Citrus Sinensis ID: 043924


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MVIMFVLLLIILEGGGSEGCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIGNWDLKERYLNASLFTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRLEGNIDVK
cHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEcccc
cHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccHHcccccccEEEEccccccccccHHHHHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccc
MVIMFVLLLIILegggsegclDQERFALLRLKlffddpfnslhhwvddegatdccqwervecsnttgRVIQLDLsfignwdlkerylnaslftpfQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSnrlegnidvk
MVIMFVLLLIILEGGGSEGCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIGNWDLKERYLNASLFTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTslylysnrlegnidvk
MVIMFVllliilegggsegCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIGNWDLKERYLNASLFTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHlssltslylysNRLEGNIDVK
*VIMFVLLLIILEGGGSEGCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIGNWDLKERYLNASLFTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRL*******
MVIMFVLLLIILEGGGSEGCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIGNWD**********FTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRLEGNID**
MVIMFVLLLIILEGGGSEGCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIGNWDLKERYLNASLFTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRLEGNIDVK
MVIMFVLLLIILEGGGSEGCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIGNWDLKERYLNASLFTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRLEGNI***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIMFVLLLIILEGGGSEGCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIGNWDLKERYLNASLFTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRLEGNIDVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
Q05091 330 Polygalacturonase inhibit N/A no 0.886 0.448 0.318 2e-11
Q9C9H7 847 Receptor-like protein 12 no no 0.946 0.186 0.312 5e-10
Q9LFS4 638 Protein NSP-INTERACTING K no no 0.724 0.189 0.330 5e-09
Q9SH71 587 Putative inactive recepto no no 0.874 0.248 0.291 2e-08
C0LGW6 966 LRR receptor-like serine/ no no 0.844 0.145 0.311 3e-08
Q8GT95 332 Polygalacturonase inhibit no no 0.814 0.409 0.286 2e-07
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.658 0.109 0.355 4e-07
Q8VZG8 1045 Probable LRR receptor-lik no no 0.928 0.148 0.289 4e-07
Q94AG2 625 Somatic embryogenesis rec no no 0.910 0.243 0.343 4e-07
A7PW81 333 Polygalacturonase inhibit no no 0.838 0.420 0.297 6e-07
>sp|Q05091|PGIP_PYRCO Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1 Back     alignment and function desciption
 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 85/176 (48%), Gaps = 28/176 (15%)

Query: 11  ILEGGGSEGCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVI 70
           +L    S+ C   ++  LL++K  F DP+  L  W  D   TDCC W  V C +TT R+ 
Sbjct: 18  VLNPALSDLCNPDDKKVLLQIKKAFGDPY-VLASWKSD---TDCCDWYCVTCDSTTNRIN 73

Query: 71  QLDL----------SFIGNWDLKER---YLNASLFTPFQQ-------LESLYLEYNNIAG 110
            L +          + +G+    E    +   +L  P Q        L+SL L + N++G
Sbjct: 74  SLTIFAGQVSGQIPALVGDLPYLETLEFHKQPNLTGPIQPAIAKLKGLKSLRLSWTNLSG 133

Query: 111 CVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRLEGNIDV 166
            V     + LS+L NL  LDLS N    +I SS++ L +L +L L  N+L G+I +
Sbjct: 134 SVP----DFLSQLKNLTFLDLSFNNLTGAIPSSLSELPNLGALRLDRNKLTGHIPI 185




Inhibitor of fungal polygalacturonase. It is an important factor for plant resistance to phytopathogenic fungi.
Pyrus communis (taxid: 23211)
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LFS4|NIK1_ARATH Protein NSP-INTERACTING KINASE 1 OS=Arabidopsis thaliana GN=NIK1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SH71|Y1421_ARATH Putative inactive receptor-like protein kinase At1g64210 OS=Arabidopsis thaliana GN=At1g64210 PE=3 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8GT95|PGIP1_ORYSJ Polygalacturonase inhibitor 1 OS=Oryza sativa subsp. japonica GN=FOR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q94AG2|SERK1_ARATH Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2 Back     alignment and function description
>sp|A7PW81|PGIP_VITVI Polygalacturonase inhibitor OS=Vitis vinifera GN=pgip PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
224120284 929 predicted protein [Populus trichocarpa] 0.976 0.175 0.485 1e-35
224070712174 predicted protein [Populus trichocarpa] 0.988 0.948 0.5 2e-33
224112233 976 leucine rich repeat family protein with 0.988 0.169 0.523 8e-33
224142723 923 predicted protein [Populus trichocarpa] 0.940 0.170 0.531 2e-32
224142499 436 predicted protein [Populus trichocarpa] 0.940 0.360 0.505 3e-32
224145105 280 predicted protein [Populus trichocarpa] 0.982 0.585 0.508 3e-32
224142503177 predicted protein [Populus trichocarpa] 0.946 0.892 0.497 4e-32
224142721 926 predicted protein [Populus trichocarpa] 0.982 0.177 0.508 1e-31
224073949 280 predicted protein [Populus trichocarpa] 0.982 0.585 0.514 1e-31
224142717 876 predicted protein [Populus trichocarpa] 0.988 0.188 0.505 2e-31
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 81/167 (48%), Positives = 118/167 (70%), Gaps = 4/167 (2%)

Query: 2   VIMFVLLLIILEGGGSEGCLDQERFALLRLKLFFDDPFNSLHH-WVDDEGATDCCQWERV 60
           VIM + ++++++G    GCL++ER ALL++K  F  P  S  H W  D    +CC+W++V
Sbjct: 10  VIMIINVVVLIQGWRCHGCLEEERVALLQIKDAFSYPNGSFPHSWGRD---ANCCEWKQV 66

Query: 61  ECSNTTGRVIQLDLSFIGNWDLKERYLNASLFTPFQQLESLYLEYNNIAGCVENEGIERL 120
           +C++TT RV+++DLSF   W+L +  LNASLF PF +L +L L  N IAGC+ENEG ERL
Sbjct: 67  QCNSTTLRVVKIDLSFSRGWELGDWLLNASLFLPFPELNALNLYGNRIAGCLENEGFERL 126

Query: 121 SRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRLEGNIDVK 167
           S L NL++L+L +N FN+SI SS+  LSSL +L L++N +EG I V+
Sbjct: 127 SVLGNLEILELGQNKFNSSIFSSLGGLSSLKNLSLHNNEIEGTISVE 173




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224070712|ref|XP_002303209.1| predicted protein [Populus trichocarpa] gi|222840641|gb|EEE78188.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112233|ref|XP_002332812.1| leucine rich repeat family protein with ABC domain [Populus trichocarpa] gi|222833206|gb|EEE71683.1| leucine rich repeat family protein with ABC domain [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142723|ref|XP_002324704.1| predicted protein [Populus trichocarpa] gi|222866138|gb|EEF03269.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142499|ref|XP_002324594.1| predicted protein [Populus trichocarpa] gi|222866028|gb|EEF03159.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145105|ref|XP_002336200.1| predicted protein [Populus trichocarpa] gi|222832534|gb|EEE71011.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142503|ref|XP_002324596.1| predicted protein [Populus trichocarpa] gi|222866030|gb|EEF03161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142721|ref|XP_002324703.1| predicted protein [Populus trichocarpa] gi|222866137|gb|EEF03268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073949|ref|XP_002335892.1| predicted protein [Populus trichocarpa] gi|222836248|gb|EEE74669.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142717|ref|XP_002324701.1| predicted protein [Populus trichocarpa] gi|222866135|gb|EEF03266.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.862 0.147 0.383 2.3e-18
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.868 0.159 0.354 1.4e-16
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.862 0.154 0.352 1.8e-16
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.862 0.149 0.333 5.1e-16
TAIR|locus:2119535 725 RLP48 "receptor like protein 4 0.610 0.140 0.389 5.8e-14
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.748 0.115 0.335 3.8e-11
TAIR|locus:2078112 868 RLP32 "receptor like protein 3 0.826 0.158 0.335 9.8e-11
TAIR|locus:2094603 835 RLP37 "receptor like protein 3 0.820 0.164 0.344 1.9e-10
TAIR|locus:2096339 786 RLP30 "receptor like protein 3 0.802 0.170 0.346 2.3e-10
TAIR|locus:2078102 875 RLP33 "receptor like protein 3 0.658 0.125 0.322 4e-09
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 234 (87.4 bits), Expect = 2.3e-18, P = 2.3e-18
 Identities = 61/159 (38%), Positives = 87/159 (54%)

Query:    20 CLDQERFALLRLKLFF-----DDPFNS-LHHWVDDEGATDCCQWERVECSNTTGRVIQLD 73
             C+++ER ALL LK +      D   +S L  W +D   ++CC+WE ++C+ T+GR+I+L 
Sbjct:    27 CIEKERKALLELKKYMISKTADWGLDSVLPTWTNDT-KSNCCRWEGLKCNQTSGRIIELS 85

Query:    74 LSFIGNWDLKER-YLNASLFTPFQQLESLYLE---YNNIAGCVEN-EGIERLSRLSNLKM 128
                IG  + KE   LN SL  PF++L SL L    YN   G  ++ EG E L RL NL++
Sbjct:    86 ---IGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEI 142

Query:   129 LDLSENLFNNSILSSVAHXXXXXXXXXXXNRLEGNIDVK 167
             LDLS N FNNSI   +             N + G + +K
Sbjct:   143 LDLSSNSFNNSIFPFLNAATSLTTLFIQSNYIGGPLPIK 181




GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096339 RLP30 "receptor like protein 30" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01520050
hypothetical protein (929 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-06
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 9e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 52.5 bits (126), Expect = 1e-08
 Identities = 55/202 (27%), Positives = 83/202 (41%), Gaps = 47/202 (23%)

Query: 2   VIMFVLLLIILEGGGSEGCLDQERFALL-RLKLFFDDPFNSLHHWVDDEGATDCCQWERV 60
            ++F+L  + L    +   L  E   LL   K   +DP   L +W     + D C W+ +
Sbjct: 11  YLIFMLFFLFL----NFSMLHAEELELLLSFKSSINDPLKYLSNW---NSSADVCLWQGI 63

Query: 61  ECSNTTGRVIQLDLS----------------FIGNWDLKERYLNASL----FTPFQQLES 100
            C+N++ RV+ +DLS                +I   +L    L+  +    FT    L  
Sbjct: 64  TCNNSS-RVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRY 122

Query: 101 LYLEYNNIAGCVENEGIERLSRL------------------SNLKMLDLSENLFNNSILS 142
           L L  NN  G +    I  L  L                  S+LK+LDL  N+    I +
Sbjct: 123 LNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN 182

Query: 143 SVAHLSSLTSLYLYSNRLEGNI 164
           S+ +L+SL  L L SN+L G I
Sbjct: 183 SLTNLTSLEFLTLASNQLVGQI 204


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
PLN03150 623 hypothetical protein; Provisional 99.85
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.82
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.29
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.2
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 99.08
PLN03150 623 hypothetical protein; Provisional 99.01
KOG0617 264 consensus Ras suppressor protein (contains leucine 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.7
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.67
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.62
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.57
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.56
KOG0617264 consensus Ras suppressor protein (contains leucine 98.52
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.48
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.39
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.36
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.36
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.33
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.3
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.27
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.22
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.18
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.11
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.09
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.08
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.07
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.06
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.05
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.01
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.86
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 97.7
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.7
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.69
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.68
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.57
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.52
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.5
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 97.41
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.37
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.26
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 96.98
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 96.91
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.85
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.8
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.79
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.69
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.64
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.38
KOG0473 326 consensus Leucine-rich repeat protein [Function un 96.01
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.94
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 95.65
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.6
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.44
smart0037026 LRR Leucine-rich repeats, outliers. 95.44
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 95.4
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.57
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.27
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.17
smart0037026 LRR Leucine-rich repeats, outliers. 94.17
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 94.16
KOG2982 418 consensus Uncharacterized conserved protein [Funct 94.0
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 93.48
KOG2123 388 consensus Uncharacterized conserved protein [Funct 93.02
PRK15386 426 type III secretion protein GogB; Provisional 91.88
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 91.72
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 91.1
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 90.2
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.19
PRK15386 426 type III secretion protein GogB; Provisional 88.57
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 86.59
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 83.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 83.09
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 80.27
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.85  E-value=6.7e-21  Score=161.21  Aligned_cols=139  Identities=29%  Similarity=0.375  Sum_probs=116.4

Q ss_pred             CCCCCHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCcceeeEEEeCCC----CCEEEEEcCCCCCCCccccccCCccc
Q 043924           17 SEGCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTT----GRVIQLDLSFIGNWDLKERYLNASLF   92 (167)
Q Consensus        17 ~~~~~~~~~~aL~~~k~~~~~~~~~~~~W~~~~~~~~~c~w~gv~C~~~~----~~v~~L~L~~~~l~~l~~~~l~~~~~   92 (167)
                      ...+.++|++||+++|+.+..+.  ..+|.++.|.+..|.|.||.|....    ..|+.|+|+++.+...     .+..+
T Consensus       366 ~~~t~~~~~~aL~~~k~~~~~~~--~~~W~g~~C~p~~~~w~Gv~C~~~~~~~~~~v~~L~L~~n~L~g~-----ip~~i  438 (623)
T PLN03150        366 ESKTLLEEVSALQTLKSSLGLPL--RFGWNGDPCVPQQHPWSGADCQFDSTKGKWFIDGLGLDNQGLRGF-----IPNDI  438 (623)
T ss_pred             ccccCchHHHHHHHHHHhcCCcc--cCCCCCCCCCCcccccccceeeccCCCCceEEEEEECCCCCcccc-----CCHHH
Confidence            34567789999999999985432  2489875544444589999996311    2589999999988632     14457


Q ss_pred             cCCCCccEEEcCCCceeeecCcccccccCCCCCCCEEeCcCCcCCchhhHhhhcCCCCCEEECcCCcceecCCC
Q 043924           93 TPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRLEGNIDV  166 (167)
Q Consensus        93 ~~l~~L~~L~Ls~n~l~g~ip~~~~~~~~~l~~L~~L~ls~N~l~g~iP~~l~~l~~L~~L~L~~N~lsG~iP~  166 (167)
                      ..+++|+.|+|++|.+.|.+|..    ++.+++|+.|+|++|+++|.+|+.++++++|++|+|++|+++|.+|.
T Consensus       439 ~~L~~L~~L~Ls~N~l~g~iP~~----~~~l~~L~~LdLs~N~lsg~iP~~l~~L~~L~~L~Ls~N~l~g~iP~  508 (623)
T PLN03150        439 SKLRHLQSINLSGNSIRGNIPPS----LGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRVPA  508 (623)
T ss_pred             hCCCCCCEEECCCCcccCcCChH----HhCCCCCCEEECCCCCCCCCCchHHhcCCCCCEEECcCCcccccCCh
Confidence            88999999999999999999988    99999999999999999999999999999999999999999999996



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-07
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-06
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 5e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-06
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 5e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-05
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-06
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-05
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 6e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 6e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score = 97.3 bits (243), Expect = 3e-24
 Identities = 38/148 (25%), Positives = 64/148 (43%), Gaps = 15/148 (10%)

Query: 19  GCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQWERVECSNTTGRVIQLDLSFIG 78
             L +E   L+  K    D  N L  W  +    + C ++ V C +   +V  +DLS   
Sbjct: 8   QSLYREIHQLISFKDVLPDK-NLLPDWSSN---KNPCTFDGVTCRD--DKVTSIDLSSKP 61

Query: 79  NWDLKERYLNASLFTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNN 138
             ++    +++SL      LESL+L  ++I G      +      ++L  LDLS N  + 
Sbjct: 62  L-NVGFSAVSSSLL-SLTGLESLFLSNSHING-----SVSGFKCSASLTSLDLSRNSLSG 114

Query: 139 SI--LSSVAHLSSLTSLYLYSNRLEGNI 164
            +  L+S+   S L  L + SN L+   
Sbjct: 115 PVTTLTSLGSCSGLKFLNVSSNTLDFPG 142


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.85
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.83
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.63
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.53
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.53
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.5
3m19_A 251 Variable lymphocyte receptor A diversity region; a 99.49
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.48
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.47
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.47
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.46
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.43
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.41
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 99.37
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.37
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.37
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.35
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.35
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.34
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.34
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.32
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.32
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.31
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.3
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.29
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.29
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 99.29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.29
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.28
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.27
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.27
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.26
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.26
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.25
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.23
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.21
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.21
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.2
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.2
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.19
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.04
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.03
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.99
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.99
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.98
4glp_A 310 Monocyte differentiation antigen CD14; alpha beta 98.98
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.98
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.98
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 98.94
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.94
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.93
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.92
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.92
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 98.91
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.9
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.87
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.87
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.85
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.84
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.84
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.84
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.83
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.79
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.79
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.77
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.75
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.6
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.56
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.54
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.5
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.43
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.42
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.4
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.2
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.19
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.16
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.02
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.79
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.7
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.52
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.51
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.42
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.02
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.51
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.46
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.31
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.11
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.05
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.5
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.94
4gt6_A394 Cell surface protein; leucine rich repeats, putati 90.83
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.76
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 88.2
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.92  E-value=7.5e-25  Score=169.98  Aligned_cols=140  Identities=30%  Similarity=0.502  Sum_probs=102.1

Q ss_pred             CCCHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCcc--eeeEEEeCCC--CCEEEEEcCCCCCCC---ccc-------
Q 043924           19 GCLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQ--WERVECSNTT--GRVIQLDLSFIGNWD---LKE-------   84 (167)
Q Consensus        19 ~~~~~~~~aL~~~k~~~~~~~~~~~~W~~~~~~~~~c~--w~gv~C~~~~--~~v~~L~L~~~~l~~---l~~-------   84 (167)
                      .|.++|++||++||+++.++. .+.+|..+.   +||.  |.||+|+...  ++|+.|+++++.+..   +..       
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~-~l~~W~~~~---~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~   77 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTT---DCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPY   77 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTS---CTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred             CCCHHHHHHHHHHHHhcCCcc-cccCCCCCC---CCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCC
Confidence            588999999999999996653 788998766   8998  9999998633  799999999998863   110       


Q ss_pred             ---------cc---cCCccccCCCCccEEEcCCCceeeecCcccccccCCCCCCCEEeCcCCcCCchhhHhhhcCCCCCE
Q 043924           85 ---------RY---LNASLFTPFQQLESLYLEYNNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTS  152 (167)
Q Consensus        85 ---------~~---l~~~~~~~l~~L~~L~Ls~n~l~g~ip~~~~~~~~~l~~L~~L~ls~N~l~g~iP~~l~~l~~L~~  152 (167)
                               +.   ..+..+..+++|++|++++|.+++.+|..    +..+++|++|++++|++++.+|..+.++++|++
T Consensus        78 L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~----~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~  153 (313)
T 1ogq_A           78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDF----LSQIKTLVTLDFSYNALSGTLPPSISSLPNLVG  153 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGG----GGGCTTCCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             CCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHH----HhCCCCCCEEeCCCCccCCcCChHHhcCCCCCe
Confidence                     00   11223555666666666666666666665    677777777777777777777777777777777


Q ss_pred             EECcCCcceecCCC
Q 043924          153 LYLYSNRLEGNIDV  166 (167)
Q Consensus       153 L~L~~N~lsG~iP~  166 (167)
                      |++++|+++|.+|.
T Consensus       154 L~L~~N~l~~~~p~  167 (313)
T 1ogq_A          154 ITFDGNRISGAIPD  167 (313)
T ss_dssp             EECCSSCCEEECCG
T ss_pred             EECcCCcccCcCCH
Confidence            77777777777664



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 167
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 45.1 bits (105), Expect = 1e-06
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 20 CLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCCQ--WERVECSNTTG--RVIQLDLS 75
          C  Q++ ALL++K    +P  +L  W+     TDCC   W  V C   T   RV  LDLS
Sbjct: 3  CNPQDKQALLQIKKDLGNP-TTLSSWLPT---TDCCNRTWLGVLCDTDTQTYRVNNLDLS 58


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.37
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.31
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.24
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.12
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.1
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.09
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.07
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.04
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.94
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.85
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.84
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.65
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.58
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.57
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.56
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.4
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.16
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.03
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.0
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.91
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.9
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.66
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.16
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.05
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.94  E-value=6.6e-27  Score=179.20  Aligned_cols=135  Identities=28%  Similarity=0.491  Sum_probs=105.5

Q ss_pred             CCHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCc--ceeeEEEeCC--CCCEEEEEcCCCCCCCccccccCCccccCC
Q 043924           20 CLDQERFALLRLKLFFDDPFNSLHHWVDDEGATDCC--QWERVECSNT--TGRVIQLDLSFIGNWDLKERYLNASLFTPF   95 (167)
Q Consensus        20 ~~~~~~~aL~~~k~~~~~~~~~~~~W~~~~~~~~~c--~w~gv~C~~~--~~~v~~L~L~~~~l~~l~~~~l~~~~~~~l   95 (167)
                      |.++|++||++||+.+.++ ..+++|..+.   |||  .|.||+|+..  ..||+.|+|+++.+.....  + ++.++++
T Consensus         3 c~~~e~~aLl~~k~~~~~~-~~l~sW~~~~---d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~--l-p~~l~~L   75 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNP-TTLSSWLPTT---DCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYP--I-PSSLANL   75 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCC-GGGTTCCTTS---CTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEE--C-CGGGGGC
T ss_pred             CCHHHHHHHHHHHHHCCCC-CcCCCCCCCC---CCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCC--C-ChHHhcC
Confidence            7899999999999999665 4689998876   999  4999999863  3489999999998864321  1 4568889


Q ss_pred             CCccEEEcCC-CceeeecCcccccccCCCCCCCEEeCcCCcCCchhhHhhhcCCCCCEEECcCCcceecCC
Q 043924           96 QQLESLYLEY-NNIAGCVENEGIERLSRLSNLKMLDLSENLFNNSILSSVAHLSSLTSLYLYSNRLEGNID  165 (167)
Q Consensus        96 ~~L~~L~Ls~-n~l~g~ip~~~~~~~~~l~~L~~L~ls~N~l~g~iP~~l~~l~~L~~L~L~~N~lsG~iP  165 (167)
                      ++|++|+|++ |.++|.+|+.    ++++++|++|++++|++++..|..+..+.+|+++++++|++.+.+|
T Consensus        76 ~~L~~L~Ls~~N~l~g~iP~~----i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p  142 (313)
T d1ogqa_          76 PYLNFLYIGGINNLVGPIPPA----IAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLP  142 (313)
T ss_dssp             TTCSEEEEEEETTEESCCCGG----GGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCC
T ss_pred             ccccccccccccccccccccc----cccccccchhhhccccccccccccccchhhhcccccccccccccCc
Confidence            9999999986 8899999987    8888888888888888877666655666666666665555555555



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure