Citrus Sinensis ID: 043923

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSSPGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLSMQRLKAFVDSITTTLHNQSNHQSIKNSRRRSLTKWVFRLSFDDRVTGER
cccccHHHHccccccccccHHHHHHHHccccccccccccEEEEEcccccccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEccHHHHHHHHHHHHcccccEEEEcccccccHHcccccccccEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHccEEEEEccccccccccccccccHHccccccccccccccccEEEEEcccccccccccEEEEEEEccHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccEEEEEcccccHHccccHHHHHHHHHHHHHHccEEEEcccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEccccccccc
ccHHHHHHccccccccccHHccHHHHcccccccccccccEEEEccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccEEEccccEEEEcccHHHHHHHHHHHcccccEEEEccccccccccccEEccccEEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHHHHHHHcccEEEEccccccEccccccEEHHHHHHHccccccccccEEEEEEEccccccccccEEEEEEEccHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEcHHHHHccccHHHHHHHHHHHHHHccEEEcccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccccccccccccccHHcccccccEEEEEccccccccc
mgllsgkatcnthgqdssyflgwqeyeknpydevqnptgiiqMGLAENQLSFDLLESWldrnpdaagfkrdGQSIFRELALFQDYHGLPAFKKALVEFMSEirgnkvtfdtSKIVLTAGATSANETLMFCLaepgeafllptpyypgfdrdlkwrtgveivpiqctslngfqITETAIEEAYQLAQKRHLKVKGvlvtnpsnplgttmsrNELNLLVNIITEKnihlisdeiysgtvfsspgfVSIMEILKdrncentqvWNRVHIVYSLSkdlglpgfrvgaiysnDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGIsclksnaglfcwVDMRHLLRSNTFEAEMELWKKIVYDVklnispgsschctepgwfRVCFANMSEDTLKLSMQRLKAFVDSITTTLhnqsnhqsiknsrrrSLTKWVFRLsfddrvtger
mgllsgkatcnthgqdsSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIrgnkvtfdtsKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTnpsnplgttmsrNELNLLVNIITEKNIHLISDEIYSGTVFSSPGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLSMQRLKAFVDSITTTlhnqsnhqsiknsrrrsltkwvfrlsfddrvtger
MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSSPGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLSMQRLKAFVDSITTTLHNQSNHQSIKNSRRRSLTKWVFRLSFDDRVTGER
****************SSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSSPGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKFTQNYIS**********RKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLSMQRLKAFVDSITTTL****************LTKWVFRLSF********
**LLSG********QDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSSPGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLSMQRLKAFV*****************************************
MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSSPGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLSMQRLKAFVDSITTTL***************SLTKWVFRLSFDDRVTGER
*************GQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSSPGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLSMQRLKAFVDSIT******************SLTKWV****FD*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSSPGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLSMQRLKAFVDSITTTLHNQSNHQSIKNSRRRSLTKWVFRLSFDDRVTGER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query469 2.2.26 [Sep-21-2011]
Q9T065469 1-aminocyclopropane-1-car yes no 1.0 1.0 0.773 0.0
P37821473 1-aminocyclopropane-1-car N/A no 0.989 0.980 0.794 0.0
Q00257475 1-aminocyclopropane-1-car N/A no 0.980 0.968 0.790 0.0
Q42881469 1-aminocyclopropane-1-car N/A no 0.989 0.989 0.791 0.0
Q9M2Y8470 1-aminocyclopropane-1-car no no 1.0 0.997 0.782 0.0
Q37001470 1-aminocyclopropane-1-car no no 1.0 0.997 0.755 0.0
Q43309474 1-aminocyclopropane-1-car no no 1.0 0.989 0.734 0.0
Q10DK7487 1-aminocyclopropane-1-car yes no 0.976 0.940 0.675 0.0
A2XLL2487 1-aminocyclopropane-1-car N/A no 0.976 0.940 0.675 0.0
Q9S9U6460 1-aminocyclopropane-1-car no no 0.957 0.976 0.668 0.0
>sp|Q9T065|1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1 Back     alignment and function desciption
 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/469 (77%), Positives = 418/469 (89%)

Query: 1   MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLD 60
           MGLLS KA+CNTHGQDSSYF GW+EYEKNPYDE++NP GIIQMGLAENQLSFDL+ESWL 
Sbjct: 1   MGLLSKKASCNTHGQDSSYFWGWEEYEKNPYDEIKNPDGIIQMGLAENQLSFDLIESWLA 60

Query: 61  RNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGA 120
           +NPDAA F+R+GQSIFRELALFQDYHGLP+FK A+ +FMSE RGN+V+F+ +K+VLTAGA
Sbjct: 61  KNPDAANFQREGQSIFRELALFQDYHGLPSFKNAMADFMSENRGNRVSFNPNKLVLTAGA 120

Query: 121 TSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEE 180
           T ANETLMFCLA+PG+AFLLPTPYYPGFDRDLKWRTG EIVPIQC S NGF+IT+ A+EE
Sbjct: 121 TPANETLMFCLADPGDAFLLPTPYYPGFDRDLKWRTGAEIVPIQCKSANGFRITKVALEE 180

Query: 181 AYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSS 240
           AY+ AQK +LKVKGVL+TNPSNPLGTT +R ELN L++ I+ K IHLISDEIYSGTVF++
Sbjct: 181 AYEQAQKLNLKVKGVLITNPSNPLGTTTTRTELNHLLDFISRKKIHLISDEIYSGTVFTN 240

Query: 241 PGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSS 300
           PGF+S+ME+LKDR  ENT V++RVHIVYSLSKDLGLPGFRVG IYSNDD VV+AATKMSS
Sbjct: 241 PGFISVMEVLKDRKLENTDVFDRVHIVYSLSKDLGLPGFRVGVIYSNDDFVVSAATKMSS 300

Query: 301 FGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFC 360
           FGL+SSQTQYLLSALLSDK FT+NY+ EN+ RLK RH+KLVSGLE AGI CLKSNAGLFC
Sbjct: 301 FGLISSQTQYLLSALLSDKTFTKNYLEENQIRLKNRHKKLVSGLEAAGIECLKSNAGLFC 360

Query: 361 WVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLS 420
           WVDMRHLL+SNTFEAE+ELWKKIVY+VKLNISPGSSCHC EPGWFRVCFAN+SE+TLK++
Sbjct: 361 WVDMRHLLKSNTFEAEIELWKKIVYEVKLNISPGSSCHCNEPGWFRVCFANLSEETLKVA 420

Query: 421 MQRLKAFVDSITTTLHNQSNHQSIKNSRRRSLTKWVFRLSFDDRVTGER 469
           + RLK FVD  + T  +QS HQ +KN R+  ++ WVFRLSF DR   ER
Sbjct: 421 LDRLKRFVDGPSPTRRSQSEHQRLKNLRKMKVSNWVFRLSFHDREPEER 469
1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes catalyze the conversion of S-adenosyl-L-methionine (SAM) into 1-aminocyclopropane-1-carboxylate (ACC), a direct precursor of ethylene.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 4
>sp|P37821|1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica GN=ACS-1 PE=1 SV=2 Back     alignment and function description
>sp|Q00257|1A12_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima GN=ACS2 PE=2 SV=1 Back     alignment and function description
>sp|Q42881|1A13_SOLLC 1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1 Back     alignment and function description
>sp|Q9M2Y8|1A19_ARATH 1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana GN=ACS9 PE=1 SV=1 Back     alignment and function description
>sp|Q37001|1A15_ARATH 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana GN=ACS5 PE=1 SV=1 Back     alignment and function description
>sp|Q43309|1A14_ARATH 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana GN=ACS4 PE=1 SV=1 Back     alignment and function description
>sp|Q10DK7|1A11_ORYSJ 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=2 SV=1 Back     alignment and function description
>sp|A2XLL2|1A11_ORYSI 1-aminocyclopropane-1-carboxylate synthase 1 OS=Oryza sativa subsp. indica GN=ACC1 PE=2 SV=2 Back     alignment and function description
>sp|Q9S9U6|1A111_ARATH 1-aminocyclopropane-1-carboxylate synthase 11 OS=Arabidopsis thaliana GN=ACS11 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
225467508469 PREDICTED: 1-aminocyclopropane-1-carboxy 1.0 1.0 0.848 0.0
359497594469 PREDICTED: 1-aminocyclopropane-1-carboxy 1.0 1.0 0.846 0.0
224127212468 1-aminocyclopropane-1-carboxylate [Popul 0.995 0.997 0.846 0.0
224097212467 1-aminocyclopropane-1-carboxylate [Popul 0.976 0.980 0.861 0.0
20152191471 1-aminocyclopropane-1-carboxylate syntha 1.0 0.995 0.830 0.0
157921976470 1-aminocyclopropane 1-carboxylate syntha 0.978 0.976 0.818 0.0
255579517466 acc synthase, putative [Ricinus communis 0.938 0.944 0.850 0.0
3273184467 1-aminocyclopropane-1-carboxylate syntha 0.995 1.0 0.805 0.0
297802162469 1-amino-cyclopropane-1-carboxylate synth 1.0 1.0 0.782 0.0
296083536445 unnamed protein product [Vitis vinifera] 0.948 1.0 0.810 0.0
>gi|225467508|ref|XP_002269780.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 3 [Vitis vinifera] gi|147801368|emb|CAN74730.1| hypothetical protein VITISV_037836 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/469 (84%), Positives = 430/469 (91%)

Query: 1   MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLD 60
           M +LS KAT N+HGQDS YFLGW+EYEKN Y EV+NP+GIIQMGLAENQLSFDLLESWL 
Sbjct: 1   MKMLSRKATFNSHGQDSEYFLGWEEYEKNAYHEVENPSGIIQMGLAENQLSFDLLESWLA 60

Query: 61  RNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGA 120
           +NPDAAGFKRDG+SIFRELALFQDYHGLPAFKKALVEFMSEIRGNKV+FD +K+VLTAGA
Sbjct: 61  QNPDAAGFKRDGESIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVSFDQNKLVLTAGA 120

Query: 121 TSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEE 180
           TSANETLMFCLA PGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQC+S NGFQITE+A+EE
Sbjct: 121 TSANETLMFCLANPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCSSSNGFQITESALEE 180

Query: 181 AYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSS 240
           AYQ AQKR LKVKGVL+TNPSNPLGTT SR+ELNLLVN IT K IHLISDEIYSGTVF S
Sbjct: 181 AYQQAQKRSLKVKGVLITNPSNPLGTTTSRDELNLLVNFITAKGIHLISDEIYSGTVFDS 240

Query: 241 PGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSS 300
           PGFVSIME+L DRN  NT+VW RVHIVYSLSKDLGLPGFRVGAIYSND  VV+AATKMSS
Sbjct: 241 PGFVSIMEVLMDRNYMNTEVWKRVHIVYSLSKDLGLPGFRVGAIYSNDVAVVSAATKMSS 300

Query: 301 FGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFC 360
           FGLVSSQTQYLLS +LSDKKFT+NY+SEN+KRLKQRH+ L+SGL+ AGI CLKSNAGLFC
Sbjct: 301 FGLVSSQTQYLLSVMLSDKKFTKNYVSENQKRLKQRHQMLISGLQNAGIDCLKSNAGLFC 360

Query: 361 WVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLS 420
           WVDMRHLL SNTFEAEMELWKKI+YDV+LNISPGSSCHCTEPGWFRVCFANMSEDTL L+
Sbjct: 361 WVDMRHLLSSNTFEAEMELWKKILYDVRLNISPGSSCHCTEPGWFRVCFANMSEDTLNLA 420

Query: 421 MQRLKAFVDSITTTLHNQSNHQSIKNSRRRSLTKWVFRLSFDDRVTGER 469
           +QR+KAFVDS TTT +NQS HQS KN RR+S TKWVFRLSF DR   ER
Sbjct: 421 LQRIKAFVDSSTTTNNNQSRHQSNKNQRRKSFTKWVFRLSFRDREASER 469

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359497594|ref|XP_003635576.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127212|ref|XP_002320015.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] gi|222860788|gb|EEE98330.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224097212|ref|XP_002310878.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] gi|222853781|gb|EEE91328.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] Back     alignment and taxonomy information
>gi|20152191|dbj|BAB89348.1| 1-aminocyclopropane-1-carboxylate synthase [Diospyros kaki] Back     alignment and taxonomy information
>gi|157921976|gb|ABW03081.1| 1-aminocyclopropane 1-carboxylate synthase 1 [Prunus salicina] Back     alignment and taxonomy information
>gi|255579517|ref|XP_002530601.1| acc synthase, putative [Ricinus communis] gi|223529849|gb|EEF31781.1| acc synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|3273184|dbj|BAA31137.1| 1-aminocyclopropane-1-carboxylate synthase [Actinidia deliciosa] Back     alignment and taxonomy information
>gi|297802162|ref|XP_002868965.1| 1-amino-cyclopropane-1-carboxylate synthase 8 [Arabidopsis lyrata subsp. lyrata] gi|297314801|gb|EFH45224.1| 1-amino-cyclopropane-1-carboxylate synthase 8 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|296083536|emb|CBI23525.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query469
UNIPROTKB|A5BL65469 VITISV_037836 "Putative unchar 1.0 1.0 0.848 8.2e-218
UNIPROTKB|Q8S935471 DK-ACS1 "1-aminocyclopropane-1 1.0 0.995 0.830 3e-211
UNIPROTKB|O80334467 O80334 "1-aminocyclopropane-1- 0.995 1.0 0.805 4.1e-207
TAIR|locus:2137579469 ACS8 "1-amino-cyclopropane-1-c 1.0 1.0 0.773 1e-203
UNIPROTKB|O65028470 ACS2 "Pollen-specific 1-aminoc 0.989 0.987 0.788 3.4e-203
UNIPROTKB|P37821473 ACS-1 "1-aminocyclopropane-1-c 0.989 0.980 0.794 1.2e-202
TAIR|locus:2097350470 ACS9 "1-aminocyclopropane-1-ca 1.0 0.997 0.782 8.2e-202
UNIPROTKB|Q9SXN8473 pPPACS1 "1-aminocyclopropane-1 0.989 0.980 0.788 2.8e-201
UNIPROTKB|O24544472 VR-ACS6 "1-aminocyclopropane-1 0.974 0.968 0.802 4.5e-201
UNIPROTKB|Q09PK3481 ACS1 "1-aminocyclopropane-1-ca 0.989 0.964 0.779 1.2e-200
UNIPROTKB|A5BL65 VITISV_037836 "Putative uncharacterized protein" [Vitis vinifera (taxid:29760)] Back     alignment and assigned GO terms
 Score = 2104 (745.7 bits), Expect = 8.2e-218, P = 8.2e-218
 Identities = 398/469 (84%), Positives = 430/469 (91%)

Query:     1 MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLD 60
             M +LS KAT N+HGQDS YFLGW+EYEKN Y EV+NP+GIIQMGLAENQLSFDLLESWL 
Sbjct:     1 MKMLSRKATFNSHGQDSEYFLGWEEYEKNAYHEVENPSGIIQMGLAENQLSFDLLESWLA 60

Query:    61 RNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGA 120
             +NPDAAGFKRDG+SIFRELALFQDYHGLPAFKKALVEFMSEIRGNKV+FD +K+VLTAGA
Sbjct:    61 QNPDAAGFKRDGESIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVSFDQNKLVLTAGA 120

Query:   121 TSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEE 180
             TSANETLMFCLA PGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQC+S NGFQITE+A+EE
Sbjct:   121 TSANETLMFCLANPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCSSSNGFQITESALEE 180

Query:   181 AYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSS 240
             AYQ AQKR LKVKGVL+TNPSNPLGTT SR+ELNLLVN IT K IHLISDEIYSGTVF S
Sbjct:   181 AYQQAQKRSLKVKGVLITNPSNPLGTTTSRDELNLLVNFITAKGIHLISDEIYSGTVFDS 240

Query:   241 PGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSS 300
             PGFVSIME+L DRN  NT+VW RVHIVYSLSKDLGLPGFRVGAIYSND  VV+AATKMSS
Sbjct:   241 PGFVSIMEVLMDRNYMNTEVWKRVHIVYSLSKDLGLPGFRVGAIYSNDVAVVSAATKMSS 300

Query:   301 FGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFC 360
             FGLVSSQTQYLLS +LSDKKFT+NY+SEN+KRLKQRH+ L+SGL+ AGI CLKSNAGLFC
Sbjct:   301 FGLVSSQTQYLLSVMLSDKKFTKNYVSENQKRLKQRHQMLISGLQNAGIDCLKSNAGLFC 360

Query:   361 WVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLS 420
             WVDMRHLL SNTFEAEMELWKKI+YDV+LNISPGSSCHCTEPGWFRVCFANMSEDTL L+
Sbjct:   361 WVDMRHLLSSNTFEAEMELWKKILYDVRLNISPGSSCHCTEPGWFRVCFANMSEDTLNLA 420

Query:   421 MQRLKAFVDSITTTLHNQSNHQSIKNSRRRSLTKWVFRLSFDDRVTGER 469
             +QR+KAFVDS TTT +NQS HQS KN RR+S TKWVFRLSF DR   ER
Sbjct:   421 LQRIKAFVDSSTTTNNNQSRHQSNKNQRRKSFTKWVFRLSFRDREASER 469
GO:0016847 "1-aminocyclopropane-1-carboxylate synthase activity" evidence=ISS
GO:0042218 "1-aminocyclopropane-1-carboxylate biosynthetic process" evidence=ISS
UNIPROTKB|Q8S935 DK-ACS1 "1-aminocyclopropane-1-carboxylate synthase" [Diospyros kaki (taxid:35925)] Back     alignment and assigned GO terms
UNIPROTKB|O80334 O80334 "1-aminocyclopropane-1-carboxylate synthase" [Actinidia deliciosa (taxid:3627)] Back     alignment and assigned GO terms
TAIR|locus:2137579 ACS8 "1-amino-cyclopropane-1-carboxylate synthase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O65028 ACS2 "Pollen-specific 1-aminocyclopropane-1-carboxylate synthase" [Petunia x hybrida (taxid:4102)] Back     alignment and assigned GO terms
UNIPROTKB|P37821 ACS-1 "1-aminocyclopropane-1-carboxylate synthase" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
TAIR|locus:2097350 ACS9 "1-aminocyclopropane-1-carboxylate synthase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SXN8 pPPACS1 "1-aminocyclopropane-1-carboxylic acid synthase" [Pyrus pyrifolia (taxid:3767)] Back     alignment and assigned GO terms
UNIPROTKB|O24544 VR-ACS6 "1-aminocyclopropane-1-carboxylate synthase" [Vigna radiata var. radiata (taxid:3916)] Back     alignment and assigned GO terms
UNIPROTKB|Q09PK3 ACS1 "1-aminocyclopropane-1-carboxylate synthase" [Cucumis sativus (taxid:3659)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5E9H21A1L1_BOVINNo assigned EC number0.31460.86350.8067yesno
Q003791A12_CUCPE4, ., 4, ., 1, ., 1, 40.52580.97220.9230N/Ano
Q9MB951A11_PRUMU4, ., 4, ., 1, ., 1, 40.56570.89970.8577N/Ano
Q9M2Y81A19_ARATH4, ., 4, ., 1, ., 1, 40.78291.00.9978nono
Q002571A12_CUCMA4, ., 4, ., 1, ., 1, 40.79040.98080.9684N/Ano
Q10DK71A11_ORYSJ4, ., 4, ., 1, ., 1, 40.67520.97650.9404yesno
Q433091A14_ARATH4, ., 4, ., 1, ., 1, 40.73411.00.9894nono
Q428811A13_SOLLC4, ., 4, ., 1, ., 1, 40.79130.98930.9893N/Ano
P378211A1C_MALDO4, ., 4, ., 1, ., 1, 40.79440.98930.9809N/Ano
Q9T0651A18_ARATH4, ., 4, ., 1, ., 1, 40.77391.01.0yesno
A2XLL21A11_ORYSI4, ., 4, ., 1, ., 1, 40.67520.97650.9404N/Ano
P184851A12_SOLLC4, ., 4, ., 1, ., 1, 40.53210.97650.9443N/Ano
P274861A1C_DIACA4, ., 4, ., 1, ., 1, 40.53280.89970.8162N/Ano
Q370011A15_ARATH4, ., 4, ., 1, ., 1, 40.75531.00.9978nono
P232791A11_CUCPE4, ., 4, ., 1, ., 1, 40.51930.97220.9249N/Ano
P295351A14_SOLLC4, ., 4, ., 1, ., 1, 40.55140.90610.8928N/Ano
Q96QU61A1L1_HUMANNo assigned EC number0.32260.88050.8243yesno
P235991A11_CUCMA4, ., 4, ., 1, ., 1, 40.51930.97220.9249N/Ano
Q072621A1C_TOBAC4, ., 4, ., 1, ., 1, 40.53910.96580.9226N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.4.1LOW CONFIDENCE prediction!
4th Layer4.4.1.140.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
ACS1
SubName- Full=Putative uncharacterized protein (Chromosome undetermined scaffold_1179, whole genome shotgun sequence); (469 aa)
(Vitis vinifera)
Predicted Functional Partners:
pVvSPMS
SubName- Full=Chromosome undetermined scaffold_171, whole genome shotgun sequence; (369 aa)
     •• 0.916
grip58
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (265 aa)
     •• 0.907
SAMDC
SubName- Full=Putative uncharacterized protein (Chromosome chr14 scaffold_9, whole genome shotg [...] (360 aa)
     •  0.899
GSVIVG00032257001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (336 aa)
     •  0.899
GSVIVG00028846001
SubName- Full=Chromosome chr1 scaffold_46, whole genome shotgun sequence; (297 aa)
     •  0.899
METK5
RecName- Full=S-adenosylmethionine synthetase; EC=2.5.1.6;; Catalyzes the formation of S-adenos [...] (391 aa)
     •  0.899
GSVIVG00025952001
SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (318 aa)
     •  0.899
GSVIVG00025412001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (816 aa)
     •  0.899
GSVIVG00024734001
RecName- Full=Cytosine-specific methyltransferase; EC=2.1.1.37; (926 aa)
     •  0.899
METK4
RecName- Full=S-adenosylmethionine synthetase; EC=2.5.1.6;; Catalyzes the formation of S-adenos [...] (393 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
PLN02450468 PLN02450, PLN02450, 1-aminocyclopropane-1-carboxyl 0.0
PLN02607447 PLN02607, PLN02607, 1-aminocyclopropane-1-carboxyl 0.0
PLN02376496 PLN02376, PLN02376, 1-aminocyclopropane-1-carboxyl 0.0
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 1e-107
PLN02994153 PLN02994, PLN02994, 1-aminocyclopropane-1-carboxyl 1e-62
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 2e-61
COG0436393 COG0436, COG0436, Aspartate/tyrosine/aromatic amin 3e-57
PRK05764393 PRK05764, PRK05764, aspartate aminotransferase; Pr 8e-38
PRK07309391 PRK07309, PRK07309, aromatic amino acid aminotrans 9e-31
PRK07683387 PRK07683, PRK07683, aminotransferase A; Validated 9e-29
PRK06836394 PRK06836, PRK06836, aspartate aminotransferase; Pr 3e-25
PRK07568397 PRK07568, PRK07568, aspartate aminotransferase; Pr 4e-25
TIGR01265403 TIGR01265, tyr_nico_aTase, tyrosine/nicotianamine 2e-24
COG1167459 COG1167, ARO8, Transcriptional regulators containi 2e-23
PRK08363398 PRK08363, PRK08363, alanine aminotransferase; Vali 6e-22
PRK07337388 PRK07337, PRK07337, aminotransferase; Validated 2e-20
PRK07550386 PRK07550, PRK07550, hypothetical protein; Provisio 2e-20
PRK08960387 PRK08960, PRK08960, hypothetical protein; Provisio 9e-20
COG1168388 COG1168, MalY, Bifunctional PLP-dependent enzyme w 2e-18
PRK06107402 PRK06107, PRK06107, aspartate aminotransferase; Pr 2e-18
PRK07682378 PRK07682, PRK07682, hypothetical protein; Validate 3e-18
PTZ00377481 PTZ00377, PTZ00377, alanine aminotransferase; Prov 2e-17
COG0079356 COG0079, HisC, Histidinol-phosphate/aromatic amino 2e-17
TIGR03537350 TIGR03537, DapC, succinyldiaminopimelate transamin 4e-17
PTZ00433412 PTZ00433, PTZ00433, tyrosine aminotransferase; Pro 1e-16
TIGR03540383 TIGR03540, DapC_direct, LL-diaminopimelate aminotr 4e-16
PRK06108382 PRK06108, PRK06108, aspartate aminotransferase; Pr 5e-16
PRK05957389 PRK05957, PRK05957, aspartate aminotransferase; Pr 8e-16
TIGR04350384 TIGR04350, C_S_lyase_PatB, putative C-S lyase 3e-15
PRK08175395 PRK08175, PRK08175, aminotransferase; Validated 4e-15
TIGR01264401 TIGR01264, tyr_amTase_E, tyrosine aminotransferase 6e-15
PRK08361391 PRK08361, PRK08361, aspartate aminotransferase; Pr 8e-15
PLN00145430 PLN00145, PLN00145, tyrosine/nicotianamine aminotr 1e-14
PRK09275527 PRK09275, PRK09275, aspartate aminotransferase; Pr 3e-14
PRK06225380 PRK06225, PRK06225, aspartate aminotransferase; Pr 1e-13
PLN00175413 PLN00175, PLN00175, aminotransferase family protei 1e-13
PRK06348384 PRK06348, PRK06348, aspartate aminotransferase; Pr 3e-13
PLN02656409 PLN02656, PLN02656, tyrosine transaminase 6e-13
PLN02187462 PLN02187, PLN02187, rooty/superroot1 1e-12
PRK08912387 PRK08912, PRK08912, hypothetical protein; Provisio 2e-12
PRK06290410 PRK06290, PRK06290, aspartate aminotransferase; Pr 2e-12
PLN00143409 PLN00143, PLN00143, tyrosine/nicotianamine aminotr 3e-12
PRK09276385 PRK09276, PRK09276, LL-diaminopimelate aminotransf 6e-12
PRK07324373 PRK07324, PRK07324, transaminase; Validated 6e-12
TIGR03539357 TIGR03539, DapC_actino, succinyldiaminopimelate tr 1e-11
TIGR03801521 TIGR03801, asp_4_decarbox, aspartate 4-decarboxyla 2e-11
PRK07777387 PRK07777, PRK07777, aminotransferase; Validated 1e-10
PRK09148405 PRK09148, PRK09148, aminotransferase; Validated 1e-10
PRK08068389 PRK08068, PRK08068, transaminase; Reviewed 3e-10
PRK05942394 PRK05942, PRK05942, aspartate aminotransferase; Pr 3e-10
PRK07681399 PRK07681, PRK07681, aspartate aminotransferase; Pr 4e-10
PRK13355517 PRK13355, PRK13355, bifunctional HTH-domain contai 6e-10
PLN02368407 PLN02368, PLN02368, alanine transaminase 6e-10
PRK09440416 PRK09440, avtA, valine--pyruvate transaminase; Pro 1e-09
TIGR01141346 TIGR01141, hisC, histidinol-phosphate aminotransfe 1e-09
TIGR03542402 TIGR03542, DAPAT_plant, LL-diaminopimelate aminotr 2e-09
TIGR01140330 TIGR01140, L_thr_O3P_dcar, L-threonine-O-3-phospha 7e-09
PRK08636403 PRK08636, PRK08636, aspartate aminotransferase; Pr 8e-09
PRK12414384 PRK12414, PRK12414, putative aminotransferase; Pro 1e-08
PRK09082386 PRK09082, PRK09082, methionine aminotransferase; V 3e-08
TIGR03947359 TIGR03947, viomycin_VioD, capreomycidine synthase 3e-08
PRK06358354 PRK06358, PRK06358, threonine-phosphate decarboxyl 3e-08
PRK08056356 PRK08056, PRK08056, threonine-phosphate decarboxyl 4e-08
PRK06855433 PRK06855, PRK06855, aminotransferase; Validated 9e-08
PRK07865364 PRK07865, PRK07865, N-succinyldiaminopimelate amin 3e-07
PLN02231534 PLN02231, PLN02231, alanine transaminase 9e-07
PRK05839374 PRK05839, PRK05839, hypothetical protein; Provisio 4e-06
PRK14809357 PRK14809, PRK14809, histidinol-phosphate aminotran 4e-06
PRK07366388 PRK07366, PRK07366, succinyldiaminopimelate transa 5e-06
PRK14807351 PRK14807, PRK14807, histidinol-phosphate aminotran 8e-06
PLN026721082 PLN02672, PLN02672, methionine S-methyltransferase 3e-05
PRK01533366 PRK01533, PRK01533, histidinol-phosphate aminotran 5e-05
COG3977417 COG3977, COG3977, Alanine-alpha-ketoisovalerate (o 1e-04
PRK08354311 PRK08354, PRK08354, putative aminotransferase; Pro 2e-04
PRK15481431 PRK15481, PRK15481, transcriptional regulatory pro 2e-04
PRK05166371 PRK05166, PRK05166, histidinol-phosphate aminotran 3e-04
PRK06207405 PRK06207, PRK06207, aspartate aminotransferase; Pr 4e-04
TIGR03538393 TIGR03538, DapC_gpp, succinyldiaminopimelate trans 4e-04
PRK09265404 PRK09265, PRK09265, aminotransferase AlaT; Validat 8e-04
PRK08637388 PRK08637, PRK08637, hypothetical protein; Provisio 0.001
PLN03026380 PLN03026, PLN03026, histidinol-phosphate aminotran 0.002
PRK02731367 PRK02731, PRK02731, histidinol-phosphate aminotran 0.003
PRK01688351 PRK01688, PRK01688, histidinol-phosphate aminotran 0.004
>gnl|CDD|178069 PLN02450, PLN02450, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information 
 Score = 1007 bits (2606), Expect = 0.0
 Identities = 391/468 (83%), Positives = 432/468 (92%)

Query: 1   MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLD 60
           M LLS KATCN+HGQDSSYFLGW+EYEKNPYDE++NP+GIIQMGLAENQLSFDL+ESWL 
Sbjct: 1   MKLLSRKATCNSHGQDSSYFLGWEEYEKNPYDEIKNPSGIIQMGLAENQLSFDLIESWLA 60

Query: 61  RNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGA 120
           +NPDAAG KR+GQSIFRELALFQDYHGLPAFK AL EFMSEIRGNKVTFD +K+VLTAGA
Sbjct: 61  KNPDAAGLKRNGQSIFRELALFQDYHGLPAFKNALAEFMSEIRGNKVTFDPNKLVLTAGA 120

Query: 121 TSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEE 180
           TSANETLMFCLAEPG+AFLLPTPYYPGFDRDLKWRTGVEIVPI C+S NGFQITE+A+EE
Sbjct: 121 TSANETLMFCLAEPGDAFLLPTPYYPGFDRDLKWRTGVEIVPIHCSSSNGFQITESALEE 180

Query: 181 AYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSS 240
           AYQ AQK +LKVKGVL+TNPSNPLGTT +R ELNLLV+ IT KNIHLISDEIYSGTVF S
Sbjct: 181 AYQQAQKLNLKVKGVLITNPSNPLGTTTTRTELNLLVDFITAKNIHLISDEIYSGTVFDS 240

Query: 241 PGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSS 300
           PGFVS+ME+LKDR  ENT V NRVHIVYSLSKDLGLPGFRVGAIYSND+MVV+AATKMSS
Sbjct: 241 PGFVSVMEVLKDRKLENTDVSNRVHIVYSLSKDLGLPGFRVGAIYSNDEMVVSAATKMSS 300

Query: 301 FGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFC 360
           FGLVSSQTQYLLSALLSDKKFT+NY+ EN+KRLKQR +KLVSGLE AGI CLKSNAGLFC
Sbjct: 301 FGLVSSQTQYLLSALLSDKKFTKNYLEENQKRLKQRQKKLVSGLEAAGIKCLKSNAGLFC 360

Query: 361 WVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLS 420
           WVDMRHLL+SNTFEAEMELWKKIVY+VKLNISPGSSCHCTEPGWFRVCFANMSE+TL L+
Sbjct: 361 WVDMRHLLKSNTFEAEMELWKKIVYEVKLNISPGSSCHCTEPGWFRVCFANMSEETLDLA 420

Query: 421 MQRLKAFVDSITTTLHNQSNHQSIKNSRRRSLTKWVFRLSFDDRVTGE 468
           M+RLK+FV+S +    N+S+HQ +KN RR++++KWVFRLSF DR   E
Sbjct: 421 MKRLKSFVESDSGRRINKSSHQRLKNLRRKTVSKWVFRLSFHDREPEE 468

Length = 468
>gnl|CDD|215327 PLN02607, PLN02607, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|178004 PLN02376, PLN02376, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|166635 PLN02994, PLN02994, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|223513 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235596 PRK05764, PRK05764, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235985 PRK07309, PRK07309, aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|236075 PRK07683, PRK07683, aminotransferase A; Validated Back     alignment and domain information
>gnl|CDD|180720 PRK06836, PRK06836, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181036 PRK07568, PRK07568, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|188123 TIGR01265, tyr_nico_aTase, tyrosine/nicotianamine family aminotransferase Back     alignment and domain information
>gnl|CDD|224089 COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181402 PRK08363, PRK08363, alanine aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180937 PRK07337, PRK07337, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181026 PRK07550, PRK07550, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181595 PRK08960, PRK08960, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224090 COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180403 PRK06107, PRK06107, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181082 PRK07682, PRK07682, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|240391 PTZ00377, PTZ00377, alanine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|223157 COG0079, HisC, Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163313 TIGR03537, DapC, succinyldiaminopimelate transaminase Back     alignment and domain information
>gnl|CDD|185613 PTZ00433, PTZ00433, tyrosine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|234250 TIGR03540, DapC_direct, LL-diaminopimelate aminotransferase Back     alignment and domain information
>gnl|CDD|180404 PRK06108, PRK06108, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235654 PRK05957, PRK05957, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|213963 TIGR04350, C_S_lyase_PatB, putative C-S lyase Back     alignment and domain information
>gnl|CDD|181268 PRK08175, PRK08175, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|188122 TIGR01264, tyr_amTase_E, tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>gnl|CDD|236248 PRK08361, PRK08361, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215074 PLN00145, PLN00145, tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236444 PRK09275, PRK09275, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235749 PRK06225, PRK06225, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215089 PLN00175, PLN00175, aminotransferase family protein; Provisional Back     alignment and domain information
>gnl|CDD|180537 PRK06348, PRK06348, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|178262 PLN02656, PLN02656, tyrosine transaminase Back     alignment and domain information
>gnl|CDD|215119 PLN02187, PLN02187, rooty/superroot1 Back     alignment and domain information
>gnl|CDD|181580 PRK08912, PRK08912, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235772 PRK06290, PRK06290, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|165711 PLN00143, PLN00143, tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181749 PRK09276, PRK09276, LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235989 PRK07324, PRK07324, transaminase; Validated Back     alignment and domain information
>gnl|CDD|132578 TIGR03539, DapC_actino, succinyldiaminopimelate transaminase Back     alignment and domain information
>gnl|CDD|163513 TIGR03801, asp_4_decarbox, aspartate 4-decarboxylase Back     alignment and domain information
>gnl|CDD|236095 PRK07777, PRK07777, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181674 PRK09148, PRK09148, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181219 PRK08068, PRK08068, transaminase; Reviewed Back     alignment and domain information
>gnl|CDD|180317 PRK05942, PRK05942, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181081 PRK07681, PRK07681, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|237361 PRK13355, PRK13355, bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|177996 PLN02368, PLN02368, alanine transaminase Back     alignment and domain information
>gnl|CDD|236517 PRK09440, avtA, valine--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|233290 TIGR01141, hisC, histidinol-phosphate aminotransferase Back     alignment and domain information
>gnl|CDD|163316 TIGR03542, DAPAT_plant, LL-diaminopimelate aminotransferase Back     alignment and domain information
>gnl|CDD|233289 TIGR01140, L_thr_O3P_dcar, L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>gnl|CDD|236316 PRK08636, PRK08636, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183514 PRK12414, PRK12414, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181642 PRK09082, PRK09082, methionine aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|188462 TIGR03947, viomycin_VioD, capreomycidine synthase Back     alignment and domain information
>gnl|CDD|180542 PRK06358, PRK06358, threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|181212 PRK08056, PRK08056, threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|180734 PRK06855, PRK06855, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|236119 PRK07865, PRK07865, N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|177876 PLN02231, PLN02231, alanine transaminase Back     alignment and domain information
>gnl|CDD|180281 PRK05839, PRK05839, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184830 PRK14809, PRK14809, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180947 PRK07366, PRK07366, succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>gnl|CDD|184829 PRK14807, PRK14807, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215360 PLN02672, PLN02672, methionine S-methyltransferase Back     alignment and domain information
>gnl|CDD|134568 PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|226485 COG3977, COG3977, Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|169399 PRK08354, PRK08354, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|185378 PRK15481, PRK15481, transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>gnl|CDD|179950 PRK05166, PRK05166, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235742 PRK06207, PRK06207, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|234249 TIGR03538, DapC_gpp, succinyldiaminopimelate transaminase Back     alignment and domain information
>gnl|CDD|181738 PRK09265, PRK09265, aminotransferase AlaT; Validated Back     alignment and domain information
>gnl|CDD|181512 PRK08637, PRK08637, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178597 PLN03026, PLN03026, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235064 PRK02731, PRK02731, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|234972 PRK01688, PRK01688, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 469
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 100.0
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 100.0
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 100.0
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 100.0
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 100.0
PRK07366388 succinyldiaminopimelate transaminase; Validated 100.0
PRK07681399 aspartate aminotransferase; Provisional 100.0
PRK09148405 aminotransferase; Validated 100.0
PRK08636403 aspartate aminotransferase; Provisional 100.0
PLN02187462 rooty/superroot1 100.0
PRK06207405 aspartate aminotransferase; Provisional 100.0
PLN00175413 aminotransferase family protein; Provisional 100.0
PRK06855433 aminotransferase; Validated 100.0
PTZ00377481 alanine aminotransferase; Provisional 100.0
PRK08068389 transaminase; Reviewed 100.0
PRK13355517 bifunctional HTH-domain containing protein/aminotr 100.0
PRK09147396 succinyldiaminopimelate transaminase; Provisional 100.0
PRK06290410 aspartate aminotransferase; Provisional 100.0
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 100.0
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 100.0
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 100.0
PTZ00433412 tyrosine aminotransferase; Provisional 100.0
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 100.0
PRK06348384 aspartate aminotransferase; Provisional 100.0
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 100.0
PLN02656409 tyrosine transaminase 100.0
PRK07682378 hypothetical protein; Validated 100.0
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 100.0
PLN02231534 alanine transaminase 100.0
PRK05942394 aspartate aminotransferase; Provisional 100.0
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 100.0
PRK08361391 aspartate aminotransferase; Provisional 100.0
PRK07309391 aromatic amino acid aminotransferase; Validated 100.0
PRK12414384 putative aminotransferase; Provisional 100.0
PRK06107402 aspartate aminotransferase; Provisional 100.0
PRK06108382 aspartate aminotransferase; Provisional 100.0
PRK08960387 hypothetical protein; Provisional 100.0
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 100.0
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 100.0
PRK08912387 hypothetical protein; Provisional 100.0
PRK07683387 aminotransferase A; Validated 100.0
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 100.0
PRK05839374 hypothetical protein; Provisional 100.0
PRK05957389 aspartate aminotransferase; Provisional 100.0
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 100.0
PRK09082386 methionine aminotransferase; Validated 100.0
PRK07337388 aminotransferase; Validated 100.0
PRK09265404 aminotransferase AlaT; Validated 100.0
PRK15481431 transcriptional regulatory protein PtsJ; Provision 100.0
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 100.0
PRK08175395 aminotransferase; Validated 100.0
PRK07324373 transaminase; Validated 100.0
PRK07568397 aspartate aminotransferase; Provisional 100.0
PRK08363398 alanine aminotransferase; Validated 100.0
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 100.0
PRK05764393 aspartate aminotransferase; Provisional 100.0
PRK07550386 hypothetical protein; Provisional 100.0
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 100.0
PRK01533366 histidinol-phosphate aminotransferase; Validated 100.0
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 100.0
PRK09275527 aspartate aminotransferase; Provisional 100.0
PRK07777387 aminotransferase; Validated 100.0
PRK06358354 threonine-phosphate decarboxylase; Provisional 100.0
PRK07392360 threonine-phosphate decarboxylase; Validated 100.0
PLN026721082 methionine S-methyltransferase 100.0
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 100.0
PRK06425332 histidinol-phosphate aminotransferase; Validated 100.0
PRK08056356 threonine-phosphate decarboxylase; Provisional 100.0
PRK09257396 aromatic amino acid aminotransferase; Provisional 100.0
PRK14809357 histidinol-phosphate aminotransferase; Provisional 100.0
PTZ00376404 aspartate aminotransferase; Provisional 100.0
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 100.0
PRK05166371 histidinol-phosphate aminotransferase; Provisional 100.0
PRK02610374 histidinol-phosphate aminotransferase; Provisional 100.0
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 100.0
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 100.0
PRK03158359 histidinol-phosphate aminotransferase; Provisional 100.0
PLN03026380 histidinol-phosphate aminotransferase; Provisional 100.0
PLN02368407 alanine transaminase 100.0
PRK04781364 histidinol-phosphate aminotransferase; Provisional 100.0
PRK06836394 aspartate aminotransferase; Provisional 100.0
PRK01688351 histidinol-phosphate aminotransferase; Provisional 100.0
PRK09440416 avtA valine--pyruvate transaminase; Provisional 100.0
PRK08637388 hypothetical protein; Provisional 100.0
PRK09105370 putative aminotransferase; Provisional 100.0
PRK07908349 hypothetical protein; Provisional 100.0
PRK03317368 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08153369 histidinol-phosphate aminotransferase; Provisional 100.0
PRK04870356 histidinol-phosphate aminotransferase; Provisional 100.0
PLN02397423 aspartate transaminase 100.0
PRK06225380 aspartate aminotransferase; Provisional 100.0
PRK02731367 histidinol-phosphate aminotransferase; Validated 100.0
PRK05387353 histidinol-phosphate aminotransferase; Provisional 100.0
PRK06959339 putative threonine-phosphate decarboxylase; Provis 100.0
PRK04635354 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08354311 putative aminotransferase; Provisional 100.0
PRK14808335 histidinol-phosphate aminotransferase; Provisional 100.0
PRK05664330 threonine-phosphate decarboxylase; Reviewed 100.0
PRK03321352 putative aminotransferase; Provisional 100.0
PRK14807351 histidinol-phosphate aminotransferase; Provisional 100.0
PRK00950361 histidinol-phosphate aminotransferase; Validated 100.0
PRK03967337 histidinol-phosphate aminotransferase; Provisional 100.0
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 100.0
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 100.0
KOG0634472 consensus Aromatic amino acid aminotransferase and 100.0
cd00609350 AAT_like Aspartate aminotransferase family. This f 100.0
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 100.0
KOG0633375 consensus Histidinol phosphate aminotransferase [A 100.0
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 100.0
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 100.0
PRK10534333 L-threonine aldolase; Provisional 100.0
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 100.0
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 99.97
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.97
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.97
PLN02721353 threonine aldolase 99.97
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.97
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.97
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 99.97
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.97
PLN02483489 serine palmitoyltransferase 99.97
PLN02822481 serine palmitoyltransferase 99.97
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.97
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.97
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.97
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.97
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.96
PRK13392410 5-aminolevulinate synthase; Provisional 99.96
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.96
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.96
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.96
PRK02948381 cysteine desulfurase; Provisional 99.96
PRK02627396 acetylornithine aminotransferase; Provisional 99.96
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.95
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.95
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.95
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.95
PRK07049427 methionine gamma-lyase; Validated 99.95
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.95
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.95
PRK07179407 hypothetical protein; Provisional 99.95
PRK09064407 5-aminolevulinate synthase; Validated 99.95
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.94
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.94
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.94
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.94
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.94
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.94
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.94
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.94
PLN02409401 serine--glyoxylate aminotransaminase 99.94
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.94
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.94
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.94
PLN02242418 methionine gamma-lyase 99.94
PRK08247366 cystathionine gamma-synthase; Reviewed 99.93
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.93
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.93
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.93
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.93
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.93
PRK13520371 L-tyrosine decarboxylase; Provisional 99.93
PRK13393406 5-aminolevulinate synthase; Provisional 99.93
PRK06234400 methionine gamma-lyase; Provisional 99.92
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.92
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.92
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.92
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.92
PRK06767386 methionine gamma-lyase; Provisional 99.91
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.91
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.91
PRK06460376 hypothetical protein; Provisional 99.91
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.91
PRK08045386 cystathionine gamma-synthase; Provisional 99.91
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.91
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 99.91
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.91
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.91
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.9
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.9
PRK14012404 cysteine desulfurase; Provisional 99.9
PRK08861388 cystathionine gamma-synthase; Provisional 99.9
PRK04260375 acetylornithine aminotransferase; Provisional 99.9
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.9
PRK07582366 cystathionine gamma-lyase; Validated 99.9
PRK07505402 hypothetical protein; Provisional 99.9
PRK07050394 cystathionine beta-lyase; Provisional 99.9
PRK08776405 cystathionine gamma-synthase; Provisional 99.9
PRK08249398 cystathionine gamma-synthase; Provisional 99.9
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.9
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.89
PRK07811388 cystathionine gamma-synthase; Provisional 99.89
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.89
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.89
PRK07503403 methionine gamma-lyase; Provisional 99.89
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.89
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.89
PLN02955476 8-amino-7-oxononanoate synthase 99.88
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.88
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 99.88
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.88
PRK05968389 hypothetical protein; Provisional 99.88
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.88
PRK08064390 cystathionine beta-lyase; Provisional 99.87
PLN00144382 acetylornithine transaminase 99.87
PRK08574385 cystathionine gamma-synthase; Provisional 99.87
PRK07269364 cystathionine gamma-synthase; Reviewed 99.87
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.87
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.87
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.87
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.87
PRK09028394 cystathionine beta-lyase; Provisional 99.87
PLN02651364 cysteine desulfurase 99.87
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.86
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.86
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.86
PRK07671377 cystathionine beta-lyase; Provisional 99.86
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.86
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.85
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.85
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.85
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.85
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.85
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.85
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.84
PRK05939397 hypothetical protein; Provisional 99.84
PLN02509464 cystathionine beta-lyase 99.84
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.84
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.84
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.84
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 99.83
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.83
PRK09792421 4-aminobutyrate transaminase; Provisional 99.83
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.83
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.83
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.83
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.83
PRK13237460 tyrosine phenol-lyase; Provisional 99.82
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.82
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.82
PLN02624474 ornithine-delta-aminotransferase 99.82
TIGR01814406 kynureninase kynureninase. This model describes ky 99.81
PRK13580493 serine hydroxymethyltransferase; Provisional 99.81
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.81
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 99.81
PRK05967395 cystathionine beta-lyase; Provisional 99.81
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.81
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.8
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.8
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.8
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.8
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.79
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.79
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.78
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.78
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.78
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.78
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.78
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.77
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.77
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.77
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.76
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.76
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.75
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.75
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.75
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.74
PRK02769380 histidine decarboxylase; Provisional 99.74
PRK08114395 cystathionine beta-lyase; Provisional 99.73
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.73
PLN03226475 serine hydroxymethyltransferase; Provisional 99.73
PLN02724 805 Molybdenum cofactor sulfurase 99.72
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.72
PLN02880490 tyrosine decarboxylase 99.72
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.72
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.71
PLN02590539 probable tyrosine decarboxylase 99.71
PLN02414993 glycine dehydrogenase (decarboxylating) 99.71
PRK06541460 hypothetical protein; Provisional 99.7
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.7
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.69
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.69
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.69
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.69
PRK06434384 cystathionine gamma-lyase; Validated 99.69
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 99.68
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.68
PLN02271586 serine hydroxymethyltransferase 99.68
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.68
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.68
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.67
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.67
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.67
PLN03032374 serine decarboxylase; Provisional 99.67
PRK03080378 phosphoserine aminotransferase; Provisional 99.67
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.67
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.66
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.66
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.66
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.65
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.65
PRK07678451 aminotransferase; Validated 99.63
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.6
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 99.6
PRK07482461 hypothetical protein; Provisional 99.6
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.6
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.59
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.59
PLN02760504 4-aminobutyrate:pyruvate transaminase 99.59
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.59
PRK06917447 hypothetical protein; Provisional 99.59
PRK15029 755 arginine decarboxylase; Provisional 99.59
PRK06062451 hypothetical protein; Provisional 99.59
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 99.58
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.58
PRK06082459 4-aminobutyrate aminotransferase; Provisional 99.58
PRK06105460 aminotransferase; Provisional 99.58
PRK05965459 hypothetical protein; Provisional 99.58
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.58
PRK07481449 hypothetical protein; Provisional 99.58
PRK07046453 aminotransferase; Validated 99.57
PLN02263470 serine decarboxylase 99.57
PRK13360442 omega amino acid--pyruvate transaminase; Provision 99.57
PRK04311464 selenocysteine synthase; Provisional 99.57
PRK12403460 putative aminotransferase; Provisional 99.57
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 99.56
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.56
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 99.56
PRK07483443 hypothetical protein; Provisional 99.55
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 99.55
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 99.55
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.55
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 99.55
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.54
PRK06149972 hypothetical protein; Provisional 99.54
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.54
PRK05367954 glycine dehydrogenase; Provisional 99.54
PRK13578 720 ornithine decarboxylase; Provisional 99.53
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 99.53
PRK061481013 hypothetical protein; Provisional 99.53
PRK07036466 hypothetical protein; Provisional 99.53
PRK07480456 putative aminotransferase; Validated 99.53
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.53
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.52
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.5
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.5
PRK15400 714 lysine decarboxylase CadA; Provisional 99.49
PRK12566954 glycine dehydrogenase; Provisional 99.49
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.49
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.47
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.46
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.46
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 99.44
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.43
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.41
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 99.38
PRK08297443 L-lysine aminotransferase; Provisional 99.38
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.34
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.33
PLN02452365 phosphoserine transaminase 99.32
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.31
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 99.3
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.3
PRK05367 954 glycine dehydrogenase; Provisional 99.3
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 99.29
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 99.26
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 99.24
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 99.19
KOG1401433 consensus Acetylornithine aminotransferase [Amino 99.18
PRK12462364 phosphoserine aminotransferase; Provisional 99.14
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 99.13
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 99.09
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.09
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 98.93
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 98.8
COG3844407 Kynureninase [Amino acid transport and metabolism] 98.77
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.77
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 98.77
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.75
COG4100416 Cystathionine beta-lyase family protein involved i 98.73
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 98.72
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 98.61
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 98.57
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 98.56
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 98.47
KOG0629510 consensus Glutamate decarboxylase and related prot 98.43
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 98.35
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 98.28
PRK12566 954 glycine dehydrogenase; Provisional 98.03
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 97.82
KOG3843432 consensus Predicted serine hydroxymethyltransferas 97.71
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 97.64
PLN02672 1082 methionine S-methyltransferase 96.85
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 96.58
KOG2790370 consensus Phosphoserine aminotransferase [Coenzyme 96.05
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 92.06
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 88.56
COG2102223 Predicted ATPases of PP-loop superfamily [General 86.36
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 84.86
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information 
Probab=100.00  E-value=4.7e-70  Score=559.10  Aligned_cols=467  Identities=84%  Similarity=1.316  Sum_probs=398.5

Q ss_pred             CCccccccccccCCCCCccchhhhhhhcCCCCCCCCCCCeeeeeccccccChHHHHHHHhcCCCccccccCCcccccccc
Q 043923            1 MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELA   80 (469)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~L~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (469)
                      |.++|.++++....++.+|+..|..+..++|++..+|.|+|+|+++||+++.+.+.++++...+.......+........
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~p~g~i~L~~~En~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~   80 (468)
T PLN02450          1 MKLLSRKATCNSHGQDSSYFLGWEEYEKNPYDEIKNPSGIIQMGLAENQLSFDLIESWLAKNPDAAGLKRNGQSIFRELA   80 (468)
T ss_pred             CcccchhhcccccCCCCchHHHHHHHhcCCCCcccCCCeeEEeehhHhHhhHHHHHHHHHhCchhhhcccccccchhhhh
Confidence            78999999999999999999999999999999999999999999999999999999999876432111000111123556


Q ss_pred             cCCCCCCcHHHHHHHHHHHHhHcCCCCCCCCCcEEEeCChHHHHHHHHHHhcCCCCEEEEccCCCcChHHHHhhhCCCEE
Q 043923           81 LFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEI  160 (469)
Q Consensus        81 ~Y~~~~g~~~Lr~aia~~l~~~~~~~~~~~~~~i~~t~G~~~al~~~~~~l~~~gd~Vl~~~P~y~~~~~~~~~~~g~~~  160 (469)
                      .|+++.|.++||++||+|++++++.++++++++|++|+|+++++..++.+++++||.|++++|+|+.|...+....|+++
T Consensus        81 ~Y~~~~G~~~LR~aiA~~l~~~~~~~~~v~~~~Iiit~Ga~~al~~l~~~l~~pGd~Vlv~~P~Y~~~~~~~~~~~g~~~  160 (468)
T PLN02450         81 LFQDYHGLPAFKNALAEFMSEIRGNKVTFDPNKLVLTAGATSANETLMFCLAEPGDAFLLPTPYYPGFDRDLKWRTGVEI  160 (468)
T ss_pred             cCCCCCChHHHHHHHHHHHHHhhCCCCCcChHHeEEccChHHHHHHHHHHhCCCCCEEEECCCCCCchHHHHhhcCCcEE
Confidence            79999999999999999999888866678999999999999999999999999999999999999999888874339999


Q ss_pred             EEeeccCCCCcccCHHHHHHHHHHHHhcCCceeEEEEecCCCCCCCCCCHHHHHHHHHHHHhcCeEEEEeccccccccCC
Q 043923          161 VPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSS  240 (469)
Q Consensus       161 ~~v~~~~~~~~~~d~~~l~~~i~~~~~~~~~~~~vvl~~P~NPtG~~~s~e~l~~l~~~~~~~~~~iI~Deay~~~~~~~  240 (469)
                      +++|++.+++|.+|++.+++++++..+.+.++++|++||||||||.++|.+++++|+++|++|+++||+||+|+++.|++
T Consensus       161 v~v~~~~~~~~~~~~~~le~~~~~~~~~~~~~k~v~l~nP~NPTG~~~s~e~l~~ll~~a~~~~~~iI~DE~Y~~~~f~~  240 (468)
T PLN02450        161 VPIHCSSSNGFQITESALEEAYQQAQKLNLKVKGVLITNPSNPLGTTTTRTELNLLVDFITAKNIHLISDEIYSGTVFDS  240 (468)
T ss_pred             EEEecCCccCCcCCHHHHHHHHHHHHhcCCCeeEEEEecCCCCCCcccCHHHHHHHHHHHHHCCcEEEEEccccccccCC
Confidence            99999766789999999999987655555689999999999999999999999999999999999999999999988876


Q ss_pred             CCccchhhhhhccccccCCcCCeEEEEccCccccCCCcceEEEEEecCHHHHHHHHHhcccccCcHHHHHHHHHHhcCch
Q 043923          241 PGFVSIMEILKDRNCENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKK  320 (469)
Q Consensus       241 ~~~~s~~~~~~~~~~~~~~~~~~~i~i~S~SK~~g~~GlRiG~li~~~~~~~~~~~~~~~~~~~s~~~q~~~~~~l~~~~  320 (469)
                      ..+.++.+......+.+.+..+++++++||||.||+||+|+||++++++.+.+.+.+...++.++.+.|.++..+|.+..
T Consensus       241 ~~~~s~l~~~~~~~~~~~~~~~~vi~l~S~SK~~~l~GlRiG~li~~~~~l~~~~~~~~~~~~~s~~~Q~a~~~~L~~~~  320 (468)
T PLN02450        241 PGFVSVMEVLKDRKLENTDVSNRVHIVYSLSKDLGLPGFRVGAIYSNDEMVVSAATKMSSFGLVSSQTQYLLSALLSDKK  320 (468)
T ss_pred             CCcccHHHHhhhcccccCCCCCcEEEEEeccccCCCCCccEEEEEECCHHHHHHHHHHhhcCCCCHHHHHHHHHHhCCch
Confidence            55556555432100001113578999999999999999999999998776666666665555578999999999999988


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHhcCCceecCCceEEEEEecccccccCChhHHHHHHHHHHHhCCeEEeCCCCCCCC
Q 043923          321 FTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCT  400 (469)
Q Consensus       321 ~~~~~~~~~~~~l~~~~~~l~~~L~~~g~~v~~~~~g~~~~v~~~~~~~~~~~~~~~~l~~~ll~~~GI~v~pg~~f~~~  400 (469)
                      +...++++.+++++++++.+.+.|+++|+++.++++|+|+|++++.......+..+.+++.++++++||.|.||+.|+..
T Consensus       321 ~~~~~l~~~~~~l~~rr~~l~~~L~~~gi~~~~~~~g~flwi~l~~~~~~~~~~~~~~l~~~ll~~~gV~v~PG~~f~~~  400 (468)
T PLN02450        321 FTKNYLEENQKRLKQRQKKLVSGLEAAGIKCLKSNAGLFCWVDMRHLLKSNTFEAEMELWKKIVYEVKLNISPGSSCHCT  400 (468)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHcCCcccCCCceEEEEEEchHhcCcCCchHHHHHHHHHHHhCCEEEeCccccCCC
Confidence            75567889999999999999999999999999999999999999865544444555678899998899999999999876


Q ss_pred             CCCeEEEEeecCCHHHHHHHHHHHHHHHHhhccccccccccccccccccccccccEEEEEeeccccc
Q 043923          401 EPGWFRVCFANMSEDTLKLSMQRLKAFVDSITTTLHNQSNHQSIKNSRRRSLTKWVFRLSFDDRVTG  467 (469)
Q Consensus       401 ~~~~iRi~~~~~~~e~i~~~l~~L~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  467 (469)
                      .++|+||+++.++++++++++++|++++++....--|.+-||-.||++|.--.||+||++|.||-..
T Consensus       401 ~~g~~Rl~f~~~~~~~l~~~l~ri~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  467 (468)
T PLN02450        401 EPGWFRVCFANMSEETLDLAMKRLKSFVESDSGRRINKSSHQRLKNLRRKTVSKWVFRLSFHDREPE  467 (468)
T ss_pred             CCCEEEEEecCCCHHHHHHHHHHHHHHHHhccccccccchhcccccccchhhhccceEEeeccCCcC
Confidence            7899999999668999999999999999888865667789999999999999999999999999654

>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2790 consensus Phosphoserine aminotransferase [Coenzyme transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
1ynu_A473 Crystal Structure Of Apple Acc Synthase In Complex 0.0
1m7y_A435 Crystal Structure Of Apple Acc Synthase In Complex 0.0
1b8g_A429 1-aminocyclopropane-1-carboxylate Synthase Length = 0.0
3piu_A410 High-Resolution Structure Of Native Malus Domestica 0.0
1iax_A428 Crystal Structure Of Acc Synthase Complexed With Pl 1e-151
1j32_A388 Aspartate Aminotransferase From Phormidium Lapideum 5e-17
1o4s_A389 Crystal Structure Of Aspartate Aminotransferase (Tm 7e-17
1xi9_A406 Alanine Aminotransferase From Pyrococcus Furiosus P 1e-16
1b5o_A385 Thermus Thermophilus Aspartate Aminotransferase Sin 2e-15
2z61_A370 Crystal Structure Of Mj0684 From Methanococcus Jann 2e-15
1bkg_A385 Aspartate Aminotransferase From Thermus Thermophilu 3e-15
1bjw_A382 Aspartate Aminotransferase From Thermus Thermophilu 4e-15
1gc3_A385 Thermus Thermophilus Aspartate Aminotransferase Tet 5e-15
5bj3_A385 Thermus Thermophilus Aspartate Aminotransferase Tet 6e-15
1gck_A385 Thermus Thermophilus Aspartate Aminotransferase Dou 6e-15
2gb3_A409 Crystal Structure Of Aspartate Aminotransferase (Tm 3e-14
2x5d_A412 Crystal Structure Of A Probable Aminotransferase Fr 9e-14
2o1b_A404 Structure Of Aminotransferase From Staphylococcus A 1e-13
1v2d_A381 Crystal Structure Of T.Th Hb8 Glutamine Aminotransf 2e-13
3e2z_B410 Crystal Structure Of Mouse Kynurenine Aminotransfer 5e-13
3op7_A375 Crystal Structure Of A Plp-Dependent Aminotransfera 7e-13
3ele_A398 Crystal Structure Of Amino Transferase (rer07020700 1e-12
3e2f_A410 Crystal Structure Of Mouse Kynurenine Aminotransfer 2e-12
1dju_A388 Crystal Structure Of Aromatic Aminotransferase From 6e-12
1gde_A389 Crystal Structure Of Pyrococcus Protein A-1 E-form 1e-11
1yiy_A429 Aedes Aegypti Kynurenine Aminotransferase Length = 2e-11
1w7n_A422 Crystal Structure Of Human Kynurenine Aminotransfer 3e-11
1yiz_A429 Aedes Aegypti Kynurenine Aminotrasferase Length = 4 7e-11
1w7l_A422 Crystal Structure Of Human Kynurenine Aminotransfer 1e-10
3h14_A391 Crystal Structure Of A Putative Aminotransferase Fr 1e-10
3fvs_A422 Human Kynurenine Aminotransferase I In Complex With 2e-10
1bw0_A416 Crystal Structure Of Tyrosine Aminotransferase From 6e-10
3pdx_A402 Crystal Structural Of Mouse Tyrosine Aminotransfera 2e-09
2o0r_A411 The Three-Dimensional Structure Of N-Succinyldiamin 2e-09
3dyd_A427 Human Tyrosine Aminotransferase Length = 427 6e-09
2zc0_A407 Crystal Structure Of An Archaeal Alanine:glyoxylate 8e-09
3aov_A448 Crystal Structure Of Pyrococcus Horikoshii Kynureni 2e-08
1x0m_A403 A Human Kynurenine Aminotransferase Ii Homologue Fr 2e-08
3tcm_A500 Crystal Structure Of Alanine Aminotransferase From 5e-08
1u08_A386 Crystal Structure And Reactivity Of Ybdl From Esche 6e-08
3asa_A400 Crystal Structure Of Apo-Ll-Diaminopimelate Aminotr 8e-08
4dgt_A391 Crystal Structure Of Plp-Bound Putative Aminotransf 2e-07
1lkc_A364 Crystal Structure Of L-Threonine-O-3-Phosphate Deca 4e-07
3b1c_A392 Crystal Structure Of Betac-S Lyase From Streptococc 4e-07
3ihj_A498 Human Alanine Aminotransferase 2 In Complex With Pl 6e-07
3b46_A447 Crystal Structure Of Bna3p, A Putative Kynurenine A 8e-07
3g7q_A417 Crystal Structure Of Valine-Pyruvate Aminotransfera 4e-06
1vp4_A425 Crystal Structure Of A Putative Aminotransferase (T 9e-06
3p1t_A337 Crystal Structure Of A Putative Aminotransferase (B 1e-05
3f6t_A533 Crystal Structure Of Aspartate Aminotransferase (E. 1e-05
3t32_B383 Crystal Structure Of A Putative C-S Lyase From Baci 2e-05
1wst_A417 Crystal Structure Of Multiple Substrate Aminotransf 2e-05
3if2_A444 Crystal Structure Of Putative Amino-Acid Aminotrans 4e-05
2zy2_A544 Dodecameric L-Aspartate Beta-Decarboxylase Length = 5e-05
1c7n_A399 Crystal Structure Of Cystalysin From Treponema Dent 6e-05
3ezs_A376 Crystal Structure Of Aminotransferase Aspb (Np_2074 6e-05
3fdb_A377 Crystal Structure Of A Putative Plp-Dependent Beta- 2e-04
1gew_A356 Crystal Structure Of Histidinol-Phosphate Aminotran 7e-04
>pdb|1YNU|A Chain A, Crystal Structure Of Apple Acc Synthase In Complex With L-Vinylglycine Length = 473 Back     alignment and structure 
Iteration: 1

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/467 (79%), Positives = 414/467 (88%), Gaps = 3/467 (0%)
Query: 1   MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLD 60
           M +LS  AT N+HGQDSSYFLGWQEYEKNPY EV N  GIIQMGLAENQL FDLLESWL 
Sbjct: 1   MRMLSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLA 60
Query: 61  RNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGA 120
           +NP+AA FK++G+SIF ELALFQDYHGLPAFKKA+V+FM+EIRGNKVTFD + +VLTAGA
Sbjct: 61  KNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGA 120
Query: 121 TSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEE 180
           TSANET +FCLA+PGEA L+PTPYYPGFDRDLKWRTGVEIVPI CTS NGFQITETA+EE
Sbjct: 121 TSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEE 180
Query: 181 AYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSS 240
           AYQ A+KR+L+VKGVLVTNPSNPLGTTM+RNEL LL++ + +K IHLISDEIYSGT FSS
Sbjct: 181 AYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSS 240
Query: 241 PGFVSIMEILKDRNC-ENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMS 299
           P F+S+ME+LKDRNC EN++VW RVH+VYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMS
Sbjct: 241 PSFISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMS 300
Query: 300 SFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLF 359
           SFGLVSSQTQ+LLSA+LSDKK T+NYI+EN KRLKQR +KLVSGL+K+GISCL  NAGLF
Sbjct: 301 SFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLF 360
Query: 360 CWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKL 419
           CWVDMRHLLRSNTFEAEMELWKKIVY+V LNISPGSSCHCTEPGWFRVCFAN+ E TL L
Sbjct: 361 CWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERTLDL 420
Query: 420 SMQRLKAFVDSITTTLHNQSNHQS--IKNSRRRSLTKWVFRLSFDDR 464
           +MQRLKAFV             QS  + +SRR+SLTKWV RLSFDDR
Sbjct: 421 AMQRLKAFVGEYYNVPEVNGGSQSSHLSHSRRQSLTKWVSRLSFDDR 467
>pdb|1M7Y|A Chain A, Crystal Structure Of Apple Acc Synthase In Complex With L- Aminoethoxyvinylglycine Length = 435 Back     alignment and structure
>pdb|1B8G|A Chain A, 1-aminocyclopropane-1-carboxylate Synthase Length = 429 Back     alignment and structure
>pdb|1IAX|A Chain A, Crystal Structure Of Acc Synthase Complexed With Plp Length = 428 Back     alignment and structure
>pdb|1J32|A Chain A, Aspartate Aminotransferase From Phormidium Lapideum Length = 388 Back     alignment and structure
>pdb|1O4S|A Chain A, Crystal Structure Of Aspartate Aminotransferase (Tm1255) From Thermotoga Maritima At 1.90 A Resolution Length = 389 Back     alignment and structure
>pdb|1XI9|A Chain A, Alanine Aminotransferase From Pyrococcus Furiosus Pfu-1397077-001 Length = 406 Back     alignment and structure
>pdb|1B5O|A Chain A, Thermus Thermophilus Aspartate Aminotransferase Single Mutant 1 Length = 385 Back     alignment and structure
>pdb|2Z61|A Chain A, Crystal Structure Of Mj0684 From Methanococcus Jannaschii Reveals Its Similarity In The Active Site To Kynurenine Aminotransferases Length = 370 Back     alignment and structure
>pdb|1BKG|A Chain A, Aspartate Aminotransferase From Thermus Thermophilus With Maleate Length = 385 Back     alignment and structure
>pdb|1BJW|A Chain A, Aspartate Aminotransferase From Thermus Thermophilus Length = 382 Back     alignment and structure
>pdb|1GC3|A Chain A, Thermus Thermophilus Aspartate Aminotransferase Tetra Mutant 2 Complexed With Tryptophan Length = 385 Back     alignment and structure
>pdb|5BJ3|A Chain A, Thermus Thermophilus Aspartate Aminotransferase Tetra Mutant 1 Length = 385 Back     alignment and structure
>pdb|1GCK|A Chain A, Thermus Thermophilus Aspartate Aminotransferase Double Mutant 1 Complexed With Aspartate Length = 385 Back     alignment and structure
>pdb|2GB3|A Chain A, Crystal Structure Of Aspartate Aminotransferase (Tm1698) From Thermotoga Maritima At 2.50 A Resolution Length = 409 Back     alignment and structure
>pdb|2X5D|A Chain A, Crystal Structure Of A Probable Aminotransferase From Pseudomonas Aeruginosa Length = 412 Back     alignment and structure
>pdb|2O1B|A Chain A, Structure Of Aminotransferase From Staphylococcus Aureus Length = 404 Back     alignment and structure
>pdb|1V2D|A Chain A, Crystal Structure Of T.Th Hb8 Glutamine Aminotransferase Length = 381 Back     alignment and structure
>pdb|3E2Z|B Chain B, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii In Complex With Kynurenine Length = 410 Back     alignment and structure
>pdb|3OP7|A Chain A, Crystal Structure Of A Plp-Dependent Aminotransferase (Zp_03625122.1) From Streptococcus Suis 89-1591 At 1.70 A Resolution Length = 375 Back     alignment and structure
>pdb|3ELE|A Chain A, Crystal Structure Of Amino Transferase (rer070207001803) From Eubacterium Rectale At 2.10 A Resolution Length = 398 Back     alignment and structure
>pdb|3E2F|A Chain A, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii, Plp-Bound Form Length = 410 Back     alignment and structure
>pdb|1DJU|A Chain A, Crystal Structure Of Aromatic Aminotransferase From Pyrococcus Horikoshii Ot3 Length = 388 Back     alignment and structure
>pdb|1GDE|A Chain A, Crystal Structure Of Pyrococcus Protein A-1 E-form Length = 389 Back     alignment and structure
>pdb|1YIY|A Chain A, Aedes Aegypti Kynurenine Aminotransferase Length = 429 Back     alignment and structure
>pdb|1W7N|A Chain A, Crystal Structure Of Human Kynurenine Aminotransferase I In Pmp Form Length = 422 Back     alignment and structure
>pdb|1YIZ|A Chain A, Aedes Aegypti Kynurenine Aminotrasferase Length = 429 Back     alignment and structure
>pdb|1W7L|A Chain A, Crystal Structure Of Human Kynurenine Aminotransferase I Length = 422 Back     alignment and structure
>pdb|3H14|A Chain A, Crystal Structure Of A Putative Aminotransferase From Silicibacter Pomeroyi Length = 391 Back     alignment and structure
>pdb|3FVS|A Chain A, Human Kynurenine Aminotransferase I In Complex With Glycerol Length = 422 Back     alignment and structure
>pdb|1BW0|A Chain A, Crystal Structure Of Tyrosine Aminotransferase From Trypanosoma Cruzi Length = 416 Back     alignment and structure
>pdb|3PDX|A Chain A, Crystal Structural Of Mouse Tyrosine Aminotransferase Length = 402 Back     alignment and structure
>pdb|2O0R|A Chain A, The Three-Dimensional Structure Of N-Succinyldiaminopimelate Aminotransferase From Mycobacterium Tuberculosis Length = 411 Back     alignment and structure
>pdb|3DYD|A Chain A, Human Tyrosine Aminotransferase Length = 427 Back     alignment and structure
>pdb|2ZC0|A Chain A, Crystal Structure Of An Archaeal Alanine:glyoxylate Aminotransferase Length = 407 Back     alignment and structure
>pdb|3AOV|A Chain A, Crystal Structure Of Pyrococcus Horikoshii Kynurenine Aminotransferase In Complex With Plp Length = 448 Back     alignment and structure
>pdb|1X0M|A Chain A, A Human Kynurenine Aminotransferase Ii Homologue From Pyrococcus Horikoshii Ot3 Length = 403 Back     alignment and structure
>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum Vulgare Length = 500 Back     alignment and structure
>pdb|1U08|A Chain A, Crystal Structure And Reactivity Of Ybdl From Escherichia Coli Identify A Methionine Aminotransferase Function. Length = 386 Back     alignment and structure
>pdb|3ASA|A Chain A, Crystal Structure Of Apo-Ll-Diaminopimelate Aminotransferase From Chlamydia Trachomatis Length = 400 Back     alignment and structure
>pdb|4DGT|A Chain A, Crystal Structure Of Plp-Bound Putative Aminotransferase From Clostridium Difficile 630 Crystallized With Magnesium Formate Length = 391 Back     alignment and structure
>pdb|1LKC|A Chain A, Crystal Structure Of L-Threonine-O-3-Phosphate Decarboxylase From Salmonella Enterica Length = 364 Back     alignment and structure
>pdb|3B1C|A Chain A, Crystal Structure Of Betac-S Lyase From Streptococcus Anginosus: Internal Aldimine Form Length = 392 Back     alignment and structure
>pdb|3IHJ|A Chain A, Human Alanine Aminotransferase 2 In Complex With Plp Length = 498 Back     alignment and structure
>pdb|3B46|A Chain A, Crystal Structure Of Bna3p, A Putative Kynurenine Aminotransferase From Saccharomyces Cerevisiae Length = 447 Back     alignment and structure
>pdb|3G7Q|A Chain A, Crystal Structure Of Valine-Pyruvate Aminotransferase Avta (Np_462565.1) From Salmonella Typhimurium Lt2 At 1.80 A Resolution Length = 417 Back     alignment and structure
>pdb|1VP4|A Chain A, Crystal Structure Of A Putative Aminotransferase (Tm1131) From Thermotoga Maritima Msb8 At 1.82 A Resolution Length = 425 Back     alignment and structure
>pdb|3P1T|A Chain A, Crystal Structure Of A Putative Aminotransferase (Bpsl1724) From Burkholderia Pseudomallei K96243 At 2.60 A Resolution Length = 337 Back     alignment and structure
>pdb|3F6T|A Chain A, Crystal Structure Of Aspartate Aminotransferase (E.C. 2.6.1.1) (Yp_194538.1) From Lactobacillus Acidophilus Ncfm At 2.15 A Resolution Length = 533 Back     alignment and structure
>pdb|1WST|A Chain A, Crystal Structure Of Multiple Substrate Aminotransferase (Msat) From Thermococcus Profundus Length = 417 Back     alignment and structure
>pdb|3IF2|A Chain A, Crystal Structure Of Putative Amino-Acid Aminotransferase (Yp_265399.1) From Psychrobacter Arcticum 273-4 At 2.50 A Resolution Length = 444 Back     alignment and structure
>pdb|2ZY2|A Chain A, Dodecameric L-Aspartate Beta-Decarboxylase Length = 544 Back     alignment and structure
>pdb|1C7N|A Chain A, Crystal Structure Of Cystalysin From Treponema Denticola Contains A Pyridoxal 5'-Phosphate Cofactor Length = 399 Back     alignment and structure
>pdb|3EZS|A Chain A, Crystal Structure Of Aminotransferase Aspb (Np_207418.1) From Helicobacter Pylori 26695 At 2.19 A Resolution Length = 376 Back     alignment and structure
>pdb|3FDB|A Chain A, Crystal Structure Of A Putative Plp-Dependent Beta-Cystathionase (Aecd, Dip1736) From Corynebacterium Diphtheriae At 1.99 A Resolution Length = 377 Back     alignment and structure
>pdb|1GEW|A Chain A, Crystal Structure Of Histidinol-Phosphate Aminotransferase Complexed With Pyridoxal 5'-Phosphate Length = 356 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query469
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 0.0
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 0.0
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 2e-44
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 2e-44
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 3e-44
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 4e-43
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 3e-42
3ele_A398 Amino transferase; RER070207001803, structural gen 3e-40
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 3e-39
1xi9_A406 Putative transaminase; alanine aminotransferase, s 4e-39
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 7e-39
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 1e-37
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 7e-37
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 2e-36
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 4e-36
3nra_A407 Aspartate aminotransferase; structural genomics, j 3e-35
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 7e-35
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 8e-35
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 1e-34
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 2e-34
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 3e-34
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 3e-34
2z61_A370 Probable aspartate aminotransferase 2; amino acid 4e-34
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 6e-34
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 1e-33
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 1e-33
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 1e-33
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 8e-33
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 8e-33
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 1e-31
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 2e-30
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 3e-30
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 9e-30
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 3e-29
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 3e-28
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 4e-28
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 7e-28
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 3e-26
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 6e-25
3aow_A448 Putative uncharacterized protein PH0207; protein-P 3e-24
1vp4_A425 Aminotransferase, putative; structural genomics, j 8e-24
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 2e-23
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 6e-22
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 2e-21
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 7e-21
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 2e-20
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 1e-19
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 6e-19
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 8e-19
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 2e-18
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 2e-18
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 9e-18
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 2e-17
3l8a_A421 METC, putative aminotransferase, probable beta-cys 2e-17
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 3e-17
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 4e-17
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 3e-16
3ftb_A361 Histidinol-phosphate aminotransferase; structural 6e-15
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 7e-13
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 3e-10
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 4e-10
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 4e-10
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 2e-09
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 3e-09
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 8e-09
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 6e-08
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 5e-07
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 2e-04
3rq1_A418 Aminotransferase class I and II; structural genomi 3e-04
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 6e-04
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Length = 435 Back     alignment and structure
 Score =  668 bits (1725), Expect = 0.0
 Identities = 353/431 (81%), Positives = 393/431 (91%), Gaps = 1/431 (0%)

Query: 1   MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLD 60
           M +LS  AT N+HGQDSSYFLGWQEYEKNPY EV N  GIIQMGLAENQL FDLLESWL 
Sbjct: 1   MRMLSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLA 60

Query: 61  RNPDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGA 120
           +NP+AA FK++G+SIF ELALFQDYHGLPAFKKA+V+FM+EIRGNKVTFD + +VLTAGA
Sbjct: 61  KNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGA 120

Query: 121 TSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEE 180
           TSANET +FCLA+PGEA L+PTPYYPGFDRDLKWRTGVEIVPI CTS NGFQITETA+EE
Sbjct: 121 TSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEE 180

Query: 181 AYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSS 240
           AYQ A+KR+L+VKGVLVTNPSNPLGTTM+RNEL LL++ + +K IHLISDEIYSGT FSS
Sbjct: 181 AYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSS 240

Query: 241 PGFVSIMEILKDRNC-ENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMS 299
           P F+S+ME+LKDRNC EN++VW RVH+VYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMS
Sbjct: 241 PSFISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMS 300

Query: 300 SFGLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLF 359
           SFGLVSSQTQ+LLSA+LSDKK T+NYI+EN KRLKQR +KLVSGL+K+GISCL  NAGLF
Sbjct: 301 SFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLF 360

Query: 360 CWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKL 419
           CWVDMRHLLRSNTFEAEMELWKKIVY+V LNISPGSSCHCTEPGWFRVCFAN+ E TL L
Sbjct: 361 CWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERTLDL 420

Query: 420 SMQRLKAFVDS 430
           +MQRLKAFV  
Sbjct: 421 AMQRLKAFVGE 431
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Length = 428 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Length = 416 Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Length = 375 Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Length = 427 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Length = 409 Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Length = 391 Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Length = 398 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Length = 389 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Length = 406 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Length = 412 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Length = 437 Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Length = 386 Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Length = 411 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Length = 404 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Length = 407 Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} PDB: 2zjg_A* 3e2f_A* 3e2z_A* Length = 410 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Length = 376 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Length = 447 Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Length = 422 Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Length = 429 Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Length = 498 Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Length = 370 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Length = 385 Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Length = 500 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Length = 389 Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Length = 381 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Length = 388 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Length = 444 Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Length = 427 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Length = 449 Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Length = 546 Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Length = 417 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Length = 432 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Length = 407 Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Length = 400 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Length = 533 Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Length = 391 Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Length = 448 Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Length = 425 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} Length = 376 Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Length = 425 Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Length = 423 Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Length = 427 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Length = 397 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Length = 396 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Length = 390 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} Length = 391 Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Length = 392 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Length = 391 Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Length = 399 Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Length = 421 Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Length = 377 Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Length = 422 Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Length = 364 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} Length = 361 Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Length = 350 Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Length = 354 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Length = 365 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} Length = 363 Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Length = 356 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Length = 369 Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Length = 335 Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} Length = 367 Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Length = 337 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Length = 360 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Length = 755 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 100.0
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 100.0
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 100.0
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 100.0
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 100.0
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 100.0
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 100.0
3aow_A448 Putative uncharacterized protein PH0207; protein-P 100.0
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 100.0
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 100.0
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 100.0
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 100.0
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 100.0
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 100.0
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 100.0
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 100.0
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 100.0
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 100.0
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 100.0
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 100.0
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 100.0
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 100.0
3ele_A398 Amino transferase; RER070207001803, structural gen 100.0
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 100.0
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 100.0
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 100.0
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 100.0
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 100.0
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 100.0
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 100.0
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 100.0
3nra_A407 Aspartate aminotransferase; structural genomics, j 100.0
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 100.0
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 100.0
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 100.0
1vp4_A425 Aminotransferase, putative; structural genomics, j 100.0
3rq1_A418 Aminotransferase class I and II; structural genomi 100.0
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 100.0
1xi9_A406 Putative transaminase; alanine aminotransferase, s 100.0
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 100.0
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 100.0
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 100.0
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 100.0
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 100.0
2z61_A370 Probable aspartate aminotransferase 2; amino acid 100.0
3l8a_A421 METC, putative aminotransferase, probable beta-cys 100.0
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 100.0
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 100.0
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 100.0
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 100.0
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 100.0
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 100.0
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 100.0
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 100.0
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 100.0
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 100.0
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 100.0
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 100.0
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 100.0
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 100.0
3ftb_A361 Histidinol-phosphate aminotransferase; structural 100.0
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 100.0
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 100.0
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 100.0
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 100.0
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 100.0
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 100.0
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 100.0
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 100.0
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 100.0
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 100.0
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 100.0
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 100.0
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 100.0
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 100.0
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 100.0
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 100.0
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 100.0
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 100.0
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 100.0
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 100.0
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 100.0
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 100.0
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 100.0
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 100.0
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 100.0
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 100.0
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 100.0
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 100.0
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 100.0
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 100.0
1svv_A359 Threonine aldolase; structural genomics, structura 100.0
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 100.0
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 100.0
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 100.0
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 100.0
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 100.0
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 100.0
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 100.0
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 100.0
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 100.0
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 100.0
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 100.0
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 100.0
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 100.0
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 100.0
1iug_A352 Putative aspartate aminotransferase; wild type, py 100.0
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 100.0
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 100.0
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 100.0
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.98
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.98
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.98
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.98
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.97
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.97
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.97
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.97
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.97
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.97
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.97
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.97
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.97
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.97
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.97
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.97
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.97
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.97
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.96
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.96
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.96
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.96
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.96
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.96
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.96
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.96
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.96
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.96
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.96
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.96
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.96
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.96
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.96
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.96
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.96
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.96
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.96
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.96
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.96
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.96
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.96
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.96
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.96
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.95
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.95
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.95
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.95
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.95
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.95
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.95
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.95
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.95
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.95
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.95
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.95
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.95
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.95
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.95
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.95
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.95
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.95
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.95
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.95
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.95
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.95
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.95
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.94
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.94
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.94
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.94
3hmu_A472 Aminotransferase, class III; structural genomics, 99.94
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.94
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.94
2fnu_A375 Aminotransferase; protein-product complex, structu 99.94
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.94
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.94
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.94
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.94
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.94
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.94
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.94
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.93
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.93
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.93
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.93
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.93
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.93
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.93
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.93
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.92
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.92
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.92
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.92
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.92
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.92
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.92
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.91
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.91
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.91
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.91
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.9
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.9
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.9
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.9
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.89
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.89
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.89
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.89
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.88
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.88
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.88
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.87
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.78
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.86
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.85
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.79
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.75
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.75
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.74
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.7
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.68
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.63
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.61
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.59
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.55
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.52
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 84.87
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 81.62
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
Probab=100.00  E-value=7e-58  Score=467.48  Aligned_cols=432  Identities=81%  Similarity=1.297  Sum_probs=352.3

Q ss_pred             CCccccccccccCCCCCccchhhhhhhcCCCCCCCCCCCeeeeeccccccChHHHHHHHhcCCCccccccCCcccccccc
Q 043923            1 MGLLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELA   80 (469)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~L~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (469)
                      |+|||.++.+.+++.++||+..|+.+..++|++..+|.++|+|+.++|+++.+.+.+++++.........+|........
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~p~~~i~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~   80 (435)
T 3piu_A            1 MRMLSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKNPEAAAFKKNGESIFAELA   80 (435)
T ss_dssp             -----------------CTTHHHHHHHHSBCBTTTBTTSBEECSSCCCCSSHHHHHHHHHHCTTGGGTEETTEECHHHHH
T ss_pred             CCccchhhhhcccccCcchhhHHHHhhcCCCCcccCCCCeEEeccccccccHHHHHHHHHhCcccccccccccccccccc
Confidence            89999999999999999999999999999999999999999999999999999999999886543222212222234457


Q ss_pred             cCCCCCCcHHHHHHHHHHHHhHcCCCCCCCCCcEEEeCChHHHHHHHHHHhcCCCCEEEEccCCCcChHHHHh-hhCCCE
Q 043923           81 LFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLK-WRTGVE  159 (469)
Q Consensus        81 ~Y~~~~g~~~Lr~aia~~l~~~~~~~~~~~~~~i~~t~G~~~al~~~~~~l~~~gd~Vl~~~P~y~~~~~~~~-~~~g~~  159 (469)
                      .|++..|..+|++++|+++++.++.++++++++|++|+|+++|+..++.+++++||.|+++.|+|..+...+. .. |++
T Consensus        81 ~y~~~~g~~~l~~~la~~~~~~~~~~~~~~~~~v~~~~gg~~a~~~~~~~l~~~gd~vl~~~p~~~~~~~~~~~~~-g~~  159 (435)
T 3piu_A           81 LFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRT-GVE  159 (435)
T ss_dssp             HCCCTTCCHHHHHHHHHHHHHHTTTSSCCCGGGEEEEEHHHHHHHHHHHHHCCTTCEEEEEESCCTTHHHHTTTTT-CCE
T ss_pred             ccCCCCCcHHHHHHHHHHHHHhhCCCCCCCHHHEEEcCChHHHHHHHHHHhcCCCCeEEECCCccccHHHHHHHhc-CCE
Confidence            8999999999999999999987776667789999999999999999999999999999999999999988887 55 999


Q ss_pred             EEEeeccCCCCcccCHHHHHHHHHHHHhcCCceeEEEEecCCCCCCCCCCHHHHHHHHHHHHhcCeEEEEeccccccccC
Q 043923          160 IVPIQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFS  239 (469)
Q Consensus       160 ~~~v~~~~~~~~~~d~~~l~~~i~~~~~~~~~~~~vvl~~P~NPtG~~~s~e~l~~l~~~~~~~~~~iI~Deay~~~~~~  239 (469)
                      ++.++++.+++|.+|++++++++++....+.++++|++++|+||||.+++.+++++|+++|++||+++|+||+|+++.|+
T Consensus       160 ~~~~~~~~~~~~~~d~~~l~~~l~~~~~~~~~~~~v~i~~p~nptG~~~~~~~l~~l~~~~~~~~~~li~Dea~~~~~~~  239 (435)
T 3piu_A          160 IVPIHCTSSNGFQITETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFS  239 (435)
T ss_dssp             EEEEECCGGGTSCCCHHHHHHHHHHHHHTTCCEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECTTGGGCCS
T ss_pred             EEEeeCCCccCCcCCHHHHHHHHHHHHhcCCCeEEEEEcCCCCCCCCCCCHHHHHHHHHHHHHcCCEEEEeccccccccC
Confidence            99999987778899999999999876555668999999999999999999999999999999999999999999988887


Q ss_pred             CCCccchhhhhhccccc-cCCcCCeEEEEccCccccCCCcceEEEEEecCHHHHHHHHHhcccccCcHHHHHHHHHHhcC
Q 043923          240 SPGFVSIMEILKDRNCE-NTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSD  318 (469)
Q Consensus       240 ~~~~~s~~~~~~~~~~~-~~~~~~~~i~i~S~SK~~g~~GlRiG~li~~~~~~~~~~~~~~~~~~~s~~~q~~~~~~l~~  318 (469)
                      +..+.++..+..+.++. ..+..+++++++|+||+||++|+|+||++++++.+.+.+.....++..+++.|.++.+++.+
T Consensus       240 ~~~~~~~~~~~~~~~~d~~~~~~~~~i~i~s~sK~~g~~G~r~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  319 (435)
T 3piu_A          240 SPSFISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSD  319 (435)
T ss_dssp             SSCCCCHHHHHHC-------CGGGGEEEEEESSSSSCCGGGCEEEEEESCHHHHHHHHHHGGGSCCCHHHHHHHHHHHHC
T ss_pred             CCCCcCHHHhccccccccccCCCCCEEEEEeeecccCCCceeEEEEEeCCHHHHHHHHHHhhcCCCCHHHHHHHHHHhcC
Confidence            76666766664410000 00005788999999999999999999999977777777777766777889999999999998


Q ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHHHhcCCceecCCceEEEEEecccccccCChhHHHHHHHHHHHhCCeEEeCCCCCC
Q 043923          319 KKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCH  398 (469)
Q Consensus       319 ~~~~~~~~~~~~~~l~~~~~~l~~~L~~~g~~v~~~~~g~~~~v~~~~~~~~~~~~~~~~l~~~ll~~~GI~v~pg~~f~  398 (469)
                      ..++.+++++.+++++++++++.+.|++.|+++.++.+|+|+|++++............+++..+++++||.+.||..|+
T Consensus       320 ~~~~~~~~~~~~~~~~~~~~~l~~~L~~~g~~~~~~~~g~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~gi~v~~g~~~~  399 (435)
T 3piu_A          320 KKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCH  399 (435)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCEECCCCSSSEEEEECGGGSSSSSHHHHHHHHHHHHHTSCEECEEGGGGT
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccCCCeeEEEEEEcccccccCCchhHHHHHHHHHHHCCEEEeCCcccC
Confidence            87767788889999999999999999999999999999999999998654333333456788888887899999999998


Q ss_pred             CCCCCeEEEEeecCCHHHHHHHHHHHHHHHHhhcc
Q 043923          399 CTEPGWFRVCFANMSEDTLKLSMQRLKAFVDSITT  433 (469)
Q Consensus       399 ~~~~~~iRi~~~~~~~e~i~~~l~~L~~~l~~~~~  433 (469)
                      ..+++++||+++..+++++++++++|++++++.++
T Consensus       400 ~~~~~~iRi~~~~~~~e~i~~~l~~l~~~l~~~~~  434 (435)
T 3piu_A          400 CTEPGWFRVCFANLPERTLDLAMQRLKAFVGEYYN  434 (435)
T ss_dssp             CSSTTEEEEECSSSCHHHHHHHHHHHHHHHHHHC-
T ss_pred             CCCCCEEEEEeeCCCHHHHHHHHHHHHHHHHHHhC
Confidence            77789999999856999999999999999987653
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 469
d1m7ya_431 c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate sy 1e-121
d1iaya_428 c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate sy 1e-107
d1j32a_388 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pho 2e-58
d1b5pa_382 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 2e-52
d1gdea_388 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 7e-50
d1xi9a_395 c.67.1.1 (A:) Putative alanine aminotransferase {P 5e-36
d2hoxa1425 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativ 5e-34
d1o4sa_375 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 6e-30
d1ajsa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 1e-28
d1w7la_418 c.67.1.1 (A:) Kynurenine--oxoglutarate transaminas 3e-27
d2q7wa1396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 5e-27
d3tata_397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 7e-24
d2r5ea1418 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate trans 3e-23
d1wsta1403 c.67.1.1 (A:13-415) Multiple substrate aminotransf 6e-23
d1yaaa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 2e-22
d7aata_401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 8e-22
d1v2da_368 c.67.1.1 (A:) Glutamine aminotransferase {Thermus 1e-19
d1bw0a_412 c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Try 9e-19
d2ay1a_394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 1e-17
d1u08a_382 c.67.1.1 (A:) Putative methionine aminotransferase 2e-15
d1c7na_394 c.67.1.3 (A:) Cystalysin {Treponema denticola [Tax 6e-12
d1vp4a_420 c.67.1.1 (A:) Putative aminotransferase TM1131 {Th 1e-11
d1d2fa_361 c.67.1.3 (A:) Modulator in mal gene expression, Ma 3e-10
d1fg7a_354 c.67.1.1 (A:) Histidinol-phosphate aminotransferas 3e-06
d2e7ja1364 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase ( 2e-04
d1p3wa_391 c.67.1.3 (A:) Cysteine desulfurase IscS {Escherich 6e-04
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Length = 431 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: 1-aminocyclopropane-1-carboxylate synthase (ACC synthase)
species: Apple (Malus domestica) [TaxId: 3750]

 Score =  358 bits (918), Expect = e-121
 Identities = 352/428 (82%), Positives = 392/428 (91%), Gaps = 1/428 (0%)

Query: 3   LLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRN 62
           +LS  AT N+HGQDSSYFLGWQEYEKNPY EV N  GIIQMGLAENQL FDLLESWL +N
Sbjct: 1   MLSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKN 60

Query: 63  PDAAGFKRDGQSIFRELALFQDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATS 122
           P+AA FK++G+SIF ELALFQDYHGLPAFKKA+V+FM+EIRGNKVTFD + +VLTAGATS
Sbjct: 61  PEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATS 120

Query: 123 ANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVPIQCTSLNGFQITETAIEEAY 182
           ANET +FCLA+PGEA L+PTPYYPGFDRDLKWRTGVEIVPI CTS NGFQITETA+EEAY
Sbjct: 121 ANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAY 180

Query: 183 QLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSSPG 242
           Q A+KR+L+VKGVLVTNPSNPLGTTM+RNEL LL++ + +K IHLISDEIYSGT FSSP 
Sbjct: 181 QEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPS 240

Query: 243 FVSIMEILKDRNC-ENTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSF 301
           F+S+ME+LKDRNC EN++VW RVH+VYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSF
Sbjct: 241 FISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSF 300

Query: 302 GLVSSQTQYLLSALLSDKKFTQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCW 361
           GLVSSQTQ+LLSA+LSDKK T+NYI+EN KRLKQR +KLVSGL+K+GISCL  NAGLFCW
Sbjct: 301 GLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCW 360

Query: 362 VDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTEPGWFRVCFANMSEDTLKLSM 421
           VDMRHLLRSNTFEAEMELWKKIVY+V LNISPGSSCHCTEPGWFRVCFAN+ E TL L+M
Sbjct: 361 VDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERTLDLAM 420

Query: 422 QRLKAFVD 429
           QRLKAFV 
Sbjct: 421 QRLKAFVG 428
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 428 Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Length = 388 Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Length = 382 Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 388 Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Length = 395 Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Length = 425 Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Length = 375 Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Length = 418 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Length = 418 Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Length = 403 Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Length = 368 Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Length = 412 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Length = 382 Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Length = 394 Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Length = 420 Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Length = 361 Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Length = 354 Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 364 Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query469
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 100.0
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 100.0
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 100.0
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 100.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 100.0
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 100.0
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 100.0
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 100.0
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 100.0
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 100.0
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 100.0
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 100.0
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 100.0
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 100.0
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.96
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.95
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.92
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.92
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.91
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.9
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.9
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.9
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.86
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.86
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.86
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.85
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.84
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.82
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.81
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.78
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.77
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.77
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.77
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.76
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.75
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.75
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.75
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.75
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.74
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.74
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.72
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.72
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.71
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.71
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.7
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.69
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.69
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.69
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.69
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.68
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.67
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.66
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.66
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.66
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.65
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.63
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.63
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.62
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.62
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.61
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.6
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.6
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.59
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.59
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.56
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.5
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.48
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.46
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.27
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.2
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 99.06
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 98.94
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.93
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 86.53
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 84.12
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 82.16
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 81.99
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 81.63
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 80.79
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 80.62
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 80.05
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: 1-aminocyclopropane-1-carboxylate synthase (ACC synthase)
species: Apple (Malus domestica) [TaxId: 3750]

Probab=100.00  E-value=1e-68  Score=544.37  Aligned_cols=429  Identities=82%  Similarity=1.323  Sum_probs=376.4

Q ss_pred             ccccccccccCCCCCccchhhhhhhcCCCCCCCCCCCeeeeeccccccChHHHHHHHhcCCCccccccCCcccccccccC
Q 043923            3 LLSGKATCNTHGQDSSYFLGWQEYEKNPYDEVQNPTGIIQMGLAENQLSFDLLESWLDRNPDAAGFKRDGQSIFRELALF   82 (469)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~L~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y   82 (469)
                      |||+||+.+++++++|||.+|+.+..|+|++..||.|+|+|+++||.++.+.+.+++.+.+........+.....+...|
T Consensus         1 ~~~~~~~~~~~~~~s~y~~g~~~~~~~~~~~~~np~G~i~l~~~en~l~~d~~~~~l~~~~~~~~~~~~~~~~~~~~~~Y   80 (431)
T d1m7ya_           1 MLSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKNPEAAAFKKNGESIFAELALF   80 (431)
T ss_dssp             CCCSTTC-------CHHHHHHHHHHHSBCCSSSCTTSBEECSSCCCCSCHHHHHHHHHHCCTGGGTEETTEECHHHHHHC
T ss_pred             CcchhhcccCCccCCchhhhhhhhhcCCCCCcCCCCcEEEeecccccccHHHHHHHHHhCCchhhhhhhhhhccHHhcCC
Confidence            89999999999999999999999999999999999999999999999999999999998776544433333334456789


Q ss_pred             CCCCCcHHHHHHHHHHHHhHcCCCCCCCCCcEEEeCChHHHHHHHHHHhcCCCCEEEEccCCCcChHHHHhhhCCCEEEE
Q 043923           83 QDYHGLPAFKKALVEFMSEIRGNKVTFDTSKIVLTAGATSANETLMFCLAEPGEAFLLPTPYYPGFDRDLKWRTGVEIVP  162 (469)
Q Consensus        83 ~~~~g~~~Lr~aia~~l~~~~~~~~~~~~~~i~~t~G~~~al~~~~~~l~~~gd~Vl~~~P~y~~~~~~~~~~~g~~~~~  162 (469)
                      +++.|.++||++||+|++++++.++++++++|++|+|+++++..++.++++|||.|++++|+|..+...+....|+++++
T Consensus        81 ~~~~G~~~LR~aiA~~l~~~~~~~~~~~pe~I~it~G~~~al~~~~~~l~~pGd~Vlv~~P~y~~~~~~~~~~~g~~~v~  160 (431)
T d1m7ya_          81 QDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVP  160 (431)
T ss_dssp             CCTTCCHHHHHHHHHHHHHHTTTSSCCCGGGEEEEEHHHHHHHHHHHHHCCTTCEEEEEESCCTTHHHHTTTTTCCEEEE
T ss_pred             cCCcCcHHHHHHHHHHHHHHhCCCCCCCcceEEECCCHHHHHHHHHHHhcCCCCEEEEeCCCchhHHHHHHHhcCceecc
Confidence            99999999999999999999987788899999999999999999999999999999999999999988887655899999


Q ss_pred             eeccCCCCcccCHHHHHHHHHHHHhcCCceeEEEEecCCCCCCCCCCHHHHHHHHHHHHhcCeEEEEeccccccccCCCC
Q 043923          163 IQCTSLNGFQITETAIEEAYQLAQKRHLKVKGVLVTNPSNPLGTTMSRNELNLLVNIITEKNIHLISDEIYSGTVFSSPG  242 (469)
Q Consensus       163 v~~~~~~~~~~d~~~l~~~i~~~~~~~~~~~~vvl~~P~NPtG~~~s~e~l~~l~~~~~~~~~~iI~Deay~~~~~~~~~  242 (469)
                      ++++.+++|.+|++.++.++++....+.++++++++|||||||.+++.+++++|+++|++|+++||+||+|+++.|++..
T Consensus       161 v~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~i~~~nP~NPtG~~~s~~~l~~i~~~a~~~~~~vI~De~Y~~~~~~~~~  240 (431)
T d1m7ya_         161 IHCTSSNGFQITETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPS  240 (431)
T ss_dssp             EECCGGGTSCCCHHHHHHHHHHHHHTTCCEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECTTGGGCCSSSC
T ss_pred             ccccchhcccccHHHhhhhhhhhhhccCcceEEEecCccccccccccccccccccccccccCcceeecccccccccCCCC
Confidence            99998889999999999999888778889999999999999999999999999999999999999999999999999888


Q ss_pred             ccchhhhhhccccc-cCCcCCeEEEEccCccccCCCcceEEEEEecCHHHHHHHHHhcccccCcHHHHHHHHHHhcCchh
Q 043923          243 FVSIMEILKDRNCE-NTQVWNRVHIVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQYLLSALLSDKKF  321 (469)
Q Consensus       243 ~~s~~~~~~~~~~~-~~~~~~~~i~i~S~SK~~g~~GlRiG~li~~~~~~~~~~~~~~~~~~~s~~~q~~~~~~l~~~~~  321 (469)
                      +.++.++.++.... ..+..+++++++|+||.||++|+|+||++++++.+.........+..+++..|.++.+.+.+..+
T Consensus       241 ~~s~~~~~~~~~~~~~~~~~~~vi~~~s~SK~~~~~G~RiG~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~a~l~~~~~  320 (431)
T d1m7ya_         241 FISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKL  320 (431)
T ss_dssp             CCCHHHHTTTTTCSSSSSGGGGEEEEEESSSSSCCGGGCEEEEEESCHHHHHHHHHHGGGSCCCHHHHHHHHHHHHCHHH
T ss_pred             CCCHHHHhhhcccccccccCceEEEEecCcccccCCCCccceeccchhhhHHHHHHHhccccccccccchhhhhhccchh
Confidence            88887765532110 01234689999999999999999999999988877777766666666788888888888888777


Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhcCCceecCCceEEEEEecccccccCChhHHHHHHHHHHHhCCeEEeCCCCCCCCC
Q 043923          322 TQNYISENKKRLKQRHRKLVSGLEKAGISCLKSNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYDVKLNISPGSSCHCTE  401 (469)
Q Consensus       322 ~~~~~~~~~~~l~~~~~~l~~~L~~~g~~v~~~~~g~~~~v~~~~~~~~~~~~~~~~l~~~ll~~~GI~v~pg~~f~~~~  401 (469)
                      ..+++++.++.++++++.+.+.|++.|+++.+|++|+|+|++++.........++.++++++++++||.+.||+.|+..+
T Consensus       321 ~~~~~~~~~~~~~~~~~~l~~~L~~~gi~~~~p~gg~f~w~~l~~~~~~~~~~~~~~l~~~ll~~~gV~v~PG~~F~~~~  400 (431)
T d1m7ya_         321 TKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTE  400 (431)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTTCEECCCCSSSEEEEECGGGSSSSSHHHHHHHHHHHHHTSCEECEEGGGGTCSS
T ss_pred             hhhhhhhhhhhhhhhhhhhhhhhhcCCcEEecCCceeEEEEECccccccCcccCHHHHHHHHHHHCCEEEEeccccCCCC
Confidence            68889999999999999999999999999999999999999999887777778888999999999999999999999888


Q ss_pred             CCeEEEEeecCCHHHHHHHHHHHHHHHHhh
Q 043923          402 PGWFRVCFANMSEDTLKLSMQRLKAFVDSI  431 (469)
Q Consensus       402 ~~~iRi~~~~~~~e~i~~~l~~L~~~l~~~  431 (469)
                      ++|+||+++..++++++++++||+++++++
T Consensus       401 ~~~~Ri~~a~~~e~~l~~al~rL~~~l~~~  430 (431)
T d1m7ya_         401 PGWFRVCFANLPERTLDLAMQRLKAFVGEY  430 (431)
T ss_dssp             TTEEEEECSSSCHHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEeCcCCHHHHHHHHHHHHHHHHHh
Confidence            999999998667889999999999999875
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure