Citrus Sinensis ID: 043964

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710---
MVNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAVLNDAEQRQVKEKSIRVWLGRLKDVSYDIENVLDEWITARRRLQMEQNAHSAQKQVSSCFPASSISFKKIILRQDIAVKIKGINKKLGVIATQKDMFKFVESGGASSTRPGRVQSTSFIDEEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKIASRCKGLPLAAKCFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQDEEVDIIGEEYFNILATHSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEHNAINSLDKKVCHLMLIIGEGASFPVSTCRVKRMRSLFIGGNMLDNSSLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELPEGIGKLINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSRGKAVDGHKGCNNVFPNWMMSLTNPRSLELILCENCNQLPPLGILPSLEKVIITYMISVKRVGNEFLGIEIIIAFPKLKSLTISWMLELKEWNYGITRTGNAFINIMPRLSSLTIDSCPKLKALPDHFHQTTTLKELIIRSNCGLLEECYRNRGGDWRKISRIPNLEIRP
cHHHcHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEccccccccccccccccccccccccccHHHHHHHHHHHccccccccccEEEEEEEEEcccccEEEEcccccHHHHHHHccccccEEcccccHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEcccccEEEHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccccEEEEEEcHHHHHHHHHHccccEEEEEEcccccccccccccccEEEEEEEccccccccccccccccEEEEcccccccccccccHHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccccEEccHHHHccccccEEccccccccccccccccccccccEEEccccccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccEEEcccccccccccccccccEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccHHHHccccccccccccccccccEEcc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccHHccccccHHccHHHHHHHHHHHHHHHHHHcHHHEEccccccEEccccccccccccccccHHHHHHHHccccccHHHHHHHHHccccHHHHccEEEEccccHHHHHHHHHHHHHccHHHHHHccccEEEEccccccHHHHHHHHHcccccHccHHHHHHccHHccccHHHHHHEEEEcccccEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEccccccccEEEEEHHHHHHHHHHHHcccccEEEEEccccccccccEEcEEEEEEEEcccccccccHHHHcccccEEEEEcccccccccccHHHcHHHHHccccEEEEEcccccccccccHHHcccccccccHcEEEEcccccccccccHHccccccccEEEEcccccHHccccHHccccccEEEEEccccccccccccccccccccEEEEEEcccccccccHccHHHHHHHHHcccccccEEEEEccccccccccccccccccEEEEEcccccccccHHHcccccccccccccEEEEcccccHHHccHHHccccHHHccccccccEEEEcccHHHHcccHHccccccccEEEEcccHHHHHHccccccccccccccccEEEEcc
MVNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAVLNDAEQRQVKEKSIRVWLGRLKDVSYDIENVLDEWITARRRLQMEQNAHSAQkqvsscfpassisfkkIILRQDIAVKIKGINKKLGVIATQKDMFKFVesggasstrpgrvqstsfideeeiygrvgekNELLSKLLCESSEQQKGLHIISIVgmggigkttlAQLDCNHEEVIRKFDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKIASrckglplaaKCFSYCAIFPKDFNIMKEKLITMWMAQgyfsveqdEEVDIIGEEYFNILATHSFFQefkkdddnlIVACKMHDIVHDFAQFvsqnecssmeingskehnainsLDKKVCHLMLIIgegasfpvstCRVKRMRSLFiggnmldnsslNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTsirklpeplcelynlekldishcwylkelpeGIGKLINMKHLLNErtdslgrmpagiarltslrtfdefhvsrgkavdghkgcnnvfpnwmmsltnprslELILCencnqlpplgilpsLEKVIITYMISVKRVGNEFLGIEIIIAFPKLKSLTISWMLELKEWNYGITRTGNAFINImprlssltidscpklkalpdhfhqTTTLKELIIRSNCGLLEEcyrnrggdwrkisripnleirp
MVNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAvlndaeqrqvkeKSIRVwlgrlkdvsydiENVLDEWITARRRLQMEQNAHSaqkqvsscfpaSSISFKKIILRQDIAVKIKGINKKLGVIATQKDMFKFVesggasstrpgrvqstsfideeeiygrVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKIASRCKGLPLAAKCFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQDEEVDIIGEEYFNILATHSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEHNAINSLDKKVCHLMLIIGegasfpvstCRVKRMRSLFIGgnmldnssLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELPEGIGKLINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSrgkavdghkgcNNVFPNWMMSLTNPRSLELILCENCNQLPPLGILPSLEKVIITYMISVKRVGNEFLGIEIIIAFPKLKSLTISWMLELKEWNYGITRTGNAFINIMPRLSSLTIDSCPKLKALPDHFHQTTTLKELIIRSNCGLLEecyrnrggdwrkisripnleirp
MVNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAVLNDAEQRQVKEKSIRVWLGRLKDVSYDIENVLDEWITARRRLQMEQNAHSAQKQVSSCFPASSISFKKIILRQDIAVKIKGINKKLGVIATQKDMFKFVESGGASSTRPGRVQSTSFIDEEEIYGRVGeknellskllcesseQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKIASRCKGLPLAAKCFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQDEEVDIIGEEYFNILATHSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEHNAINSLDKKVCHLMLIIGEGASFPVSTCRVKRMRSLFIGGNMLDNSSLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELPEGIGKLINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSRGKAVDGHKGCNNVFPNWMMSLTNPRSLELILCENCNQLPPLGILPSLEKVIITYMISVKRVGNEFLGIEIIIAFPKLKSLTISWMLELKEWNYGITRTGNAFINIMPRLSSLTIDSCPKLKALPDHFHQTTTLKELIIRSNCGLLEECYRNRGGDWRKISRIPNLEIRP
*******PLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAVLNDAEQRQVKEKSIRVWLGRLKDVSYDIENVLDEWITARRRL**************SCFPASSISFKKIILRQDIAVKIKGINKKLGVIATQKDMFKFV******************IDEEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKIASRCKGLPLAAKCFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQDEEVDIIGEEYFNILATHSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECS**********NAINSLDKKVCHLMLIIGEGASFPVSTCRVKRMRSLFIGGNMLDNSSLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELPEGIGKLINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSRGKAVDGHKGCNNVFPNWMMSLTNPRSLELILCENCNQLPPLGILPSLEKVIITYMISVKRVGNEFLGIEIIIAFPKLKSLTISWMLELKEWNYGITRTGNAFINIMPRLSSLTIDSCPKLKALPDHFHQTTTLKELIIRSNCGLLEECYRNRGGDWRKISRI*******
MVNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAVLNDAEQRQVKEKSIRVWLGRLKDVSYDIENVLDEWITAR******************CFPASSISFKKIILRQDIAVKIKGINKKLGVIATQKDMF*********************IDEEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKIASRCKGLPLAAKCFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQDEEVDIIGEEYFNILATHSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEHNAINSLDKKVCHLMLIIGEGASFPVSTCRVKRMRSLFIGGNMLDNSSLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELPEGIGKLINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSRGKAVDG**************LTNPRSLELILCENCNQLPPLGILPSLEKVIITYMISVKRVGNEFLGIEIIIAFPKLKSLTISWMLELKEWNYGITRTGNAFINIMPRLSSLTIDSCPKLKALPDHFHQTTTLKELIIRSNCGLLEEC****GGDWRKISRIPNLEIRP
MVNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAVLNDAEQRQVKEKSIRVWLGRLKDVSYDIENVLDEWITARRRLQ**************CFPASSISFKKIILRQDIAVKIKGINKKLGVIATQKDMFKFVE************QSTSFIDEEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKIASRCKGLPLAAKCFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQDEEVDIIGEEYFNILATHSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEHNAINSLDKKVCHLMLIIGEGASFPVSTCRVKRMRSLFIGGNMLDNSSLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELPEGIGKLINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSRGKAVDGHKGCNNVFPNWMMSLTNPRSLELILCENCNQLPPLGILPSLEKVIITYMISVKRVGNEFLGIEIIIAFPKLKSLTISWMLELKEWNYGITRTGNAFINIMPRLSSLTIDSCPKLKALPDHFHQTTTLKELIIRSNCGLLEECYRNRGGDWRKISRIPNLEIRP
MVNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAVLNDAEQRQVKEKSIRVWLGRLKDVSYDIENVLDEWITARRRLQMEQNAHSAQKQVSSCFPASSISFKKIILRQDIAVKIKGINKKLGVIATQKDMFKFVESGGASSTRPGRVQSTSFIDEEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKIASRCKGLPLAAKCFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQDEEVDIIGEEYFNILATHSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEHNAINSLDKKVCHLMLIIGEGASFPVSTCRVKRMRSLFIGGNMLDNSSLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELPEGIGKLINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSRGKAVDGHKGCNNVFPNWMMSLTNPRSLELILCENCNQLPPLGILPSLEKVIITYMISVKRVGNEFLGIEIIIAFPKLKSLTISWMLELKEWNYGITRTGNAFINIMPRLSSLTIDSCPKLKALPDHFHQTTTLKELIIRSNCGLLEECYRNRGGDWRKISRIPNLEIRP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQExxxxxxxxxxxxxxxxxxxxxQVKEKSIRVWLGRLKDVSYDIENVLDEWITARRRLQMEQNAHSAQKQVSSCFPASSISFKKIILRQDIAVKIKGINKKLGVIATQKDMFKFVESGGASSTRPGRVQSTSFIDEEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKIASRCKGLPLAAKCFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQDEEVDIIGEEYFNILATHSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEHNAINSLDKKVCHLMLIIGEGASFPVSTCRVKRMRSLFIGGNMLDNSSLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELPEGIGKLINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSRGKAVDGHKGCNNVFPNWMMSLTNPRSLELILCENCNQLPPLGILPSLEKVIITYMISVKRVGNEFLGIEIIIAFPKLKSLTISWMLELKEWNYGITRTGNAFINIMPRLSSLTIDSCPKLKALPDHFHQTTTLKELIIRSNCGLLEECYRNRGGDWRKISRIPNLEIRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query713 2.2.26 [Sep-21-2011]
Q7XBQ9 970 Disease resistance protei N/A no 0.346 0.254 0.337 3e-32
Q7XA39 988 Putative disease resistan N/A no 0.417 0.301 0.289 2e-30
Q9LRR5 1424 Putative disease resistan yes no 0.395 0.198 0.283 7e-29
Q7XA42 979 Putative disease resistan N/A no 0.300 0.218 0.322 1e-28
Q9LRR4 1054 Putative disease resistan no no 0.361 0.244 0.327 3e-27
Q7XA40 992 Putative disease resistan N/A no 0.384 0.276 0.294 1e-25
Q8W3K3 910 Putative disease resistan no no 0.304 0.238 0.291 4e-18
Q39214926 Disease resistance protei no no 0.426 0.328 0.272 6e-18
P0C8S1 906 Probable disease resistan no no 0.305 0.240 0.281 1e-17
Q38834 852 Disease resistance RPP13- no no 0.315 0.264 0.278 1e-17
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function desciption
 Score =  140 bits (354), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 147/293 (50%), Gaps = 46/293 (15%)

Query: 268 LPLAAK-CFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQDEEVDIIGEEYFNILATHSF 326
           LPL  K CF+YCA+FPKD  + KEKLI++WMA G+   + + E++ +G+E +  L   SF
Sbjct: 399 LPLDLKQCFAYCAVFPKDAKMEKEKLISLWMAHGFLLSKGNMELEDVGDEVWKELYLRSF 458

Query: 327 FQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEHNAINSLDKKVCHLMLI 386
           FQE +  D       KMHD++HD A  +     SS  I    +H+          H+M I
Sbjct: 459 FQEIEVKDGKTYF--KMHDLIHDLATSLFSANTSSSNIREINKHS--------YTHMMSI 508

Query: 387 IGEGASFPVSTCRVKRMRSLFIGGNMLDNSSLNGKMLKELFEKLTSLRVLNIGKWSISRW 446
                 F  +   +                           EK  SLRVLN+G  + ++ 
Sbjct: 509 GFAEVVFFYTLPPL---------------------------EKFISLRVLNLGDSTFNK- 540

Query: 447 YFILEIPRNIEKLIHLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELPEGIGK 506
                +P +I  L+HL+YLNL   + +R LP+ LC+L NL+ LD+ +C  L  LP+   K
Sbjct: 541 -----LPSSIGDLVHLRYLNLYG-SGMRSLPKQLCKLQNLQTLDLQYCTKLCCLPKETSK 594

Query: 507 LINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSRGKAVD-GHKGCNNVF 558
           L ++++LL + + SL  MP  I  LT L+T  +F V R K    G  G  N++
Sbjct: 595 LGSLRNLLLDGSQSLTCMPPRIGSLTCLKTLGQFVVGRKKGYQLGELGNLNLY 647
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth. Confers a broad resistance to all known races of P.infestans.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
224101679788 nbs-lrr resistance protein [Populus tric 0.948 0.857 0.367 1e-118
147775713 886 hypothetical protein VITISV_014504 [Viti 0.936 0.753 0.342 1e-110
224110248 888 cc-nbs-lrr resistance protein [Populus t 0.966 0.775 0.310 4e-96
224122720746 cc-nbs-lrr resistance protein [Populus t 0.705 0.674 0.349 1e-90
147825450 927 hypothetical protein VITISV_000086 [Viti 0.645 0.496 0.355 8e-77
359482794 880 PREDICTED: putative disease resistance p 0.642 0.520 0.346 1e-74
224115686 938 cc-nbs-lrr resistance protein [Populus t 0.642 0.488 0.337 2e-71
359482784 919 PREDICTED: putative disease resistance p 0.624 0.484 0.325 1e-70
147825449677 hypothetical protein VITISV_000085 [Viti 0.720 0.759 0.324 2e-70
255549784786 leucine-rich repeat containing protein, 0.598 0.543 0.352 4e-69
>gi|224101679|ref|XP_002334255.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222870330|gb|EEF07461.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 302/822 (36%), Positives = 444/822 (54%), Gaps = 146/822 (17%)

Query: 1   MVNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAVLNDAEQRQVKEK 60
           M +A+VS +LE+L S  +E+V Q+V+L  GV+ EVEKLTS  + IQAV  DAE+RQ+K++
Sbjct: 1   MADALVSVVLERLSSIVSEKVGQKVRLFVGVKNEVEKLTSSFRAIQAVFADAEERQLKDQ 60

Query: 61  SIRVWLGRLKDVSYDIENVLDEWITARRRLQMEQNAHSAQKQVSSCFPASSISFKKIILR 120
            ++ WL +LKDVSYD+++VLDEW TA  +LQ +         + SCF      F+++ LR
Sbjct: 61  FVKHWLDQLKDVSYDMDDVLDEWDTAIAKLQSKNTRKVCSFMIFSCF-----HFREVGLR 115

Query: 121 QDIAVKIKGINKKLGVIATQKDMFKF--VESGGASSTRPGRVQSTSFIDEEEIYGRVGEK 178
             +A KIK +N+++  I  +K+ F F  +E+G          ++ S ID +E+ GR  +K
Sbjct: 116 HRVAYKIKELNERIDGIVVEKNRFHFKLLEAGIKQLEHH---ETASVIDVKEVKGREKDK 172

Query: 179 NELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVCVSETF 238
             ++  LL ESS Q   L  IS+VGMGGIGKTTLA+L  N   V   F++ +WVCVS+ F
Sbjct: 173 VRVIKTLLSESS-QGPALRTISLVGMGGIGKTTLAKLVFNDHVVKTHFNRRIWVCVSDPF 231

Query: 239 EEIAFHGRSIEECEKLEQIGQKIASRCKGLPLAAKCFSYCAIFPKDFNIMKEKLITMWMA 298
           +E       +E       +  ++           +CFSYCA+FPKDF   +  LI +WMA
Sbjct: 232 DETRIAKEILEAHMSYHDLPSEVR----------RCFSYCAVFPKDFTFYRGDLIKLWMA 281

Query: 299 QGYFSVEQDEEVDIIGEEYFNILATHSFFQEFKKDD-DNLIVACKMHDIVHDFAQFVSQN 357
           QG+    Q++E++++G E F  LA  SFFQ+FKK++ D+ I ACKMHD+VHDFAQF+++N
Sbjct: 282 QGFLRETQNKEMEVMGRECFEALAARSFFQDFKKEEGDDSIYACKMHDMVHDFAQFLTKN 341

Query: 358 ECSSMEINGSKEHNAINSLDKKVCHLMLIIGE--GASFPVSTCRVKRMRSLFIGGNMLDN 415
           E  ++EI+G+ E + I+S  +   H M+++ +    SFP +   +K++RSL + G     
Sbjct: 342 ESFNVEIDGAAE-SKIDSFSRDARHSMVVLRKYKTYSFPETIHSLKKLRSLIVDGY---P 397

Query: 416 SSLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRK 475
           SS+N   L  L   L+ LR L + +  I       E+P NI KLIHL++++LS    IR+
Sbjct: 398 SSMNA-TLPNLIANLSCLRTLRLSRCGIE------EVPSNIGKLIHLRHVDLSG-NLIRE 449

Query: 476 LPEPLCELYNLEKLDISHCWYLKELP------------------------EGI------- 504
           LPE +CELYN+  LD+S C  L+ LP                        EG+       
Sbjct: 450 LPEEMCELYNMLTLDVSDCEKLERLPDNMEKLVKLRHLSVGRLFVKMRGVEGLSSLRELD 509

Query: 505 -------------GKLINMKHLLNE-RTDSLGRM--PAGIAR--------LTSLRTFDEF 540
                        G L N+ HL    +   LG +  P  + +        LT LR + E 
Sbjct: 510 EFHVSGSGEVSNFGDLRNLNHLQGSLKIRWLGDVKDPDEVKKALLKSKEHLTCLRLWFES 569

Query: 541 HVSRGKAVDG-------------------HKGCNNVFPNWMMSLTNPRSLELILCENCNQ 581
            + +G   D                    ++G + VF + +  L   R +EL        
Sbjct: 570 RIDKGTIHDDEVLEALEPPPNLEFLEIRYYRGIDPVFSSCINKL---RVVELSEWGKIEN 626

Query: 582 LPPLGILPSLEKVIITYMISVKRVGNEFLGIE-----------------------IIIAF 618
           LPPLG LPSLE++ I++M  VK++G+EFLG+E                       II AF
Sbjct: 627 LPPLGKLPSLEELTISWMECVKKMGDEFLGLEVDREDDEDSEISIGEMTSPSPSNIITAF 686

Query: 619 PKLKSLTISWMLELKEWNYGIT---------RTGNAFINIMPRLSSLTIDSCPKLKALPD 669
           PKLK LTIS M + +EW  G           +T  +   IMP L SL I  CPKLKALPD
Sbjct: 687 PKLKGLTISDMRKWEEWEGGEGGRWRRGNEDKTNISISIIMPSLRSLLILKCPKLKALPD 746

Query: 670 HFHQTTTLKELIIRSNCGLLEECYRNRGGDWRKISRIPNLEI 711
           +  Q+TT+++L+I+S+  +LEE ++  G  W   S IP++ I
Sbjct: 747 YVLQSTTIEKLLIKSS-SILEEQFKAGGEGWPNDSHIPSITI 787

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147775713|emb|CAN69300.1| hypothetical protein VITISV_014504 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110248|ref|XP_002333128.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834939|gb|EEE73388.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122720|ref|XP_002318909.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859582|gb|EEE97129.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482794|ref|XP_002268547.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115686|ref|XP_002332117.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874937|gb|EEF12068.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147825449|emb|CAN71071.1| hypothetical protein VITISV_000085 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255549784|ref|XP_002515943.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544848|gb|EEF46363.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.367 0.248 0.343 1.9e-53
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.364 0.182 0.322 2.7e-44
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.403 0.159 0.287 2.2e-31
TAIR|locus:2037623 899 AT1G58410 [Arabidopsis thalian 0.302 0.240 0.272 1.6e-30
TAIR|locus:2169523 901 AT5G35450 [Arabidopsis thalian 0.319 0.253 0.247 8e-30
TAIR|locus:2078012 852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.314 0.262 0.272 4.3e-29
TAIR|locus:504956184 1017 AT1G58807 "AT1G58807" [Arabido 0.321 0.225 0.238 1.1e-27
TAIR|locus:2827038 1017 AT1G59124 "AT1G59124" [Arabido 0.321 0.225 0.238 1.1e-27
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.325 0.221 0.233 8.9e-27
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.325 0.221 0.233 8.9e-27
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 326 (119.8 bits), Expect = 1.9e-53, Sum P(4) = 1.9e-53
 Identities = 100/291 (34%), Positives = 156/291 (53%)

Query:   268 LPLAAK-CFSYCAIFPKDFNIMKEKLITMWMAQGYFS-VEQDEEVDIIGEEYFNILATHS 325
             LP   K CF+YC+IFPK     K+K++ +WMA+G+       + ++ +G EYF+ L + S
Sbjct:   422 LPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRS 481

Query:   326 FFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECSSMEINGSKEHNAINSLDKKVCHLML 385
               Q+ K      I    MHD +++ AQF S  E SS   +G K    ++   + + +L  
Sbjct:   482 LLQKTKT---RYI----MHDFINELAQFAS-GEFSSKFEDGCKLQ--VSERTRYLSYLRD 531

Query:   386 IIGEGASFPVSTCRVKRMRSLFIGGNMLDNSS---LNGKMLKELFEKLTSLRVLNIGKWS 442
                E   F      VK +R+ F+  ++ ++S    L+  + ++L   LT LRVL++  + 
Sbjct:   532 NYAEPMEFEALR-EVKFLRT-FLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYK 589

Query:   443 ISRWYFILEIPRNIEKLI-HLKYLNLSCLTSIRKLPEPLCELYNLEKLDISHCWYLKELP 501
             I+R      +P +  K I H ++L+LS  T + KLP+ LC +YNL+ L +S+C  LKELP
Sbjct:   590 IAR------LPPDFFKNISHARFLDLS-RTELEKLPKSLCYMYNLQTLLLSYCSSLKELP 642

Query:   502 EGIGKLINMKHLLNERTDSLGRMPAGIARLTSLRTFDEFHVSRGKAVDGHK 552
               I  LIN+++L    T  L +MP    RL SL+T   F VS   A DG +
Sbjct:   643 TDISNLINLRYLDLIGT-KLRQMPRRFGRLKSLQTLTTFFVS---ASDGSR 689
GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 4e-11
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 9e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-04
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 64.3 bits (157), Expect = 4e-11
 Identities = 28/67 (41%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 174 RVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRKFDKILWVC 233
           R      L+ KL     E    L ++ IVGMGG+GKTTLA+   N + V   FD + WV 
Sbjct: 1   REDMIEALIEKL----LEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVV 56

Query: 234 VSETFEE 240
           VS+T+ E
Sbjct: 57  VSKTYTE 63

Length = 285
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 713
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.85
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.83
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.82
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.69
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.66
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.64
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.53
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.52
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.5
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.5
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.44
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.4
KOG0617264 consensus Ras suppressor protein (contains leucine 99.39
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.33
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.29
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.21
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.04
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.03
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.83
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.81
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.77
KOG4341483 consensus F-box protein containing LRR [General fu 98.76
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.73
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.67
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.66
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.63
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.62
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.6
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.56
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.56
PLN03150623 hypothetical protein; Provisional 98.36
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.31
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.25
PLN03150623 hypothetical protein; Provisional 98.23
KOG4341483 consensus F-box protein containing LRR [General fu 98.21
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.09
PRK15386 426 type III secretion protein GogB; Provisional 98.09
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.01
PRK15386 426 type III secretion protein GogB; Provisional 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.81
PRK09376416 rho transcription termination factor Rho; Provisio 97.81
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.72
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.68
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.67
cd01128249 rho_factor Transcription termination factor rho is 97.61
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.52
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.49
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.46
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.31
PRK11331459 5-methylcytosine-specific restriction enzyme subun 97.18
PRK08118167 topology modulation protein; Reviewed 97.15
PTZ00202550 tuzin; Provisional 97.14
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.06
TIGR02928365 orc1/cdc6 family replication initiation protein. M 97.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.0
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.98
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.98
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.94
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.92
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 96.9
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.85
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.82
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 96.8
TIGR00767415 rho transcription termination factor Rho. Members 96.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.7
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.54
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.54
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 96.52
PRK06696223 uridine kinase; Validated 96.51
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 96.49
PTZ00301210 uridine kinase; Provisional 96.46
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.43
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.4
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.36
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 96.35
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 96.24
PRK07261171 topology modulation protein; Provisional 96.22
PRK07667193 uridine kinase; Provisional 96.21
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.06
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 96.05
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 96.03
PRK15455644 PrkA family serine protein kinase; Provisional 95.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.91
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.86
PRK05480209 uridine/cytidine kinase; Provisional 95.86
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.82
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.79
TIGR00235207 udk uridine kinase. Model contains a number of lon 95.77
TIGR00763775 lon ATP-dependent protease La. This protein is ind 95.73
PRK05541176 adenylylsulfate kinase; Provisional 95.71
KOG2028554 consensus ATPase related to the helicase subunit o 95.69
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.68
PRK08233182 hypothetical protein; Provisional 95.65
PRK13342413 recombination factor protein RarA; Reviewed 95.64
PRK06547172 hypothetical protein; Provisional 95.63
PF05729166 NACHT: NACHT domain 95.61
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.59
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.56
PRK04195482 replication factor C large subunit; Provisional 95.53
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.52
PHA02544316 44 clamp loader, small subunit; Provisional 95.49
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.43
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 95.36
PF13173128 AAA_14: AAA domain 95.35
PRK06762166 hypothetical protein; Provisional 95.32
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 95.28
COG2255332 RuvB Holliday junction resolvasome, helicase subun 95.24
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.23
PRK09270229 nucleoside triphosphate hydrolase domain-containin 95.22
PHA00729226 NTP-binding motif containing protein 95.22
PRK12402337 replication factor C small subunit 2; Reviewed 95.2
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 95.14
CHL00095 821 clpC Clp protease ATP binding subunit 95.13
PRK04040188 adenylate kinase; Provisional 95.13
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.12
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.1
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 95.1
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 95.1
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 95.0
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.99
PRK03839180 putative kinase; Provisional 94.97
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 94.96
PRK13341 725 recombination factor protein RarA/unknown domain f 94.96
PRK03992389 proteasome-activating nucleotidase; Provisional 94.94
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.93
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.92
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 94.89
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 94.87
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.85
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.84
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.79
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 94.79
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 94.77
PRK06893229 DNA replication initiation factor; Validated 94.76
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 94.71
PLN03025319 replication factor C subunit; Provisional 94.67
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 94.63
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 94.62
PRK00440319 rfc replication factor C small subunit; Reviewed 94.61
PRK00625173 shikimate kinase; Provisional 94.59
PF00004132 AAA: ATPase family associated with various cellula 94.54
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 94.48
smart00382148 AAA ATPases associated with a variety of cellular 94.46
PRK10865 857 protein disaggregation chaperone; Provisional 94.45
PRK00889175 adenylylsulfate kinase; Provisional 94.43
PRK10536262 hypothetical protein; Provisional 94.43
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 94.4
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.39
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.38
PRK08084235 DNA replication initiation factor; Provisional 94.36
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.35
PRK05439311 pantothenate kinase; Provisional 94.35
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 94.35
PRK00131175 aroK shikimate kinase; Reviewed 94.28
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.28
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 94.27
PRK06217183 hypothetical protein; Validated 94.27
PTZ001121164 origin recognition complex 1 protein; Provisional 94.25
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 94.17
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 94.15
PRK03846198 adenylylsulfate kinase; Provisional 94.13
COG1936180 Predicted nucleotide kinase (related to CMP and AM 94.11
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.11
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.08
CHL00181287 cbbX CbbX; Provisional 94.07
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 94.03
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 93.98
PF07726131 AAA_3: ATPase family associated with various cellu 93.96
PRK00300205 gmk guanylate kinase; Provisional 93.96
PRK13949169 shikimate kinase; Provisional 93.96
PLN02318656 phosphoribulokinase/uridine kinase 93.89
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 93.87
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 93.85
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 93.84
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.83
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 93.8
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 93.8
PRK08727233 hypothetical protein; Validated 93.77
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 93.77
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 93.77
PRK13947171 shikimate kinase; Provisional 93.76
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.75
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 93.73
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.7
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 93.68
PRK08903227 DnaA regulatory inactivator Hda; Validated 93.66
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 93.62
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 93.61
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.6
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 93.59
PRK13975196 thymidylate kinase; Provisional 93.58
PRK13531498 regulatory ATPase RavA; Provisional 93.57
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 93.57
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 93.56
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 93.56
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 93.55
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 93.55
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 93.53
PRK05642234 DNA replication initiation factor; Validated 93.52
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 93.51
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.51
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 93.5
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.48
PRK14530215 adenylate kinase; Provisional 93.48
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.46
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 93.41
PRK13695174 putative NTPase; Provisional 93.41
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 93.35
PRK13236296 nitrogenase reductase; Reviewed 93.34
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 93.3
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 93.27
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 93.27
PRK14738206 gmk guanylate kinase; Provisional 93.26
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 93.25
PRK12377248 putative replication protein; Provisional 93.24
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 93.2
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 93.19
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 93.18
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 93.18
PRK12339197 2-phosphoglycerate kinase; Provisional 93.16
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 93.13
PRK05057172 aroK shikimate kinase I; Reviewed 93.12
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 93.12
TIGR01287275 nifH nitrogenase iron protein. This model describe 93.1
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.08
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 93.05
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.05
PLN02348395 phosphoribulokinase 93.03
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 93.02
KOG4252246 consensus GTP-binding protein [Signal transduction 92.99
cd03116159 MobB Molybdenum is an essential trace element in t 92.98
PRK08356195 hypothetical protein; Provisional 92.97
TIGR00064272 ftsY signal recognition particle-docking protein F 92.95
PLN02796347 D-glycerate 3-kinase 92.94
PRK06620214 hypothetical protein; Validated 92.92
PRK09825176 idnK D-gluconate kinase; Provisional 92.91
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 92.91
COG1100219 GTPase SAR1 and related small G proteins [General 92.9
PRK13946184 shikimate kinase; Provisional 92.89
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 92.85
COG1126240 GlnQ ABC-type polar amino acid transport system, A 92.85
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 92.83
PRK04182180 cytidylate kinase; Provisional 92.81
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 92.79
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 92.77
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 92.76
COG3899 849 Predicted ATPase [General function prediction only 92.76
PRK05564313 DNA polymerase III subunit delta'; Validated 92.73
cd02117212 NifH_like This family contains the NifH (iron prot 92.73
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 92.72
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 92.7
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 92.7
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 92.69
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 92.69
PRK13948182 shikimate kinase; Provisional 92.67
PRK14974336 cell division protein FtsY; Provisional 92.67
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.66
PLN03071219 GTP-binding nuclear protein Ran; Provisional 92.66
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 92.64
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.64
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 92.63
PRK13232273 nifH nitrogenase reductase; Reviewed 92.62
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 92.62
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 92.61
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 92.59
cd03114148 ArgK-like The function of this protein family is u 92.58
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 92.57
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 92.55
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 92.5
PRK09087226 hypothetical protein; Validated 92.5
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 92.5
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 92.49
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 92.47
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.45
PF00142273 Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot 92.45
PRK13768253 GTPase; Provisional 92.45
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 92.44
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 92.44
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 92.43
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 92.41
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 92.41
PRK13230279 nitrogenase reductase-like protein; Reviewed 92.41
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 92.41
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 92.4
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 92.35
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 92.35
PRK06761282 hypothetical protein; Provisional 92.32
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 92.31
PRK14527191 adenylate kinase; Provisional 92.3
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 92.3
PRK01184184 hypothetical protein; Provisional 92.29
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 92.29
PRK03731171 aroL shikimate kinase II; Reviewed 92.28
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 92.28
KOG2543438 consensus Origin recognition complex, subunit 5 [R 92.28
PRK10416318 signal recognition particle-docking protein FtsY; 92.28
PLN02200234 adenylate kinase family protein 92.27
PRK09435332 membrane ATPase/protein kinase; Provisional 92.26
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 92.26
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 92.25
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 92.23
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.2
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 92.2
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 92.19
PRK08116268 hypothetical protein; Validated 92.19
PRK14737186 gmk guanylate kinase; Provisional 92.15
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 92.15
PRK09183259 transposase/IS protein; Provisional 92.14
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 92.13
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 92.12
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 92.12
cd02040270 NifH NifH gene encodes component II (iron protein) 92.1
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 92.1
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 92.05
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 92.04
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 92.0
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 91.99
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 91.98
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 91.98
PLN03046460 D-glycerate 3-kinase; Provisional 91.97
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 91.97
PRK08099399 bifunctional DNA-binding transcriptional repressor 91.97
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 91.95
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 91.95
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 91.92
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 91.9
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 91.88
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 91.85
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 91.84
PRK13233275 nifH nitrogenase reductase; Reviewed 91.84
PRK15453290 phosphoribulokinase; Provisional 91.84
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 91.81
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 91.8
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 91.79
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.78
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 91.76
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 91.74
cd03269210 ABC_putative_ATPase This subfamily is involved in 91.73
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 91.73
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 91.71
COG1136226 SalX ABC-type antimicrobial peptide transport syst 91.68
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 91.67
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 91.64
COG3638258 ABC-type phosphate/phosphonate transport system, A 91.63
PRK07952244 DNA replication protein DnaC; Validated 91.6
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 91.58
cd02034116 CooC The accessory protein CooC, which contains a 91.57
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 91.57
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 91.55
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 91.55
cd03115173 SRP The signal recognition particle (SRP) mediates 91.54
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 91.53
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 91.53
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 91.52
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 91.51
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 91.51
PRK13235274 nifH nitrogenase reductase; Reviewed 91.5
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 91.5
COG0003322 ArsA Predicted ATPase involved in chromosome parti 91.48
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 91.48
PRK09112351 DNA polymerase III subunit delta'; Validated 91.47
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 91.45
PRK09361225 radB DNA repair and recombination protein RadB; Pr 91.45
cd01394218 radB RadB. The archaeal protein radB shares simila 91.44
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 91.43
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 91.43
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 91.41
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 91.4
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 91.4
PRK13231264 nitrogenase reductase-like protein; Reviewed 91.39
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 91.36
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 91.36
PTZ00088229 adenylate kinase 1; Provisional 91.35
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 91.35
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 91.35
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 91.35
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 91.34
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 91.34
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 91.33
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 91.32
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 91.31
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 91.3
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 91.29
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 91.29
PRK06526254 transposase; Provisional 91.28
PRK07429327 phosphoribulokinase; Provisional 91.27
PRK00698205 tmk thymidylate kinase; Validated 91.26
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 91.24
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 91.23
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 91.22
cd01878204 HflX HflX subfamily. A distinct conserved domain w 91.21
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 91.2
cd00876160 Ras Ras family. The Ras family of the Ras superfam 91.19
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 91.18
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 91.16
PRK10865857 protein disaggregation chaperone; Provisional 91.12
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 91.12
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 91.11
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 91.11
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 91.11
TIGR00231161 small_GTP small GTP-binding protein domain. This m 91.11
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 91.09
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 91.08
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 91.06
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 91.05
cd00154159 Rab Rab family. Rab GTPases form the largest famil 91.05
TIGR00101199 ureG urease accessory protein UreG. This model rep 91.01
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 91.0
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 91.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 90.98
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 90.98
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 90.97
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 90.97
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 90.96
PRK07940394 DNA polymerase III subunit delta'; Validated 90.95
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 90.93
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 90.92
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 90.91
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 90.9
PRK08181269 transposase; Validated 90.9
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 90.89
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 90.88
PRK06921266 hypothetical protein; Provisional 90.87
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 90.87
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 90.87
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 90.84
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 90.83
COG1123539 ATPase components of various ABC-type transport sy 90.82
PRK14532188 adenylate kinase; Provisional 90.82
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.81
cd03246173 ABCC_Protease_Secretion This family represents the 90.79
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 90.78
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 90.78
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 90.76
PLN02165334 adenylate isopentenyltransferase 90.76
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 90.75
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 90.75
PRK08939306 primosomal protein DnaI; Reviewed 90.74
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 90.73
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 90.7
PRK10908222 cell division protein FtsE; Provisional 90.67
PRK08154309 anaerobic benzoate catabolism transcriptional regu 90.65
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 90.64
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 90.63
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 90.62
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 90.61
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 90.61
PRK14730195 coaE dephospho-CoA kinase; Provisional 90.6
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 90.6
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 90.59
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 90.57
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 90.56
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 90.56
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 90.54
PRK06835329 DNA replication protein DnaC; Validated 90.54
PRK02496184 adk adenylate kinase; Provisional 90.53
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 90.52
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 90.51
PRK14531183 adenylate kinase; Provisional 90.5
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 90.5
cd03216163 ABC_Carb_Monos_I This family represents the domain 90.48
PRK13407334 bchI magnesium chelatase subunit I; Provisional 90.48
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 90.48
cd04171164 SelB SelB subfamily. SelB is an elongation factor 90.47
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 90.46
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 90.46
KOG3308225 consensus Uncharacterized protein of the uridine k 90.45
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 90.45
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 90.45
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 90.45
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 90.44
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 90.4
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 90.4
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 90.38
TIGR00362405 DnaA chromosomal replication initiator protein Dna 90.38
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 90.38
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 90.37
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 90.37
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 90.37
PRK07471365 DNA polymerase III subunit delta'; Validated 90.36
cd03215182 ABC_Carb_Monos_II This family represents domain II 90.36
cd02032267 Bchl_like This family of proteins contains bchL an 90.35
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 90.35
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 90.33
PRK14242253 phosphate transporter ATP-binding protein; Provisi 90.33
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 90.33
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 90.33
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 90.3
COG4559259 ABC-type hemin transport system, ATPase component 90.29
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 90.28
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-68  Score=603.67  Aligned_cols=647  Identities=23%  Similarity=0.343  Sum_probs=444.6

Q ss_pred             hhhhHHHHHHHHhccchHHHHHHHHHhhccHHHHHHHHHHHHHHHHHHHHHhhccccchHHHHHHHHHHHHHHhhHhHHH
Q 043964            2 VNAVVSPLLEQLISFSTEEVTQQVKLVKGVEQEVEKLTSHLQTIQAVLNDAEQRQVKEKSIRVWLGRLKDVSYDIENVLD   81 (713)
Q Consensus         2 a~~~v~~~~~kl~~~~~~~~~~~~~~~~~~~~~~~~L~~~l~~i~~~l~~a~~~~~~~~~~~~Wl~~l~~~~~d~ed~ld   81 (713)
                      |++.++..++|+.+    .+.++...+.+.++.+..|+++|..++.+++||+.++.....+..|.+.+++++|++||.++
T Consensus         1 ~~~~~s~~~~~~~~----~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~   76 (889)
T KOG4658|consen    1 MGACVSFGVEKLDQ----LLNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIW   76 (889)
T ss_pred             CCeEEEEehhhHHH----HHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34566667788888    88899999999999999999999999999999999988889999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhcccccccccccccCccccchhhHhHHHHHHHHHHHHHHHHHHHhcccccceeecCCCCCCCCCCCc
Q 043964           82 EWITARRRLQMEQNAHSAQKQVSSCFPASSISFKKIILRQDIAVKIKGINKKLGVIATQKDMFKFVESGGASSTRPGRVQ  161 (713)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~i~~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~  161 (713)
                      .|..+....+..+.-.+. ....+......+|...+...+.+++++-++...++.+..+. .  +.... ........++
T Consensus        77 ~~~v~~~~~~~~~~l~~~-~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~-~--~~~~~-~~~~~~~~~e  151 (889)
T KOG4658|consen   77 LFLVEEIERKANDLLSTR-SVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKG-V--FEVVG-ESLDPREKVE  151 (889)
T ss_pred             HHHHHHHHHHHhHHhhhh-HHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhcccc-c--eeccc-ccccchhhcc
Confidence            999887665433221000 00111111001122233333444455444444444443221 0  11111 0111222344


Q ss_pred             ccccCCCCcEEeccchHHHHHHHHhCCCCccCCCeEEEEEEecCCchhHHHHHHHhchHH-HHhhCCceeEEEecccccc
Q 043964          162 STSFIDEEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEE-VIRKFDKILWVCVSETFEE  240 (713)
Q Consensus       162 ~~~~~~~~~~vG~~~~~~~l~~~L~~~~~~~~~~~~vi~I~G~gGiGKTTLa~~v~~~~~-~~~~F~~~~wv~vs~~~~~  240 (713)
                      +.+...+.. ||.+..++++++.|+.+      +..++||+||||+||||||+.|+|+.. ++.+||.++||+||++|+.
T Consensus       152 ~~~~~~~~~-VG~e~~~~kl~~~L~~d------~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~  224 (889)
T KOG4658|consen  152 TRPIQSESD-VGLETMLEKLWNRLMED------DVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTT  224 (889)
T ss_pred             cCCCCcccc-ccHHHHHHHHHHHhccC------CCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccH
Confidence            444444445 99999999999999954      348999999999999999999999977 9999999999999999987


Q ss_pred             --------------------------------------------------------------------------------
Q 043964          241 --------------------------------------------------------------------------------  240 (713)
Q Consensus       241 --------------------------------------------------------------------------------  240 (713)
                                                                                                      
T Consensus       225 ~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~  304 (889)
T KOG4658|consen  225 RKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGR  304 (889)
T ss_pred             HhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhc
Confidence                                                                                            


Q ss_pred             ------------------------ccccCCCchhchHHHHHHHHHHHhcCCCCchhH-----------------------
Q 043964          241 ------------------------IAFHGRSIEECEKLEQIGQKIASRCKGLPLAAK-----------------------  273 (713)
Q Consensus       241 ------------------------~~f~~~~~~~~~~l~~i~~~i~~~c~GlPlai~-----------------------  273 (713)
                                              ++|.... ..++.++++|++|+++|+|||||++                       
T Consensus       305 ~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~-~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~  383 (889)
T KOG4658|consen  305 AMGVDYPIEVECLTPEEAWDLFQKKVGPNTL-GSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLK  383 (889)
T ss_pred             cccCCccccccccCccccHHHHHHhhccccc-cccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcccc
Confidence                                    3333322 3445599999999999999999998                       


Q ss_pred             -------------------------------HHhhhccCCCCCccChHHHHHHHHHcCccccCC-CccHHHHHHHHHHHH
Q 043964          274 -------------------------------CFSYCAIFPKDFNIMKEKLITMWMAQGYFSVEQ-DEEVDIIGEEYFNIL  321 (713)
Q Consensus       274 -------------------------------cfl~~~~fp~~~~i~~~~Li~~Wiaeg~i~~~~-~~~~e~~~~~~~~eL  321 (713)
                                                     ||+|||+|||||+|++++|+.+||||||+.... +..+++.|++|+.+|
T Consensus       384 s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~L  463 (889)
T KOG4658|consen  384 SSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEEL  463 (889)
T ss_pred             ccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHH
Confidence                                           999999999999999999999999999998844 578999999999999


Q ss_pred             HhCcCCcccccCCCCceeEEEeChHHHHHHHHhhc-----cccceeecC-CcccccccccCCCceEEEEEEecCCCCCCc
Q 043964          322 ATHSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQ-----NECSSMEIN-GSKEHNAINSLDKKVCHLMLIIGEGASFPV  395 (713)
Q Consensus       322 ~~~~ll~~~~~~~~~~~~~~~mhdlv~dla~~i~~-----~e~~~~~~~-~~~~~~~~~~~~~~~r~lsl~~~~~~~~~~  395 (713)
                      +.+++++.....  ++..+|+|||+||++|.++++     .++.+.... +....+. ...+..+|++++.++.....+ 
T Consensus       464 V~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~-~~~~~~~rr~s~~~~~~~~~~-  539 (889)
T KOG4658|consen  464 VRASLLIEERDE--GRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQ-VKSWNSVRRMSLMNNKIEHIA-  539 (889)
T ss_pred             HHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhccccccccceEEECCcCcccccc-ccchhheeEEEEeccchhhcc-
Confidence            999999987654  666789999999999999999     555444432 2222211 223578999999998876533 


Q ss_pred             cccCCCceeEEEecCCcCCCcchhhhHHHHHHccCCceeEEEeCCCCcccchhhcccCcchhccCcCCccccCCcccccc
Q 043964          396 STCRVKRMRSLFIGGNMLDNSSLNGKMLKELFEKLTSLRVLNIGKWSISRWYFILEIPRNIEKLIHLKYLNLSCLTSIRK  475 (713)
Q Consensus       396 ~~~~~~~Lr~L~l~~~~~~~~~~~~~~~~~~~~~~~~Lr~L~L~~~~~~~~~~~~~lp~~i~~L~~Lr~L~L~~~~~i~~  475 (713)
                      ...++++|++|.+.++..    ....+...+|..++.||||||++|.-     ..++|++|+.|.|||||+|+++. +..
T Consensus       540 ~~~~~~~L~tLll~~n~~----~l~~is~~ff~~m~~LrVLDLs~~~~-----l~~LP~~I~~Li~LryL~L~~t~-I~~  609 (889)
T KOG4658|consen  540 GSSENPKLRTLLLQRNSD----WLLEISGEFFRSLPLLRVLDLSGNSS-----LSKLPSSIGELVHLRYLDLSDTG-ISH  609 (889)
T ss_pred             CCCCCCccceEEEeecch----hhhhcCHHHHhhCcceEEEECCCCCc-----cCcCChHHhhhhhhhcccccCCC-ccc
Confidence            334567899999998841    13445677799999999999998763     78999999999999999999999 999


Q ss_pred             cCccccCCCCCcEEeccCccCccccchhhccCCccceeeccCcccCCccc---ccCcCCCCCCcCCceecCCC--CcccC
Q 043964          476 LPEPLCELYNLEKLDISHCWYLKELPEGIGKLINMKHLLNERTDSLGRMP---AGIARLTSLRTFDEFHVSRG--KAVDG  550 (713)
Q Consensus       476 lp~~i~~L~~L~~L~l~~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~~p---~~i~~l~~L~~L~~~~~~~~--~ei~~  550 (713)
                      +|.++++|+.|++|++..+..+..+|..+..|++||+|.+.... ...-.   ..+.+|++|+.|.....+..  ..+.+
T Consensus       610 LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~-~~~~~~~l~el~~Le~L~~ls~~~~s~~~~e~l~~  688 (889)
T KOG4658|consen  610 LPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSA-LSNDKLLLKELENLEHLENLSITISSVLLLEDLLG  688 (889)
T ss_pred             cchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccc-cccchhhHHhhhcccchhhheeecchhHhHhhhhh
Confidence            99999999999999999998777777777779999999988753 11112   22344444554444332220  00000


Q ss_pred             -------------CCCCCccCCccccCCCCCcEEEeccCCCCCCC----CC--CC-CCCCcceeeeccCccceEeCcccc
Q 043964          551 -------------HKGCNNVFPNWMMSLTNPRSLELILCENCNQL----PP--LG-ILPSLEKVIITYMISVKRVGNEFL  610 (713)
Q Consensus       551 -------------~~~~~~~~p~~~~~l~~L~~L~L~~~~~~~~l----~~--l~-~l~~L~~L~L~~~~~l~~~~~~~~  610 (713)
                                   .+......+..+..+.+|+.|.+.+|...+..    ..  .. .+|+|..+.+.+|..++.....  
T Consensus       689 ~~~L~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~--  766 (889)
T KOG4658|consen  689 MTRLRSLLQSLSIEGCSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWL--  766 (889)
T ss_pred             hHHHHHHhHhhhhcccccceeecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHHHHhhccccccccchh--
Confidence                         00111223344445666666666666543211    11  11 1344555555555444332211  


Q ss_pred             CCcccccCcccceeecccccccccccccccccc--ccccccccccccc-cccccccCC---CCCCCCCCCCCccEEEEEc
Q 043964          611 GIEIIIAFPKLKSLTISWMLELKEWNYGITRTG--NAFINIMPRLSSL-TIDSCPKLK---ALPDHFHQTTTLKELIIRS  684 (713)
Q Consensus       611 ~~~~~~~f~~L~~L~l~~~~~l~~~~~~~~~~~--~~~~~~~p~L~~L-~l~~c~~L~---~lp~~l~~l~~L~~L~i~~  684 (713)
                           ...|+|+.|.+..|..+++.........  ......|++++.+ .+.+.+.+.   ..|..   .+.|+.+.+. 
T Consensus       767 -----~f~~~L~~l~l~~~~~~e~~i~~~k~~~~l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~---~~~l~~~~ve-  837 (889)
T KOG4658|consen  767 -----LFAPHLTSLSLVSCRLLEDIIPKLKALLELKELILPFNKLEGLRMLCSLGGLPQLYWLPLS---FLKLEELIVE-  837 (889)
T ss_pred             -----hccCcccEEEEecccccccCCCHHHHhhhcccEEecccccccceeeecCCCCceeEecccC---ccchhheehh-
Confidence                 1357888888887776665443222100  0012244455555 244333333   22322   2347777777 


Q ss_pred             CCchhhH
Q 043964          685 NCGLLEE  691 (713)
Q Consensus       685 ~C~~l~~  691 (713)
                      .||++..
T Consensus       838 ~~p~l~~  844 (889)
T KOG4658|consen  838 ECPKLGK  844 (889)
T ss_pred             cCccccc
Confidence            7777653

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-26
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-19
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 5e-24
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-12
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 1e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-04
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  112 bits (280), Expect = 5e-26
 Identities = 29/216 (13%), Positives = 65/216 (30%), Gaps = 8/216 (3%)

Query: 48  VLNDAEQRQVKEKSIRVWLGRLKDVSYDIENVLDEWITARRRLQMEQNAHSAQKQVSSCF 107
            L+ A  R + +   R  L  L+  +   E+  +       RL+   N     ++ +S  
Sbjct: 9   ALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTRLERIANFLRIYRRQASEL 68

Query: 108 PASSISFKKIILRQDIAVKIKGINKKLGVIATQKDMFKFVESGGASSTRPGRVQSTSFID 167
                 F               I+  +            +    +      ++   +   
Sbjct: 69  GPLIDFFNYNNQSHLADFLEDYIDFAINEP--DLLRPVVIAPQFSRQMLDRKLLLGNVPK 126

Query: 168 EEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRK-- 225
           +   Y R    + ++ KL             + + G  G GK+ +A    +  + +    
Sbjct: 127 QMTCYIREYHVDRVIKKLD---EMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGIN 183

Query: 226 FDKILWVCVSETFEEIAFHGRSIEECEKLEQIGQKI 261
           +D I+W+  S T  +  F     +    L+     +
Sbjct: 184 YDSIVWLKDSGTAPKSTFD-LFTDILLMLKSEDDLL 218
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.86
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.83
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.83
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.83
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.83
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.82
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.82
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.81
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.81
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.81
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.8
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.8
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.8
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.79
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.79
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.79
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.79
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.79
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.78
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.78
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.78
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.78
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.78
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.77
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.77
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.77
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.76
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.75
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.75
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.72
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.72
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.72
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.7
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.7
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.66
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.66
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.65
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.65
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.65
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.64
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.64
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.64
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.62
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.62
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.62
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.61
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.61
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.56
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.53
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.53
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.53
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.52
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.52
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.51
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.51
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.5
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.5
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.49
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.48
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.48
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.47
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.46
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.45
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.43
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.43
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.42
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.42
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.41
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.4
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.39
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.37
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.36
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.34
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.34
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.34
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.33
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.33
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.33
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.32
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.31
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.3
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.25
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.24
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.21
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.2
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.16
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.02
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.96
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.95
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.91
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.89
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.85
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.7
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.47
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.34
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.15
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.91
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.82
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.74
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.7
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.67
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.46
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.39
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.25
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.15
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.15
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.1
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.03
2fna_A357 Conserved hypothetical protein; structural genomic 97.03
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.99
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.96
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.84
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.84
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.55
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.25
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.18
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.18
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.07
3co5_A143 Putative two-component system transcriptional RES 96.01
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.0
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.92
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.9
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.89
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.85
3bos_A242 Putative DNA replication factor; P-loop containing 95.8
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 95.75
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.66
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 95.61
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.56
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.47
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 95.41
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 95.38
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.36
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.35
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.33
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.29
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.29
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.28
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.23
2chq_A319 Replication factor C small subunit; DNA-binding pr 95.19
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 95.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.16
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.03
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.0
3pvs_A447 Replication-associated recombination protein A; ma 94.91
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.91
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 94.91
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.9
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.87
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.83
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.8
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.79
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.77
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.76
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 94.76
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.74
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.73
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 94.73
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.71
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.68
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.66
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.64
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 94.64
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 94.64
3fwy_A314 Light-independent protochlorophyllide reductase I 94.63
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.62
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 94.62
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 94.6
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 94.6
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 94.54
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.53
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.5
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.45
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.43
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.43
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 94.42
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.4
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.4
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.4
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.39
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 94.37
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 94.32
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.31
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.31
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.28
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.27
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 94.26
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.24
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 94.23
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.23
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 94.22
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 94.22
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.2
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.18
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.15
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.08
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 94.07
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.06
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.06
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.05
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 94.03
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 93.98
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.98
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 93.93
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.9
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 93.89
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.88
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 93.87
1ojl_A304 Transcriptional regulatory protein ZRAR; response 93.87
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.86
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 93.85
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.84
1via_A175 Shikimate kinase; structural genomics, transferase 93.83
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 93.82
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.8
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.79
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.78
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 93.74
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 93.73
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.69
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.67
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 93.66
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.65
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 93.64
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 93.6
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.58
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 93.58
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 93.57
2hf9_A226 Probable hydrogenase nickel incorporation protein 93.57
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 93.55
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.54
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 93.52
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.52
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.52
2r44_A331 Uncharacterized protein; putative ATPase, structur 93.47
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.47
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 93.47
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.45
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.44
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 93.4
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.39
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.39
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.38
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.38
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.37
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 93.35
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 93.31
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 93.26
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.19
2vli_A183 Antibiotic resistance protein; transferase, tunica 93.19
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 93.18
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.15
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.15
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.14
2og2_A359 Putative signal recognition particle receptor; nuc 93.11
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.09
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.04
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 93.04
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.03
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.01
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.97
2qgz_A308 Helicase loader, putative primosome component; str 92.97
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.96
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.95
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 92.91
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 92.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.89
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 92.88
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 92.87
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.84
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.83
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 92.81
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 92.78
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 92.74
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 92.74
4a74_A231 DNA repair and recombination protein RADA; hydrola 92.72
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 92.72
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 92.71
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 92.7
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 92.69
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 92.66
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 92.65
1b0u_A262 Histidine permease; ABC transporter, transport pro 92.65
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 92.64
3tlx_A243 Adenylate kinase 2; structural genomics, structura 92.64
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 92.63
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 92.63
1ji0_A240 ABC transporter; ATP binding protein, structural g 92.59
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.59
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 92.53
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.53
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 92.53
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 92.52
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 92.51
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 92.5
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 92.49
1g6h_A257 High-affinity branched-chain amino acid transport 92.49
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 92.49
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 92.49
2xxa_A433 Signal recognition particle protein; protein trans 92.49
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 92.42
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 92.41
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 92.41
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.4
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 92.36
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 92.34
1vma_A306 Cell division protein FTSY; TM0570, structural gen 92.32
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 92.31
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 92.3
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 92.28
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.24
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.22
2ghi_A260 Transport protein; multidrug resistance protein, M 92.22
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 92.19
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.18
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.17
3end_A307 Light-independent protochlorophyllide reductase ir 92.14
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 92.12
2ged_A193 SR-beta, signal recognition particle receptor beta 92.1
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 92.07
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 92.03
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.02
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 91.99
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 91.94
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 91.9
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 91.89
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 91.89
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 91.83
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 91.77
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 91.76
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 91.76
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 91.75
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.74
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 91.62
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 91.52
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 91.52
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 91.48
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 91.46
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.41
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 91.37
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 91.35
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 91.31
2wji_A165 Ferrous iron transport protein B homolog; membrane 91.3
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 91.29
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 91.22
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 91.2
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 91.18
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 91.15
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 91.11
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.03
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 91.02
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 90.98
1tue_A212 Replication protein E1; helicase, replication, E1E 90.97
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 90.96
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 90.92
2cvh_A220 DNA repair and recombination protein RADB; filamen 90.88
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 90.81
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 90.79
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 90.79
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 90.65
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 90.63
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 90.61
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 90.55
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 90.5
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 90.5
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 90.48
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 90.45
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 90.39
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 90.37
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 90.37
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 90.27
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 90.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 90.19
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 90.18
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 90.16
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 90.11
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 90.1
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 90.08
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 90.04
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 90.03
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 90.03
3kta_A182 Chromosome segregation protein SMC; structural mai 90.03
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 90.03
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 90.02
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 89.93
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 89.93
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 89.88
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 89.87
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 89.83
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 89.82
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 89.75
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 89.68
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 89.68
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 89.63
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 89.6
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 89.6
3t1o_A198 Gliding protein MGLA; G domain containing protein, 89.6
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 89.58
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 89.57
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 89.49
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 89.48
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 89.47
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 89.43
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 89.43
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 89.36
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 89.36
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 89.34
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 89.3
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 89.3
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 89.29
2www_A349 Methylmalonic aciduria type A protein, mitochondri 89.25
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 89.23
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 89.19
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 89.15
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 89.14
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 89.13
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 89.12
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 89.04
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 88.98
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 88.98
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 88.96
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 88.93
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 88.87
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 88.84
1u94_A356 RECA protein, recombinase A; homologous recombinat 88.77
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 88.75
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 88.75
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 88.73
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 88.7
3llu_A196 RAS-related GTP-binding protein C; structural geno 88.66
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 88.65
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 88.62
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 88.61
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 88.61
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 88.54
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 88.54
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 88.49
1nrj_B218 SR-beta, signal recognition particle receptor beta 88.45
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 88.44
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 88.43
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.95  E-value=1.1e-28  Score=274.56  Aligned_cols=175  Identities=18%  Similarity=0.278  Sum_probs=143.3

Q ss_pred             EeccchHHHHHHHHhCCCCccCCCeEEEEEEecCCchhHHHHHHHhc--hHHHHhhCCceeEEEecccc--cc-------
Q 043964          172 YGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCN--HEEVIRKFDKILWVCVSETF--EE-------  240 (713)
Q Consensus       172 vG~~~~~~~l~~~L~~~~~~~~~~~~vi~I~G~gGiGKTTLa~~v~~--~~~~~~~F~~~~wv~vs~~~--~~-------  240 (713)
                      |||++++++|+++|....   +...+||+||||||+||||||++||+  +.+++.+|+.++||+|++.+  +.       
T Consensus       131 ~GR~~~~~~l~~~L~~~~---~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~i  207 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMC---DLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDI  207 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHT---TSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhccc---CCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHH
Confidence            699999999999997542   23689999999999999999999998  67889999999999999863  11       


Q ss_pred             --------------------------------------------------------------------------------
Q 043964          241 --------------------------------------------------------------------------------  240 (713)
Q Consensus       241 --------------------------------------------------------------------------------  240 (713)
                                                                                                      
T Consensus       208 l~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~~~~~~~gs~ilvTTR~~~v~~~~~~~~~~  287 (549)
T 2a5y_B          208 LLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEF  287 (549)
T ss_dssp             HHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHHHTTCEEEEEESBGGGGGGCCSCEEE
T ss_pred             HHHHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhhcccccCCCEEEEEcCCHHHHHHcCCCCeE
Confidence                                                                                            


Q ss_pred             -----------------ccccCCCchhchHHHHHHHHHHHhcCCCCchhH------------------------------
Q 043964          241 -----------------IAFHGRSIEECEKLEQIGQKIASRCKGLPLAAK------------------------------  273 (713)
Q Consensus       241 -----------------~~f~~~~~~~~~~l~~i~~~i~~~c~GlPlai~------------------------------  273 (713)
                                       ++|+..   .++.+++++++|+++|+|+||||+                              
T Consensus       288 ~~l~~L~~~ea~~Lf~~~a~~~~---~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~w~~~~~l~~~l~~~~~~~i~  364 (549)
T 2a5y_B          288 IEVTSLEIDECYDFLEAYGMPMP---VGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVE  364 (549)
T ss_dssp             EECCCCCHHHHHHHHHHTSCCCC-----CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTC
T ss_pred             EECCCCCHHHHHHHHHHHhcCCC---CchhHHHHHHHHHHHhCCChHHHHHHHHHhccchHHHHHHhHHHhhcccHHHHH
Confidence                             122211   136788899999999999999997                              


Q ss_pred             ----------------HHh-----------hhccCCCCCccChHHHHHHHHHc--CccccCC-CccHHHHHHHHHHHHHh
Q 043964          274 ----------------CFS-----------YCAIFPKDFNIMKEKLITMWMAQ--GYFSVEQ-DEEVDIIGEEYFNILAT  323 (713)
Q Consensus       274 ----------------cfl-----------~~~~fp~~~~i~~~~Li~~Wiae--g~i~~~~-~~~~e~~~~~~~~eL~~  323 (713)
                                      ||+           |||+||+++.|+    +++|+|+  ||+.... +...+++++ ||++|++
T Consensus       365 ~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~  439 (549)
T 2a5y_B          365 CITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSK  439 (549)
T ss_dssp             CCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHHHTTT
T ss_pred             HHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHH
Confidence                            999           999999999999    8999999  9998766 566788888 9999999


Q ss_pred             CcCCcccccCCCCceeEEEeChHHHHHHHHhhccccc
Q 043964          324 HSFFQEFKKDDDNLIVACKMHDIVHDFAQFVSQNECS  360 (713)
Q Consensus       324 ~~ll~~~~~~~~~~~~~~~mhdlv~dla~~i~~~e~~  360 (713)
                      +||++....+   ...+|+|||++|++|++++.+++.
T Consensus       440 rsLl~~~~~~---~~~~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          440 RGALLSGKRM---PVLTFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             BSSCSEEECS---SSCEEECCHHHHHHHHTTSCTHHH
T ss_pred             cCCeeEecCC---CceEEEeChHHHHHHHHHHHHHHH
Confidence            9999987643   345799999999999999987764
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 713
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 66.4 bits (161), Expect = 2e-12
 Identities = 15/92 (16%), Positives = 32/92 (34%), Gaps = 5/92 (5%)

Query: 167 DEEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEEVIRK- 225
            +   Y R    + ++ KL             + + G  G GK+ +A    +  + +   
Sbjct: 18  KQMTCYIREYHVDRVIKKLDEMCDLD---SFFLFLHGRAGSGKSVIASQALSKSDQLIGI 74

Query: 226 -FDKILWVCVSETFEEIAFHGRSIEECEKLEQ 256
            +D I+W+  S T  +  F   +        +
Sbjct: 75  NYDSIVWLKDSGTAPKSTFDLFTDILLMLKSE 106
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.68
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.67
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.64
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.62
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.61
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.6
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.55
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.5
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.5
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.45
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.42
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.31
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.24
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.22
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.17
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.13
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.94
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.93
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.83
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.82
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.52
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.35
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.24
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.1
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.55
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.42
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.41
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.12
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.02
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.97
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.97
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.88
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.84
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.69
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.68
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.65
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.64
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.63
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.63
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.58
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.52
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.45
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.39
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.37
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.32
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.17
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.15
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.07
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.0
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.92
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.87
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.85
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.76
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.71
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.71
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.65
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.65
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.62
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.57
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.49
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.47
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.44
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.43
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.37
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.33
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.22
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.2
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.15
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.06
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.04
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.85
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.84
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.8
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.76
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 94.74
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.62
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 94.62
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.58
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.58
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.57
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.39
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.23
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.22
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.11
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.11
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.02
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.01
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 94.01
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.96
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.93
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.89
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.88
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.72
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 93.68
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.66
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 93.66
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.58
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.56
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.52
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 93.38
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.37
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.31
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.29
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.19
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.14
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 93.11
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.1
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.08
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.07
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.05
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.96
d2qy9a2211 GTPase domain of the signal recognition particle r 92.96
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.91
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.87
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.81
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.8
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.79
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.79
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 92.7
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.49
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 92.43
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.43
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.38
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.26
d1vmaa2213 GTPase domain of the signal recognition particle r 92.24
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.13
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.11
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.1
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 91.98
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.96
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.93
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.89
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 91.79
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 91.78
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.64
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 91.63
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.53
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.51
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.51
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.38
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.37
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.28
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.12
d2hyda1255 Putative multidrug export ATP-binding/permease pro 91.1
d1okkd2207 GTPase domain of the signal recognition particle r 90.92
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.86
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.78
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.74
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.65
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 90.62
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.61
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.56
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.56
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.38
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.29
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.29
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 90.22
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.09
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.03
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.83
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.79
d1svma_362 Papillomavirus large T antigen helicase domain {Si 89.78
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.75
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.66
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.63
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 89.56
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 89.44
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 89.4
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 89.36
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.27
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.26
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.95
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.87
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 88.8
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 88.68
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 88.63
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 88.59
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 88.57
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 88.52
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 88.51
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.46
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 88.3
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 88.18
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 88.16
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.16
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 88.11
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 88.09
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 87.93
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 87.64
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.57
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 87.52
d1nrjb_209 Signal recognition particle receptor beta-subunit 87.51
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.48
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.37
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.31
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.26
d2fh5b1207 Signal recognition particle receptor beta-subunit 87.23
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.22
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.22
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.12
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 87.08
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 86.99
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 86.92
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 86.9
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 86.87
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 86.77
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 86.4
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 86.34
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 86.28
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 86.24
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 86.24
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 85.77
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.71
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.48
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 85.47
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 85.4
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 85.38
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 85.25
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 85.21
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.37
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 84.3
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 83.86
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 83.74
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.72
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 83.63
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 83.5
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 82.61
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 82.5
d1xpua3289 Transcription termination factor Rho, ATPase domai 82.4
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 82.33
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 82.27
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 82.18
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 81.48
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 81.41
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 81.32
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 80.55
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 80.21
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.19
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.75  E-value=3.2e-19  Score=177.24  Aligned_cols=70  Identities=20%  Similarity=0.271  Sum_probs=60.0

Q ss_pred             CCcEEeccchHHHHHHHHhCCCCccCCCeEEEEEEecCCchhHHHHHHHhchHH--HHhhCCceeEEEecccccc
Q 043964          168 EEEIYGRVGEKNELLSKLLCESSEQQKGLHIISIVGMGGIGKTTLAQLDCNHEE--VIRKFDKILWVCVSETFEE  240 (713)
Q Consensus       168 ~~~~vG~~~~~~~l~~~L~~~~~~~~~~~~vi~I~G~gGiGKTTLa~~v~~~~~--~~~~F~~~~wv~vs~~~~~  240 (713)
                      +..++||+.++++|+++|....   +.+.++|+|+||||+||||||++||++..  +..+|++++||+|++.++.
T Consensus        19 ~~~~~gR~~~~~~i~~~L~~~~---~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~   90 (277)
T d2a5yb3          19 QMTCYIREYHVDRVIKKLDEMC---DLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPK   90 (277)
T ss_dssp             CCCSCCCHHHHHHHHHHHHHHT---TSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTT
T ss_pred             CCceeCcHHHHHHHHHHHHhcc---CCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCH
Confidence            4568999999999999998644   34688999999999999999999998643  6778999999999987764
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure