populus trichocarpa] gi|222870989|gb|EEF08120.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145028|ref|XP_002325500.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222862375|gb|EEE99881.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495221|ref|XP_002274238.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147822714|emb|CAN68293.1| hypothetical protein VITISV_015601 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537137|ref|XP_002509635.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223549534|gb|EEF51022.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147834354|emb|CAN69843.1| hypothetical protein VITISV_019700 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query353
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.730 0.204 0.362 1.2e-28
TAIR|locus:2175075 1068 AT5G41750 [Arabidopsis thalian 0.875 0.289 0.287 1.9e-28
TAIR|locus:2160472 1038 AT5G41540 [Arabidopsis thalian 0.866 0.294 0.300 1.3e-27
TAIR|locus:2175070 1114 AT5G41740 [Arabidopsis thalian 0.869 0.275 0.303 1.3e-26
TAIR|locus:2155189980 AT5G49140 [Arabidopsis thalian 0.793 0.285 0.299 1.7e-26
TAIR|locus:2136108 1095 AT4G11170 [Arabidopsis thalian 0.779 0.251 0.317 7.2e-26
TAIR|locus:2158475 1217 RPS4 "RESISTANT TO P. SYRINGAE 0.784 0.227 0.334 1.8e-25
TAIR|locus:2026624 1131 AT1G63750 [Arabidopsis thalian 0.813 0.253 0.296 4.2e-25
TAIR|locus:2164486 1104 AT5G40910 [Arabidopsis thalian 0.858 0.274 0.300 6.7e-25
TAIR|locus:2076043 1194 RPP1 "recognition of peronospo 0.770 0.227 0.287 5.4e-24
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 332 (121.9 bits), Expect = 1.2e-28, P = 1.2e-28
 Identities = 101/279 (36%), Positives = 148/279 (53%)

Query:     4 EIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDP----VFP- 58
             ++ G+ LDM +V+E+ L SDTF KM  LR+LKFYNS  + E + + S +  P      P 
Sbjct:   558 KVRGVYLDMFEVKEMGLDSDTFNKMDDLRYLKFYNSHCHRECEAEDSKLNFPEGLEFLPQ 617

Query:    59 EIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTK 118
             E+RYL W  YP K+LP    P  L+ L++P+S I+Q+ +  +    L  +     N  +K
Sbjct:   618 ELRYLNWLKYPEKNLPINFDPKNLIDLKLPYSQIEQIWEEEKDTSNLQWLDL---NHSSK 674

Query:   119 TPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEE-MILN--G-TAIEELPSSIEC 174
               + S +    KL  +NL GC+ LK LP ++L   NME  M LN  G T++E LP     
Sbjct:   675 LHSLSGLSRAQKLQSINLEGCTGLKTLP-QVLQ--NMESLMFLNLRGCTSLESLPDIT-- 729

Query:   175 LSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTK 234
             L  L  L L +C R K   K + K  +L+ L L+G  I +LP  +G L  L    L+  K
Sbjct:   730 LVGLRTLILSNCSRFKEF-KLIAK--NLEELYLDGTAIKELPSTIGDLQKLISLKLKDCK 786

Query:   235 -FEKIPTNVIHLSRLHSFCLSYCERLQSLPKLPCNLKEL 272
                 +P ++ +L  +    LS C  L+S P++  NLK L
Sbjct:   787 NLLSLPDSIGNLKAIQEIILSGCSSLESFPEVNQNLKHL 825


GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160472 AT5G41540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175070 AT5G41740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026624 AT1G63750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164486 AT5G40910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076043 RPP1 "recognition of peronospora parasitica 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01250001
hypothetical protein (467 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.02220007
annotation not avaliable (671 aa)
       0.460
eugene3.00190764
hypothetical protein (586 aa)
       0.460
eugene3.27720001
hypothetical protein (224 aa)
       0.455
eugene3.03590002
hypothetical protein (228 aa)
       0.455
fgenesh4_pg.C_LG_VI000128
hypothetical protein (228 aa)
       0.454
eugene3.02620001
hypothetical protein (209 aa)
       0.451
gw1.VI.2172.1
hypothetical protein (315 aa)
       0.437
eugene3.02170002
hypothetical protein (188 aa)
       0.414
eugene3.00150435
hypothetical protein (198 aa)
       0.411
fgenesh4_pg.C_LG_III000118
hypothetical protein (297 aa)
       0.410

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-29
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  117 bits (295), Expect = 8e-29
 Identities = 91/297 (30%), Positives = 148/297 (49%), Gaps = 22/297 (7%)

Query: 1   GTEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCK--VSNIQDPVFP 58
           GT+++ GI LD+ +++E+H++ + F  MR L FLKFY    + + + +  +    D + P
Sbjct: 530 GTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPP 589

Query: 59  EIRYLFWHGYPLKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTK 118
           ++R L W  YPL+ +PS   P  LV L++  S +++L DG      L  I       + +
Sbjct: 590 KLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKE 649

Query: 119 TPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTA-IEELPSSIECLSR 177
            P+ S   +L     L LS CS L  LP+ I     +E++ ++    +E LP+ I  L  
Sbjct: 650 IPDLSMATNLET---LKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGIN-LKS 705

Query: 178 LLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEK 237
           L  L L  C RLKS P       ++ +L L+   I + P NL +L +L+E  L + K EK
Sbjct: 706 LYRLNLSGCSRLKSFPD---ISTNISWLDLDETAIEEFPSNL-RLENLDELILCEMKSEK 761

Query: 238 IPTNVIHLSRL-----HSFCLSYCERLQSLPKLPC------NLKELDADHCAALESL 283
           +   V  L+ L      S    +   + SL +LP        L+ L+ ++C  LE+L
Sbjct: 762 LWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETL 818


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 353
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.65
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG4237498 consensus Extracellular matrix protein slit, conta 99.5
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.46
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.45
KOG4237498 consensus Extracellular matrix protein slit, conta 99.26
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.15
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.93
KOG4341483 consensus F-box protein containing LRR [General fu 98.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.79
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.75
PLN03150623 hypothetical protein; Provisional 98.73
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.72
PRK15386 426 type III secretion protein GogB; Provisional 98.7
KOG4341483 consensus F-box protein containing LRR [General fu 98.65
PLN03150623 hypothetical protein; Provisional 98.65
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.55
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.49
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.49
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.41
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.39
PRK15386 426 type III secretion protein GogB; Provisional 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.2
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.13
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.92
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.8
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.8
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.72
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.68
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.6
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.6
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.42
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.23
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.91
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.81
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.64
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.47
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.36
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.91
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.98
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.56
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.0
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 92.86
smart0037026 LRR Leucine-rich repeats, outliers. 89.08
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.08
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.74
KOG4308478 consensus LRR-containing protein [Function unknown 84.82
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.81
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.13
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.95  E-value=1.5e-26  Score=238.44  Aligned_cols=209  Identities=31%  Similarity=0.543  Sum_probs=170.0

Q ss_pred             CCCceEEEEEeCCCccccccCHHHHhcCCCCcEEEeeeCCCCCCccceeecCCCCCCCc--cceEeecccCCCCCCCCCC
Q 043910            1 GTEEIEGICLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPE--IRYLFWHGYPLKSLPSITH   78 (353)
Q Consensus         1 ~~~~~~~i~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~--L~~L~l~~~~~~~l~~~~~   78 (353)
                      |+..+++|.+|++..+...+..++|.+|++|+.|.+..+............+..+..++  |+.|+|.+++++.+|..+.
T Consensus       530 g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~  609 (1153)
T PLN03210        530 GTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFR  609 (1153)
T ss_pred             ccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCCCcCC
Confidence            67889999999999999999999999999999999987653322222244566666655  9999999999999999889


Q ss_pred             CCCceEEEccCCCccccCCCCcCCCCccEEecCCCcCcCCCCCCccccCCccCcEEeecCCCCCcccchhhhcCCCccEE
Q 043910           79 PAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEM  158 (353)
Q Consensus        79 ~~~L~~L~L~~~~i~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L  158 (353)
                      +++|+.|+++++.++.++.+...+++|+.+++++++.++.++   .++.+++|++|++++|.....+|..+..+++|+.|
T Consensus       610 ~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip---~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L  686 (1153)
T PLN03210        610 PENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIP---DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDL  686 (1153)
T ss_pred             ccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCC---ccccCCcccEEEecCCCCccccchhhhccCCCCEE
Confidence            999999999999999999988999999999999998776554   47788999999999999999999999999999999


Q ss_pred             EccCc-cCcccCccccCCCCCCEEeccCCCCCcccCccccCCCCCCEEEeeCccCCccC
Q 043910          159 ILNGT-AIEELPSSIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLP  216 (353)
Q Consensus       159 ~l~~~-~i~~l~~~~~~l~~L~~L~l~~~~~~~~l~~~~~~l~~L~~L~l~~~~i~~~~  216 (353)
                      ++++| .++.+|..+ .+++|++|++++|..+..+|..   ..+|+.|++++|.+..+|
T Consensus       687 ~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP  741 (1153)
T PLN03210        687 DMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFP  741 (1153)
T ss_pred             eCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCcccccc
Confidence            99997 566888755 6889999999988776665532   234455555555444333



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 4e-07
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 3e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 5e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 38/139 (27%), Positives = 60/139 (43%), Gaps = 15/139 (10%) Query: 139 CSQLKRLPAEILSAGNMEEMILNGTAIEELPSSIECLSRLLHLGLRDCKRLKSLP----- 193 + L LP +E + L + LP+SI L+RL L +R C L LP Sbjct: 113 AAGLXELPDTXQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLAS 172 Query: 194 -------KGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLS 246 +GL L+SL+ L GI LP ++ L +L+ +R + + + HL Sbjct: 173 TDASGEHQGLVNLQSLR---LEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLP 229 Query: 247 RLHSFCLSYCERLQSLPKL 265 +L L C L++ P + Sbjct: 230 KLEELDLRGCTALRNYPPI 248
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  122 bits (308), Expect = 3e-32
 Identities = 58/272 (21%), Positives = 95/272 (34%), Gaps = 37/272 (13%)

Query: 23  DTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPEIRYLFWHGYPLKSLP-SITHPAK 81
            +  +       +    +     K     ++D   P    L     PL   P      + 
Sbjct: 47  HSAWRQANSNNPQIETRTGR-ALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSH 105

Query: 82  LVLLEVPHSNIQQLGDG-GQ---------HHCKLSQIITAARNFVTKTPNPSFIRSLNKL 131
           L  + +  + + +L D   Q             L  +             P+ I SLN+L
Sbjct: 106 LQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRAL-------------PASIASLNRL 152

Query: 132 TILNLSGCSQLKRLPAEILSAG---------NMEEMILNGTAIEELPSSIECLSRLLHLG 182
             L++  C +L  LP  + S           N++ + L  T I  LP+SI  L  L  L 
Sbjct: 153 RELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLK 212

Query: 183 LRDCKRLKSLPKGLCKLKSLKFLILNGC-GITQLPENLGQLFSLEEFCLR-KTKFEKIPT 240
           +R+   L +L   +  L  L+ L L GC  +   P   G    L+   L+  +    +P 
Sbjct: 213 IRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPL 271

Query: 241 NVIHLSRLHSFCLSYCERLQSLPKLPCNLKEL 272
           ++  L++L    L  C  L  LP L   L   
Sbjct: 272 DIHRLTQLEKLDLRGCVNLSRLPSLIAQLPAN 303


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query353
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.74
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.68
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.49
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.37
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.32
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.02
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.97
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.89
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.86
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.75
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.71
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.69
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.67
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.57
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.55
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.36
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.17
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.79
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.58
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.83
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.3
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=2e-26  Score=217.43  Aligned_cols=296  Identities=19%  Similarity=0.135  Sum_probs=239.5

Q ss_pred             EEeCCCccccccCHHHHhcCCCCcEEEeeeCCCCCCccceeecCCCCCCCc-cceEeecccCCCCCCC--CCCCCCceEE
Q 043910            9 CLDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPE-IRYLFWHGYPLKSLPS--ITHPAKLVLL   85 (353)
Q Consensus         9 ~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~-L~~L~l~~~~~~~l~~--~~~~~~L~~L   85 (353)
                      .+|++++....+.++.|.++++|++|++++|.+++.      .+..+..+. |++|++++|.++.++.  +..+++|+.|
T Consensus        36 ~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~------~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L  109 (477)
T 2id5_A           36 LLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV------EPGAFNNLFNLRTLGLRSNRLKLIPLGVFTGLSNLTKL  109 (477)
T ss_dssp             EEECCSSCCCEECTTTTTTCTTCCEEECTTSCCCEE------CTTTTTTCTTCCEEECCSSCCCSCCTTSSTTCTTCCEE
T ss_pred             EEECCCCccceECHhHccCCCCCCEEECCCCccCEe------ChhhhhCCccCCEEECCCCcCCccCcccccCCCCCCEE
Confidence            457777777777788999999999999999988642      244555555 9999999999998884  4478999999


Q ss_pred             EccCCCccccC-CCCcCCCCccEEecCCCcCcCCCCCCccccCCccCcEEeecCCCCCcccchhhhcCCCccEEEccCcc
Q 043910           86 EVPHSNIQQLG-DGGQHHCKLSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTA  164 (353)
Q Consensus        86 ~L~~~~i~~l~-~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~  164 (353)
                      ++++|.+..+. ..+..+++|+.|++++|.. +... ...+..+++|++|++++|......+..+..+++|+.|++++|.
T Consensus       110 ~Ls~n~i~~~~~~~~~~l~~L~~L~l~~n~l-~~~~-~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~  187 (477)
T 2id5_A          110 DISENKIVILLDYMFQDLYNLKSLEVGDNDL-VYIS-HRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLN  187 (477)
T ss_dssp             ECTTSCCCEECTTTTTTCTTCCEEEECCTTC-CEEC-TTSSTTCTTCCEEEEESCCCSSCCHHHHTTCTTCCEEEEESCC
T ss_pred             ECCCCccccCChhHccccccCCEEECCCCcc-ceeC-hhhccCCCCCCEEECCCCcCcccChhHhcccCCCcEEeCCCCc
Confidence            99999998864 4567799999999998753 3332 3478899999999999976554444568889999999999999


Q ss_pred             CcccCc-cccCCCCCCEEeccCCCCCcccCccccCCCCCCEEEeeCccCCccCc-ccCCCCCCcEEEeeCCCCcccch-h
Q 043910          165 IEELPS-SIECLSRLLHLGLRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPE-NLGQLFSLEEFCLRKTKFEKIPT-N  241 (353)
Q Consensus       165 i~~l~~-~~~~l~~L~~L~l~~~~~~~~l~~~~~~l~~L~~L~l~~~~i~~~~~-~~~~l~~L~~L~l~~~~l~~l~~-~  241 (353)
                      +..++. .+..+++|++|++++|...+.++.......+|+.|++++|.++.+|. .+..+++|+.|++++|.+..++. .
T Consensus       188 i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~  267 (477)
T 2id5_A          188 INAIRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSM  267 (477)
T ss_dssp             CCEECTTCSCSCTTCCEEEEECCTTCCEECTTTTTTCCCSEEEEESSCCCSCCHHHHTTCTTCCEEECCSSCCCEECTTS
T ss_pred             CcEeChhhcccCcccceeeCCCCccccccCcccccCccccEEECcCCcccccCHHHhcCccccCeeECCCCcCCccChhh
Confidence            996654 68889999999999999888888776677799999999999998884 67889999999999999986654 5


Q ss_pred             HhhccCCceeccccccccccCCC---CCCCcceeecCCCcCccccCccccccccccccEEEecCCccCchHHHHhH
Q 043910          242 VIHLSRLHSFCLSYCERLQSLPK---LPCNLKELDADHCAALESLSDLFSISYDYYIRCFELSTNYKLDRNELRSI  314 (353)
Q Consensus       242 l~~l~~L~~L~l~~~~~l~~l~~---~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~l~~l~~~~c~~l~~~~~~~~  314 (353)
                      +..+++|+.|++++|......+.   .+++|+.|+++++ .++.++...+ ..+++|+.+++.+++.-++.....+
T Consensus       268 ~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N-~l~~~~~~~~-~~l~~L~~L~l~~N~l~c~c~~~~~  341 (477)
T 2id5_A          268 LHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGN-QLTTLEESVF-HSVGNLETLILDSNPLACDCRLLWV  341 (477)
T ss_dssp             CTTCTTCCEEECCSSCCSEECTTTBTTCTTCCEEECCSS-CCSCCCGGGB-SCGGGCCEEECCSSCEECSGGGHHH
T ss_pred             ccccccCCEEECCCCccceECHHHhcCcccCCEEECCCC-cCceeCHhHc-CCCcccCEEEccCCCccCccchHhH
Confidence            78899999999999754443343   3578999999998 6777776544 3467899999999988777655433



>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 353
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 47.3 bits (111), Expect = 9e-07
 Identities = 38/247 (15%), Positives = 83/247 (33%), Gaps = 9/247 (3%)

Query: 10  LDMSKVEEIHLYSDTFTKMRKLRFLKFYNSSINGENKCKVSNIQDPVFPEIRYLFWHGYP 69
           LD+   +   +    F  ++ L  L   N+ I+  +    +        ++  L+     
Sbjct: 36  LDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAP-----LVKLERLYLSKNQ 90

Query: 70  LKSLPSITHPAKLVLLEVPHSNIQQLGDGGQHHCKLSQIITAARNFVTKTPNPSFIRSLN 129
           LK LP         L    +   +          ++  +        +        + + 
Sbjct: 91  LKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMK 150

Query: 130 KLTILNLSGCSQLKRLPAEILSAGNMEEMILNGTAIEE-LPSSIECLSRLLHLGLRDCKR 188
           KL+ + ++    +  +P  +    ++ E+ L+G  I +   +S++ L+ L  LGL     
Sbjct: 151 KLSYIRIADT-NITTIPQGLPP--SLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSI 207

Query: 189 LKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFEKIPTNVIHLSRL 248
                  L     L+ L LN   + ++P  L     ++   L       I +N       
Sbjct: 208 SAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGY 267

Query: 249 HSFCLSY 255
           ++   SY
Sbjct: 268 NTKKASY 274


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query353
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.3
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.15
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.1
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.1
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.66
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.65
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.91
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.88  E-value=2.1e-22  Score=177.38  Aligned_cols=247  Identities=15%  Similarity=0.151  Sum_probs=199.4

Q ss_pred             CCcEEEeeeCCCCCCccceeecCCCCCCCc-cceEeecc-cCCC-CCC-CCCCCCCceEEEccCCCccccCC-CCcCCCC
Q 043910           30 KLRFLKFYNSSINGENKCKVSNIQDPVFPE-IRYLFWHG-YPLK-SLP-SITHPAKLVLLEVPHSNIQQLGD-GGQHHCK  104 (353)
Q Consensus        30 ~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~-L~~L~l~~-~~~~-~l~-~~~~~~~L~~L~L~~~~i~~l~~-~~~~~~~  104 (353)
                      +++.|+++++.+.+..    ..+..+..++ |++|++++ |.+. .+| .+.++++|++|++++|++.++.. ....+.+
T Consensus        51 ~v~~L~L~~~~l~g~~----~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~  126 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPY----PIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKT  126 (313)
T ss_dssp             CEEEEEEECCCCSSCE----ECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTT
T ss_pred             EEEEEECCCCCCCCCC----CCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhh
Confidence            6889999999887642    2345555555 99999987 5654 677 46689999999999999988654 4566899


Q ss_pred             ccEEecCCCcCcCCCCCCccccCCccCcEEeecCCCCCcccchhhhcCCCc-cEEEccCccCcc-cCccccCCCCCCEEe
Q 043910          105 LSQIITAARNFVTKTPNPSFIRSLNKLTILNLSGCSQLKRLPAEILSAGNM-EEMILNGTAIEE-LPSSIECLSRLLHLG  182 (353)
Q Consensus       105 L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L-~~L~l~~~~i~~-l~~~~~~l~~L~~L~  182 (353)
                      |+.++++++......  +..+..++.++++++++|...+.+|..+..+.++ +.+.+++|+++. .|..+..+. ..+++
T Consensus       127 L~~l~l~~N~~~~~~--p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~-~~~l~  203 (313)
T d1ogqa_         127 LVTLDFSYNALSGTL--PPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVD  203 (313)
T ss_dssp             CCEEECCSSEEESCC--CGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEE
T ss_pred             hcccccccccccccC--chhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccc-ccccc
Confidence            999999988654333  3578899999999999988888889888888775 889999999984 455565554 45789


Q ss_pred             ccCCCCCcccCccccCCCCCCEEEeeCccCCccCcccCCCCCCcEEEeeCCCCc-ccchhHhhccCCceecccccccccc
Q 043910          183 LRDCKRLKSLPKGLCKLKSLKFLILNGCGITQLPENLGQLFSLEEFCLRKTKFE-KIPTNVIHLSRLHSFCLSYCERLQS  261 (353)
Q Consensus       183 l~~~~~~~~l~~~~~~l~~L~~L~l~~~~i~~~~~~~~~l~~L~~L~l~~~~l~-~l~~~l~~l~~L~~L~l~~~~~l~~  261 (353)
                      +..+.....+|..+..+++++.+++.++.+...+..+..+++|+.|++++|++. .+|..++++++|++|++++|...+.
T Consensus       204 l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~  283 (313)
T d1ogqa_         204 LSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGE  283 (313)
T ss_dssp             CCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEE
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCccccc
Confidence            988777777888888999999999999998866667888999999999999998 8999999999999999999876668


Q ss_pred             CCCC--CCCcceeecCCCcCcccc
Q 043910          262 LPKL--PCNLKELDADHCAALESL  283 (353)
Q Consensus       262 l~~~--~~~L~~L~l~~c~~l~~~  283 (353)
                      +|..  +++|+.+++.+++.+...
T Consensus       284 iP~~~~L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         284 IPQGGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             CCCSTTGGGSCGGGTCSSSEEEST
T ss_pred             CCCcccCCCCCHHHhCCCccccCC
Confidence            8864  467888888888766544



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure