Citrus Sinensis ID: 044048

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27

MGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDPEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWMDVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPNADYNRGIRRSIGAPELHEYLKLESNVKNETTNNNKDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNELGWKIHRIDATYVLEGRMKDAEDAEDAWEEVVLKPGVAIVEDFLNKIKQ

cccccccHHHHHHHHHHHccccEEEccHHHHHcccccccccccHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEccHHHHHHHHHHHcccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccc

cccccccHHHHHHHHHHHcccEEEEcccEEEEccccEccccccHHHHccccccEEEcccccccccHHHHHHHHHHHHHHHHHcccccEEEcccHHHHHHHHcccccccccccHHHEEEHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHcccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccc

mgatatgktkLSIDLAIHFsgeainsdkiqvykgldiatnkvteserqgvphhllgfvdpeadypvEEFCEHALRAIDKIIenghlpiivggsNTYIEALVEDSIINFRANYdccfiwmdvdplvLYKYVGIRVDKMVETGLVDevrdmfdpnadynrgirrsigapelhEYLKLEsnvknettnnnKDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNELGWKIHRIDATYVLEGRMKDAEDAEDAWEEVVLKPGVAIVEDFLNKIKQ

mgatatgktklsiDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDPEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWMDVDPLVLYKYVGIRVDKMVEtglvdevrdmfdpnadynrgIRRSIGAPELHEYLKLesnvknettnnnKDLLLKKAIQEIKDNTCKLVDKQVQKIKRlrnelgwkihridatyvleGRMKDAEDAEDAWEEVVLKPGVAIVEDFLNKIKQ

**********LSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDPEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWMDVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPNADYNRGIRRSIGAPELHEYLKLE***********KDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNELGWKIHRIDATYVLEGRMKDAEDAEDAWEEVVLKPGVAIVEDFLN****

MGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDPEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWMDVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPNADYNRGIRRSIGAPELHEYLKLESNV*****NNNKDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNELGWKIHRIDATYVLEGRMKDAEDAEDAWEEVVLKPGVAIVE*FLN****

*********KLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDPEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWMDVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPNADYNRGIRRSIGAPELHEYLKLESNVKNETTNNNKDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNELGWKIHRIDATYVLEGRMKDAEDAEDAWEEVVLKPGVAIVEDFLNKIKQ

*****TGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDPEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWMDVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPNADYNRGIRRSIGAPELHEYLKLESNVKNETTNNNKDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNELGWKIHRIDATYVLEGRMKDAEDAEDAWEEVVLKPGVAIVEDFLNK***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		269	2.2.26 [Sep-21-2011]
Q94ID2		330	Adenylate isopentenyltran	yes	no	0.955	0.778	0.533	3e-74
Q93WC9		336	Adenylate isopentenyltran	no	no	0.962	0.770	0.501	3e-70
Q94ID1		329	Adenylate isopentenyltran	no	no	0.977	0.799	0.507	1e-69
Q5GHF7		329	Adenylate isopentenyltran	N/A	no	0.985	0.805	0.406	2e-55
Q9LJL4		330	Adenylate isopentenyltran	no	no	0.970	0.790	0.406	5e-53
Q94ID3		357	Adenylate isopentenyltran	no	no	0.966	0.728	0.399	3e-51
Q9SB60		318	Adenylate isopentenyltran	no	no	0.947	0.801	0.393	1e-49
Q9C6L1		342	Adenylate isopentenyltran	no	no	0.962	0.757	0.369	9e-45
Q9ZUX7		466	tRNA dimethylallyltransfe	no	no	0.427	0.246	0.435	1e-24
B9DPA1		316	tRNA dimethylallyltransfe	yes	no	0.379	0.322	0.504	5e-24

>sp\|Q94ID2\|IPT5_ARATH Adenylate isopentenyltransferase 5, chloroplastic OS=Arabidopsis thaliana GN=IPT5 PE=1 SV=2	Back alignment and function desciption

 Score =  278 bits (711), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 188/268 (70%), Gaps = 11/268 (4%)

Query: 1   MGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFV-D 59
           MGAT TGK++L+IDLA  F  E +NSDKIQVYKGLDI TNKVT  E  GVPHHLLG V D
Sbjct: 39  MGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTVHD 98

Query: 60  PEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWM 119
              D+  E+F   A+RA++ I++   +PII GGSN+YIEALV D  ++FR  Y+CCF+W+
Sbjct: 99  TYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEALVNDC-VDFRLRYNCCFLWV 157

Query: 120 DVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDP-NADYNRGIRRSIGAPELHEYLKLE-S 177
           DV   VL+ +V  RVDKMV+ GLVDEVR +FDP ++DY+ GIRR+IG PEL E+L+ E  
Sbjct: 158 DVSRPVLHSFVSERVDKMVDMGLVDEVRRIFDPSSSDYSAGIRRAIGVPELDEFLRSEMR 217

Query: 178 NVKNETTNNNKDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNELGWKIHRIDATYVLEGR 237
           N   ETT      LL+ AI++IK+NTC L  +Q+QKI+RL  +  W +HR+DAT V    
Sbjct: 218 NYPAETTER----LLETAIEKIKENTCLLACRQLQKIQRLYKQWKWNMHRVDATEVF--- 270

Query: 238 MKDAEDAEDAWEEVVLKPGVAIVEDFLN 265
           ++  E+A++AW+  V  P    VE FL+
Sbjct: 271 LRRGEEADEAWDNSVAHPSALAVEKFLS 298

Involved in cytokinin biosynthesis. Catalyzes the transfer of an isopentenyl group from dimethylallyl diphosphate (DMAPP) to ATP and ADP.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: nEC: 4

>sp\|Q93WC9\|IPT3_ARATH Adenylate isopentenyltransferase 3, chloroplastic OS=Arabidopsis thaliana GN=IPT3 PE=1 SV=1	Back alignment and function description

>sp\|Q94ID1\|IPT7_ARATH Adenylate isopentenyltransferase 7, mitochondrial OS=Arabidopsis thaliana GN=IPT7 PE=2 SV=2	Back alignment and function description

>sp\|Q5GHF7\|IPT_HUMLU Adenylate isopentenyltransferase OS=Humulus lupulus PE=1 SV=1	Back alignment and function description

>sp\|Q9LJL4\|IPT8_ARATH Adenylate isopentenyltransferase 8, chloroplastic OS=Arabidopsis thaliana GN=IPT8 PE=2 SV=1	Back alignment and function description

>sp\|Q94ID3\|IPT1_ARATH Adenylate isopentenyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=IPT1 PE=1 SV=2	Back alignment and function description

>sp\|Q9SB60\|IPT4_ARATH Adenylate isopentenyltransferase 4 OS=Arabidopsis thaliana GN=IPT4 PE=1 SV=1	Back alignment and function description

>sp\|Q9C6L1\|IPT6_ARATH Adenylate isopentenyltransferase 6, chloroplastic OS=Arabidopsis thaliana GN=IPT6 PE=2 SV=1	Back alignment and function description

>sp\|Q9ZUX7\|IPT2_ARATH tRNA dimethylallyltransferase 2 OS=Arabidopsis thaliana GN=IPT2 PE=1 SV=2	Back alignment and function description

>sp\|B9DPA1\|MIAA_STACT tRNA dimethylallyltransferase OS=Staphylococcus carnosus (strain TM300) GN=miaA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		269
255556115		338	tRNA delta(2)-isopentenylpyrophosphate t	0.959	0.763	0.592	2e-85
449461158		339	PREDICTED: adenylate isopentenyltransfer	0.966	0.766	0.599	5e-85
255556129		290	ATP binding protein, putative [Ricinus c	0.962	0.893	0.570	1e-81
356567280		307	PREDICTED: adenylate isopentenyltransfer	0.973	0.853	0.558	4e-81
359481561		283	PREDICTED: adenylate isopentenyltransfer	0.959	0.911	0.532	3e-77
297741673		258	unnamed protein product [Vitis vinifera]	0.959	1.0	0.532	4e-77
325112804		284	adenylate isopentenyltransferase [Malus	0.962	0.911	0.574	6e-77
224080289		333	cytokinin biosynthetic isopentenyltransf	0.959	0.774	0.537	1e-76
325112793		320	adenylate isopentenyltransferase [Malus	0.955	0.803	0.530	3e-76
325301844		308	adenylate isopentenyltransferase [Malus	0.955	0.834	0.530	3e-76

>gi\|255556115\|ref\|XP_002519092.1\| tRNA delta(2)-isopentenylpyrophosphate transferase, putative [Ricinus communis] gi\|223541755\|gb\|EEF43303.1\| tRNA delta(2)-isopentenylpyrophosphate transferase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 197/265 (74%), Gaps = 7/265 (2%)

Query: 1   MGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDP 60
           +GATATGK+KLS+DLA HF  E INSDKIQVYKGLDI TNK+ E  R+G+PHHLLGF+DP
Sbjct: 78  LGATATGKSKLSVDLASHFDAEIINSDKIQVYKGLDIVTNKIPEDNRKGIPHHLLGFMDP 137

Query: 61  EADYPVEEFCEHALRAIDKIIE-NGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWM 119
           EAD+  ++FC H  +A+  I E NG +PIIVGGSN +I ALVED   +F+ANYD CF+WM
Sbjct: 138 EADFTAQDFCNHVCKAMTHITEYNGRVPIIVGGSNNFIRALVEDPHSSFKANYDSCFLWM 197

Query: 120 DVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPNADYNRGIRRSIGAPELHEYLKLESNV 179
           DV   VLYK+VG RVD+MV+ GLVDEVR+     +DY RG+ R+IG PE+HE+   E  +
Sbjct: 198 DVALPVLYKHVGKRVDQMVKAGLVDEVRETAVSGSDYTRGVWRAIGLPEMHEFYYAEKTM 257

Query: 180 KNETTNNNKDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNELGWKIHRIDATYVLEGRMK 239
            +E   N K +LL  AI  IK+NTC+LVD Q+ KI R+ +ELGWKIHRIDAT V+E   K
Sbjct: 258 SDE---NTKKMLLDAAIDRIKENTCRLVDAQLGKIDRMIHELGWKIHRIDATCVVE---K 311

Query: 240 DAEDAEDAWEEVVLKPGVAIVEDFL 264
             ++A +AW +VVLKP + IV  FL
Sbjct: 312 SEDEAVEAWNKVVLKPSIEIVRGFL 336

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449461158\|ref\|XP_004148309.1\| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like [Cucumis sativus] gi\|449510325\|ref\|XP_004163632.1\| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255556129\|ref\|XP_002519099.1\| ATP binding protein, putative [Ricinus communis] gi\|223541762\|gb\|EEF43310.1\| ATP binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356567280\|ref\|XP_003551849.1\| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|359481561\|ref\|XP_003632640.1\| PREDICTED: adenylate isopentenyltransferase 5, chloroplastic-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297741673\|emb\|CBI32805.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|325112804\|gb\|ADY80563.1\| adenylate isopentenyltransferase [Malus x domestica]	Back alignment and taxonomy information

>gi\|224080289\|ref\|XP_002306084.1\| cytokinin biosynthetic isopentenyltransferase [Populus trichocarpa] gi\|222849048\|gb\|EEE86595.1\| cytokinin biosynthetic isopentenyltransferase [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|325112793\|gb\|ADY80558.1\| adenylate isopentenyltransferase [Malus x domestica]	Back alignment and taxonomy information

>gi\|325301844\|gb\|ADZ05814.1\| adenylate isopentenyltransferase [Malus x domestica]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		269
TAIR\|locus:2179629		330	IPT5 "isopentenyltransferase 5	0.955	0.778	0.518	2.5e-65
TAIR\|locus:2099177		336	IPT3 "isopentenyltransferase 3	0.962	0.770	0.483	2.7e-61
TAIR\|locus:2088025		329	IPT7 "isopentenyltransferase 7	0.977	0.799	0.492	1.3e-59
TAIR\|locus:2042103		466	IPT2 "tRNAisopentenyltransfera	0.427	0.246	0.435	9.1e-44
TAIR\|locus:2121979		318	IPT4 "isopentenyltransferase 4	0.843	0.713	0.394	1.1e-37
UNIPROTKB\|Q5GHF7		329	Q5GHF7 "Adenylate isopentenylt	0.565	0.462	0.476	3.1e-35
TAIR\|locus:2094128		330	IPT8 "ATP/ADP isopentenyltrans	0.565	0.460	0.466	4.6e-34
UNIPROTKB\|F1Q3P4		468	TRIT1 "Uncharacterized protein	0.397	0.228	0.431	1.1e-33
TAIR\|locus:2201292		357	IPT1 "isopentenyltransferase 1	0.565	0.425	0.433	4.1e-33
UNIPROTKB\|Q9H3H1		467	TRIT1 "tRNA dimethylallyltrans	0.397	0.229	0.425	6.5e-33

TAIR\|locus:2179629 IPT5 "isopentenyltransferase 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 665 (239.2 bits), Expect = 2.5e-65, P = 2.5e-65
 Identities = 139/268 (51%), Positives = 180/268 (67%)

Query:     1 MGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFV-D 59
             MGAT TGK++L+IDLA  F  E +NSDKIQVYKGLDI TNKVT  E  GVPHHLLG V D
Sbjct:    39 MGATGTGKSRLAIDLATRFPAEIVNSDKIQVYKGLDIVTNKVTPEESLGVPHHLLGTVHD 98

Query:    60 PEADYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVEDSIINFRANYDCCFIWM 119
                D+  E+F   A+RA++ I++   +PII GGSN+YIEALV D + +FR  Y+CCF+W+
Sbjct:    99 TYEDFTAEDFQREAIRAVESIVQRDRVPIIAGGSNSYIEALVNDCV-DFRLRYNCCFLWV 157

Query:   120 DVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPNA-DYNRGIRRSIGAPELHEYLKLES- 177
             DV   VL+ +V  RVDKMV+ GLVDEVR +FDP++ DY+ GIRR+IG PEL E+L+ E  
Sbjct:   158 DVSRPVLHSFVSERVDKMVDMGLVDEVRRIFDPSSSDYSAGIRRAIGVPELDEFLRSEMR 217

Query:   178 NVKNETTNNNKDLLLKKAIQEIKDNTCKLVDKQVQKIKRLRNELGWKIHRIDATYVLEGR 237
             N   ETT      LL+ AI++IK+NTC L  +Q+QKI+RL  +  W +HR+DAT V    
Sbjct:   218 NYPAETTER----LLETAIEKIKENTCLLACRQLQKIQRLYKQWKWNMHRVDATEVF--- 270

Query:   238 MKXXXXXXXXXXXVVLKPGVAIVEDFLN 265
             ++            V  P    VE FL+
Sbjct:   271 LRRGEEADEAWDNSVAHPSALAVEKFLS 298

GO:0005524 "ATP binding" evidence=IEA

GO:0005739 "mitochondrion" evidence=ISM

GO:0008033 "tRNA processing" evidence=IEA

GO:0016765 "transferase activity, transferring alkyl or aryl (other than methyl) groups" evidence=ISS

GO:0009536 "plastid" evidence=IDA

GO:0009824 "AMP dimethylallyltransferase activity" evidence=IMP

GO:0052622 "ATP dimethylallyltransferase activity" evidence=ISS

GO:0052623 "ADP dimethylallyltransferase activity" evidence=ISS

GO:0009691 "cytokinin biosynthetic process" evidence=IGI;RCA

GO:0007131 "reciprocal meiotic recombination" evidence=RCA

TAIR\|locus:2099177 IPT3 "isopentenyltransferase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2088025 IPT7 "isopentenyltransferase 7" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2042103 IPT2 "tRNAisopentenyltransferase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2121979 IPT4 "isopentenyltransferase 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5GHF7 Q5GHF7 "Adenylate isopentenyltransferase" [Humulus lupulus (taxid:3486)]	Back alignment and assigned GO terms

TAIR\|locus:2094128 IPT8 "ATP/ADP isopentenyltransferases" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|F1Q3P4 TRIT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

TAIR\|locus:2201292 IPT1 "isopentenyltransferase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9H3H1 TRIT1 "tRNA dimethylallyltransferase, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q94ID2	IPT5_ARATH	2, ., 5, ., 1, ., n, 4	0.5335	0.9553	0.7787	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.5.1.75	LOW CONFIDENCE prediction!
4th Layer	2.5.1.n4	0.914
3rd Layer	2.5.1	0.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.IV.412.1	cytokinin biosynthetic isopentenyltransferase (267 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	CYP735A6	cytochrome P450 (518 aa)	•		0.899
	CYP735A5	cytochrome P450 (516 aa)	•		0.899
	GA20ox7	gibberellin 20-oxidase (EC-1.14.11.12) (372 aa)		•	0.510
	GA20ox5	gibberellin 20-oxidase (EC-1.14.11.12) (378 aa)		•	0.510
	GA20ox2-1	gibberellin 20-oxidase (EC-1.14.11.12) (366 aa)		•	0.510
	GA20ox6	gibberellin 20-oxidase (EC-1.14.11.12) (385 aa)		•	0.510
	GA20ox4	gibberellin 20-oxidase (EC-1.14.11.12) (341 aa)		•	0.510
	eugene3.00140701	response regulator (144 aa)		•	0.510
	GA20ox3	gibberellin 20-oxidase (EC-1.14.11.12) (361 aa)		•	0.510
	GA20ox2-2	gibberellin 20-oxidase (EC-1.14.11.12) (379 aa)		•	0.510

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		269
PLN02165		334	PLN02165, PLN02165, adenylate isopentenyltransfera	5e-87
PRK00091		307	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosp	1e-40
COG0324		308	COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosph	4e-38
PLN02748		468	PLN02748, PLN02748, tRNA dimethylallyltransferase	6e-36
PLN02748		468	PLN02748, PLN02748, tRNA dimethylallyltransferase	6e-36
TIGR00174		287	TIGR00174, miaA, tRNA dimethylallyltransferase	9e-33
PLN02840		421	PLN02840, PLN02840, tRNA dimethylallyltransferase	1e-26
pfam01715		253	pfam01715, IPPT, IPP transferase	2e-22
PRK14729		300	PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosp	7e-16
pfam01715		253	pfam01715, IPPT, IPP transferase	4e-09
COG0324		308	COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosph	1e-08
PRK00091		307	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosp	3e-08
TIGR00174		287	TIGR00174, miaA, tRNA dimethylallyltransferase	5e-08

>gnl\|CDD\|177823 PLN02165, PLN02165, adenylate isopentenyltransferase	Back alignment and domain information

 Score =  262 bits (670), Expect = 5e-87
 Identities = 117/289 (40%), Positives = 172/289 (59%), Gaps = 27/289 (9%)

Query: 1   MGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDP 60
           MGAT +GK++LS+DLA  F  E INSDK+QVY GL I TN++T  +R+GVPHHLLG ++P
Sbjct: 49  MGATGSGKSRLSVDLATRFPSEIINSDKMQVYDGLKITTNQITIQDRRGVPHHLLGELNP 108

Query: 61  EA-DYPVEEFCEHALRAIDKIIENGHLPIIVGGSNTYIEALVED-------------SII 106
           +  +    EF   A  +I +I     LPI+ GGSN++I AL+ D             S+I
Sbjct: 109 DDGELTASEFRSLASLSISEITSRQKLPIVAGGSNSFIHALLADRFDPEIYPFSSGSSLI 168

Query: 107 NFRANYDCCFIWMDVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPNADYNR--GIRRSI 164
           +    YDCCFIW+DV   VL++Y+  RVD+M+++G+ +E+ + +DP    +   GIR++I
Sbjct: 169 SSDLRYDCCFIWVDVSEPVLFEYLSKRVDEMMDSGMFEELAEFYDPVKSGSEPLGIRKAI 228

Query: 165 GAPELHEYLKLESNVKNETTNNNKDLLLK----KAIQEIKDNTCKLVDKQVQKIKRLRNE 220
           G PE   Y K       E      D   K    +A++EIK+NTC+L  +Q++KI +L++ 
Sbjct: 229 GVPEFDRYFKK---YPPENKMGKWDQARKAAYEEAVREIKENTCQLAKRQIEKIMKLKSA 285

Query: 221 LGWKIHRIDATYVLEGRM---KDAEDAEDAWEEVVLKPGVAIVEDFLNK 266
            GW I R+DAT      M      +   + WE+ VL+P V IV+ FL +
Sbjct: 286 -GWDIKRVDATASFRAVMRKKGKKKKWREIWEKDVLEPSVKIVKRFLVE 333

Length = 334

>gnl\|CDD\|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed	Back alignment and domain information

>gnl\|CDD\|223401 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|215399 PLN02748, PLN02748, tRNA dimethylallyltransferase	Back alignment and domain information

>gnl\|CDD\|215399 PLN02748, PLN02748, tRNA dimethylallyltransferase	Back alignment and domain information

>gnl\|CDD\|213512 TIGR00174, miaA, tRNA dimethylallyltransferase	Back alignment and domain information

>gnl\|CDD\|215451 PLN02840, PLN02840, tRNA dimethylallyltransferase	Back alignment and domain information

>gnl\|CDD\|216659 pfam01715, IPPT, IPP transferase	Back alignment and domain information

>gnl\|CDD\|173191 PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|216659 pfam01715, IPPT, IPP transferase	Back alignment and domain information

>gnl\|CDD\|223401 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed	Back alignment and domain information

>gnl\|CDD\|213512 TIGR00174, miaA, tRNA dimethylallyltransferase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		269
PLN02748		468	tRNA dimethylallyltransferase	100.0
PLN02165		334	adenylate isopentenyltransferase	100.0
PRK14729		300	miaA tRNA delta(2)-isopentenylpyrophosphate transf	100.0
COG0324		308	MiaA tRNA delta(2)-isopentenylpyrophosphate transf	100.0
KOG1384		348	consensus tRNA delta(2)-isopentenylpyrophosphate t	100.0
TIGR00174		287	miaA tRNA isopentenyltransferase (miaA). Catalyzes	100.0
PRK00091		307	miaA tRNA delta(2)-isopentenylpyrophosphate transf	100.0
PLN02840		421	tRNA dimethylallyltransferase	100.0
PF01715		253	IPPT: IPP transferase; InterPro: IPR002627 tRNA is	100.0
PF01745		233	IPT: Isopentenyl transferase; InterPro: IPR002648	100.0
PRK04220		301	2-phosphoglycerate kinase; Provisional	99.27
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	99.11
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	99.1
PRK00300		205	gmk guanylate kinase; Provisional	99.07
cd00071		137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	99.06
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	98.95
PRK11545		163	gntK gluconate kinase 1; Provisional	98.94
PRK00131		175	aroK shikimate kinase; Reviewed	98.93
PRK05057		172	aroK shikimate kinase I; Reviewed	98.93
PRK13946		184	shikimate kinase; Provisional	98.87
PRK00625		173	shikimate kinase; Provisional	98.77
PRK13948		182	shikimate kinase; Provisional	98.76
PRK06217		183	hypothetical protein; Validated	98.75
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	98.73
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	98.72
PRK13947		171	shikimate kinase; Provisional	98.69
PRK13949		169	shikimate kinase; Provisional	98.67
PF01202		158	SKI: Shikimate kinase; InterPro: IPR000623 Shikima	98.67
COG3265		161	GntK Gluconate kinase [Carbohydrate transport and	98.66
PRK07261		171	topology modulation protein; Provisional	98.65
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	98.65
PRK14737		186	gmk guanylate kinase; Provisional	98.62
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	98.6
PRK03731		171	aroL shikimate kinase II; Reviewed	98.57
smart00072		184	GuKc Guanylate kinase homologues. Active enzymes c	98.56
PRK08118		167	topology modulation protein; Reviewed	98.53
PLN02199		303	shikimate kinase	98.51
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	98.5
PRK14021		542	bifunctional shikimate kinase/3-dehydroquinate syn	98.49
PF00625		183	Guanylate_kin: Guanylate kinase; InterPro: IPR0081	98.48
PRK03839		180	putative kinase; Provisional	98.47
PRK09825		176	idnK D-gluconate kinase; Provisional	98.46
PRK06762		166	hypothetical protein; Provisional	98.44
PRK04182		180	cytidylate kinase; Provisional	98.43
PRK13951		488	bifunctional shikimate kinase/3-dehydroquinate syn	98.43
PRK05541		176	adenylylsulfate kinase; Provisional	98.42
COG1102		179	Cmk Cytidylate kinase [Nucleotide transport and me	98.39
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	98.38
PRK08233		182	hypothetical protein; Provisional	98.37
COG0194		191	Gmk Guanylate kinase [Nucleotide transport and met	98.36
PHA02530		300	pseT polynucleotide kinase; Provisional	98.35
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	98.33
cd02024		187	NRK1 Nicotinamide riboside kinase (NRK) is an enzy	98.31
PRK06547		172	hypothetical protein; Provisional	98.3
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	98.27
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	98.27
PRK14531		183	adenylate kinase; Provisional	98.27
PRK08154		309	anaerobic benzoate catabolism transcriptional regu	98.26
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	98.26
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	98.25
PRK14738		206	gmk guanylate kinase; Provisional	98.25
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	98.25
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	98.22
TIGR02173		171	cyt_kin_arch cytidylate kinase, putative. Proteins	98.22
PRK12338		319	hypothetical protein; Provisional	98.22
cd02025		220	PanK Pantothenate kinase (PanK) catalyzes the phos	98.21
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	98.17
PRK14532		188	adenylate kinase; Provisional	98.16
PRK14530		215	adenylate kinase; Provisional	98.14
TIGR00017		217	cmk cytidylate kinase. This family consists of cyt	98.14
TIGR01351		210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	98.11
PF06414		199	Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e	98.11
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	98.1
PRK01184		184	hypothetical protein; Provisional	98.08
PRK12337		475	2-phosphoglycerate kinase; Provisional	98.06
PRK14528		186	adenylate kinase; Provisional	98.05
PLN02200		234	adenylate kinase family protein	98.04
TIGR00152		188	dephospho-CoA kinase. This model produces scores i	98.03
PRK00081		194	coaE dephospho-CoA kinase; Reviewed	98.01
PRK00279		215	adk adenylate kinase; Reviewed	98.01
COG1072		283	CoaA Panthothenate kinase [Coenzyme metabolism]	98.0
PRK12339		197	2-phosphoglycerate kinase; Provisional	98.0
PRK14527		191	adenylate kinase; Provisional	97.99
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	97.98
PTZ00301		210	uridine kinase; Provisional	97.98
PRK08356		195	hypothetical protein; Provisional	97.94
PRK02496		184	adk adenylate kinase; Provisional	97.93
PTZ00088		229	adenylate kinase 1; Provisional	97.9
cd02027		149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	97.88
PLN02772		398	guanylate kinase	97.87
PRK00889		175	adenylylsulfate kinase; Provisional	97.86
cd02028		179	UMPK_like Uridine monophosphate kinase_like (UMPK_	97.86
COG0645		170	Predicted kinase [General function prediction only	97.83
PRK13477		512	bifunctional pantoate ligase/cytidylate kinase; Pr	97.83
PRK05480		209	uridine/cytidine kinase; Provisional	97.81
cd02023		198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	97.81
TIGR00554		290	panK_bact pantothenate kinase, bacterial type. Sho	97.81
cd02022		179	DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2	97.79
PRK06696		223	uridine kinase; Validated	97.76
PRK14731		208	coaE dephospho-CoA kinase; Provisional	97.76
COG0572		218	Udk Uridine kinase [Nucleotide transport and metab	97.75
KOG3354		191	consensus Gluconate kinase [Carbohydrate transport	97.74
PRK09270		229	nucleoside triphosphate hydrolase domain-containin	97.71
PRK07667		193	uridine kinase; Provisional	97.68
TIGR00235		207	udk uridine kinase. Model contains a number of lon	97.65
PF00485		194	PRK: Phosphoribulokinase / Uridine kinase family;	97.62
PRK00023		225	cmk cytidylate kinase; Provisional	97.61
PRK04040		188	adenylate kinase; Provisional	97.61
PF00406		151	ADK: Adenylate kinase; InterPro: IPR000850 Adenyla	97.6
PRK14734		200	coaE dephospho-CoA kinase; Provisional	97.59
PRK13808		333	adenylate kinase; Provisional	97.58
COG2074		299	2-phosphoglycerate kinase [Carbohydrate transport	97.57
PRK05439		311	pantothenate kinase; Provisional	97.56
TIGR00455		184	apsK adenylylsulfate kinase (apsK). Important resi	97.56
KOG2702		323	consensus Predicted panthothenate kinase/uridine k	97.54
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	97.54
PRK00698		205	tmk thymidylate kinase; Validated	97.5
PF07931		174	CPT: Chloramphenicol phosphotransferase-like prote	97.49
PRK05537		568	bifunctional sulfate adenylyltransferase subunit 1	97.46
PF08433		270	KTI12: Chromatin associated protein KTI12 ; InterP	97.46
PF00004		132	AAA: ATPase family associated with various cellula	97.45
PRK03846		198	adenylylsulfate kinase; Provisional	97.44
cd01672		200	TMPK Thymidine monophosphate kinase (TMPK), also k	97.44
TIGR03575		340	selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti	97.43
PLN02348		395	phosphoribulokinase	97.38
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	97.37
PF01583		156	APS_kinase: Adenylylsulphate kinase; InterPro: IPR	97.35
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	97.34
cd01673		193	dNK Deoxyribonucleoside kinase (dNK) catalyzes the	97.33
PLN02674		244	adenylate kinase	97.3
PRK14526		211	adenylate kinase; Provisional	97.29
PRK11860		661	bifunctional 3-phosphoshikimate 1-carboxyvinyltran	97.29
PRK03333		395	coaE dephospho-CoA kinase/protein folding accessor	97.25
COG0563		178	Adk Adenylate kinase and related kinases [Nucleoti	97.25
cd02030		219	NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO	97.24
PRK14732		196	coaE dephospho-CoA kinase; Provisional	97.15
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	97.14
PLN02459		261	probable adenylate kinase	97.13
PRK07429		327	phosphoribulokinase; Provisional	97.13
PRK06620		214	hypothetical protein; Validated	97.13
PRK14529		223	adenylate kinase; Provisional	97.13
PLN02318		656	phosphoribulokinase/uridine kinase	97.11
PRK14730		195	coaE dephospho-CoA kinase; Provisional	97.09
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	97.07
PLN02422		232	dephospho-CoA kinase	97.06
PRK05506		632	bifunctional sulfate adenylyltransferase subunit 1	97.02
PRK13975		196	thymidylate kinase; Provisional	97.0
PLN02842		505	nucleotide kinase	96.97
PF01121		180	CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th	96.96
PRK05416		288	glmZ(sRNA)-inactivating NTPase; Provisional	96.95
PHA00729		226	NTP-binding motif containing protein	96.94
PRK06893		229	DNA replication initiation factor; Validated	96.92
COG0237		201	CoaE Dephospho-CoA kinase [Coenzyme metabolism]	96.86
smart00382		148	AAA ATPases associated with a variety of cellular	96.85
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	96.82
TIGR00041		195	DTMP_kinase thymidylate kinase. Function: phosphor	96.82
PRK09087		226	hypothetical protein; Validated	96.8
PRK08084		235	DNA replication initiation factor; Provisional	96.79
cd02026		273	PRK Phosphoribulokinase (PRK) is an enzyme involve	96.78
KOG3308		225	consensus Uncharacterized protein of the uridine k	96.73
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	96.72
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	96.72
PRK09518		712	bifunctional cytidylate kinase/GTPase Der; Reviewe	96.7
COG0283		222	Cmk Cytidylate kinase [Nucleotide transport and me	96.62
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	96.6
PF13173		128	AAA_14: AAA domain	96.6
PRK13973		213	thymidylate kinase; Provisional	96.57
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	96.54
COG3709		192	Uncharacterized component of phosphonate metabolis	96.54
PRK08903		227	DnaA regulatory inactivator Hda; Validated	96.51
PF13189		179	Cytidylate_kin2: Cytidylate kinase-like family; PD	96.5
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	96.5
PRK14733		204	coaE dephospho-CoA kinase; Provisional	96.49
KOG3877		393	consensus NADH:ubiquinone oxidoreductase, NDUFA10/	96.48
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	96.46
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	96.4
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	96.35
cd03115		173	SRP The signal recognition particle (SRP) mediates	96.33
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	96.29
PRK06761		282	hypothetical protein; Provisional	96.27
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	96.24
CHL00181		287	cbbX CbbX; Provisional	96.18
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	96.16
PTZ00451		244	dephospho-CoA kinase; Provisional	96.13
KOG0707		231	consensus Guanylate kinase [Nucleotide transport a	96.13
cd01918		149	HprK_C HprK/P, the bifunctional histidine-containi	96.11
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	96.1
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	96.08
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	96.05
PRK05642		234	DNA replication initiation factor; Validated	96.02
COG4639		168	Predicted kinase [General function prediction only	95.99
PRK00149		450	dnaA chromosomal replication initiation protein; R	95.99
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	95.99
CHL00195		489	ycf46 Ycf46; Provisional	95.95
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	95.94
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	95.91
PRK15453		290	phosphoribulokinase; Provisional	95.9
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	95.89
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	95.84
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	95.83
cd02029		277	PRK_like Phosphoribulokinase-like (PRK-like) is a	95.8
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	95.79
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	95.79
PRK13974		212	thymidylate kinase; Provisional	95.67
PRK14088		440	dnaA chromosomal replication initiation protein; P	95.66
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	95.66
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	95.64
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	95.62
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	95.59
PF02223		186	Thymidylate_kin: Thymidylate kinase; InterPro: IPR	95.55
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	95.54
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	95.45
PHA02244		383	ATPase-like protein	95.44
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	95.44
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	95.34
COG2087		175	CobU Adenosyl cobinamide kinase/adenosyl cobinamid	95.31
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	95.3
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	95.29
KOG3220		225	consensus Similar to bacterial dephospho-CoA kinas	95.28
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	95.28
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	95.27
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	95.21
PRK07933		213	thymidylate kinase; Validated	95.2
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	95.2
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	95.11
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	95.09
PTZ00202		550	tuzin; Provisional	95.08
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	95.08
PF13521		163	AAA_28: AAA domain; PDB: 1LW7_A.	95.02
PLN03046		460	D-glycerate 3-kinase; Provisional	95.01
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	94.98
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	94.95
COG1341		398	Predicted GTPase or GTP-binding protein [General f	94.92
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	94.91
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	94.89
PRK10867		433	signal recognition particle protein; Provisional	94.88
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	94.87
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	94.86
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	94.86
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	94.86
PRK03992		389	proteasome-activating nucleotidase; Provisional	94.84
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	94.79
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	94.79
COG2256		436	MGS1 ATPase related to the helicase subunit of the	94.76
PRK12269		863	bifunctional cytidylate kinase/ribosomal protein S	94.75
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	94.74
TIGR00750		300	lao LAO/AO transport system ATPase. Mutations have	94.74
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	94.73
COG1428		216	Deoxynucleoside kinases [Nucleotide transport and	94.7
PLN02796		347	D-glycerate 3-kinase	94.7
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	94.66
PRK07952		244	DNA replication protein DnaC; Validated	94.66
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	94.64
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	94.63
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	94.62
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	94.6
TIGR00959		428	ffh signal recognition particle protein. This mode	94.59
PRK13976		209	thymidylate kinase; Provisional	94.59
PRK10416		318	signal recognition particle-docking protein FtsY;	94.58
PRK10865		857	protein disaggregation chaperone; Provisional	94.56
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	94.56
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	94.52
PRK04195		482	replication factor C large subunit; Provisional	94.52
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	94.48
TIGR00064		272	ftsY signal recognition particle-docking protein F	94.45
PF03029		238	ATP_bind_1: Conserved hypothetical ATP binding pro	94.45
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	94.4
PRK08727		233	hypothetical protein; Validated	94.39
PF07475		171	Hpr_kinase_C: HPr Serine kinase C-terminal domain;	94.38
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	94.38
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	94.36
PRK06835		329	DNA replication protein DnaC; Validated	94.33
COG0714		329	MoxR-like ATPases [General function prediction onl	94.3
PF08303		168	tRNA_lig_kinase: tRNA ligase kinase domain; InterP	94.28
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	94.28
PRK08099		399	bifunctional DNA-binding transcriptional repressor	94.27
COG4619		223	ABC-type uncharacterized transport system, ATPase	94.22
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	94.18
PRK06921		266	hypothetical protein; Provisional	94.14
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	94.13
KOG3079		195	consensus Uridylate kinase/adenylate kinase [Nucle	94.09
CHL00095		821	clpC Clp protease ATP binding subunit	94.05
TIGR03167		311	tRNA_sel_U_synt tRNA 2-selenouridine synthase. The	94.04
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	94.04
PRK13342		413	recombination factor protein RarA; Reviewed	94.04
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	94.02
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	94.02
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	93.98
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	93.98
PRK09169		2316	hypothetical protein; Validated	93.97
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	93.94
PF13245		76	AAA_19: Part of AAA domain	93.86
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	93.86
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	93.86
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	93.84
PLN02924		220	thymidylate kinase	93.76
PF02283		167	CobU: Cobinamide kinase / cobinamide phosphate gua	93.76
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	93.76
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	93.75
PF07726		131	AAA_3: ATPase family associated with various cellu	93.74
PRK00771		437	signal recognition particle protein Srp54; Provisi	93.73
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	93.71
cd01983		99	Fer4_NifH The Fer4_NifH superfamily contains a var	93.7
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	93.66
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	93.61
PRK06526		254	transposase; Provisional	93.6
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	93.6
PRK00411		394	cdc6 cell division control protein 6; Reviewed	93.57
TIGR00679		304	hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene	93.54
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	93.53
PRK13851		344	type IV secretion system protein VirB11; Provision	93.47
PF12846		304	AAA_10: AAA-like domain	93.46
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	93.45
PHA02624		647	large T antigen; Provisional	93.45
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	93.44
PHA02544		316	44 clamp loader, small subunit; Provisional	93.44
PRK12422		445	chromosomal replication initiation protein; Provis	93.43
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	93.39
PRK12377		248	putative replication protein; Provisional	93.39
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	93.37
cd01394		218	radB RadB. The archaeal protein radB shares simila	93.35
PRK05707		328	DNA polymerase III subunit delta'; Validated	93.35
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	93.34
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	93.33
PRK11784		345	tRNA 2-selenouridine synthase; Provisional	93.33
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	93.3
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	93.29
CHL00176		638	ftsH cell division protein; Validated	93.28
COG1493		308	HprK Serine kinase of the HPr protein, regulates c	93.26
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	93.25
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	93.25
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	93.24
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	93.23
PLN03025		319	replication factor C subunit; Provisional	93.21
PRK12402		337	replication factor C small subunit 2; Reviewed	93.2
cd03114		148	ArgK-like The function of this protein family is u	93.2
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	93.14
PRK05428		308	HPr kinase/phosphorylase; Provisional	93.13
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	93.01
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	92.98
PRK09183		259	transposase/IS protein; Provisional	92.97
TIGR01526		325	nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr	92.97
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	92.95
COG4185		187	Uncharacterized protein conserved in bacteria [Fun	92.94
PF02367		123	UPF0079: Uncharacterised P-loop hydrolase UPF0079;	92.9
PRK14087		450	dnaA chromosomal replication initiation protein; P	92.87
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	92.87
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	92.87
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	92.81
PF13555		62	AAA_29: P-loop containing region of AAA domain	92.79
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	92.77
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	92.76
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	92.72
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	92.68
PRK07940		394	DNA polymerase III subunit delta'; Validated	92.67
CHL00095		821	clpC Clp protease ATP binding subunit	92.64
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	92.64
TIGR02237		209	recomb_radB DNA repair and recombination protein R	92.64
PRK09435		332	membrane ATPase/protein kinase; Provisional	92.62
TIGR00176		155	mobB molybdopterin-guanine dinucleotide biosynthes	92.61
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	92.58
PRK14086		617	dnaA chromosomal replication initiation protein; P	92.53
PF10662		143	PduV-EutP: Ethanolamine utilisation - propanediol	92.47
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	92.45
PRK13768		253	GTPase; Provisional	92.41
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	92.39
PRK08181		269	transposase; Validated	92.36
COG0125		208	Tmk Thymidylate kinase [Nucleotide transport and m	92.34
PRK13341		725	recombination factor protein RarA/unknown domain f	92.32
PF05729		166	NACHT: NACHT domain	92.31
PRK14974		336	cell division protein FtsY; Provisional	92.29
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	92.29
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	92.27
cd00983		325	recA RecA is a bacterial enzyme which has roles in	92.26
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	92.26
PRK15455		644	PrkA family serine protein kinase; Provisional	92.17
PRK13764		602	ATPase; Provisional	92.16
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	92.15
PTZ00322		664	6-phosphofructo-2-kinase/fructose-2,6-biphosphatas	92.14
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	92.12
COG0606		490	Predicted ATPase with chaperone activity [Posttran	92.07
cd00880		163	Era_like Era (E. coli Ras-like protein)-like. This	91.92
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	91.89
PRK04296		190	thymidine kinase; Provisional	91.89
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	91.87
TIGR01618		220	phage_P_loop phage nucleotide-binding protein. Thi	91.81
PRK13833		323	conjugal transfer protein TrbB; Provisional	91.81
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	91.81
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	91.77
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	91.76
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	91.75
cd04163		168	Era Era subfamily. Era (E. coli Ras-like protein)	91.74
PRK10865		857	protein disaggregation chaperone; Provisional	91.72
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	91.68
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	91.67
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	91.67
PRK08116		268	hypothetical protein; Validated	91.67
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	91.65
CHL00206		2281	ycf2 Ycf2; Provisional	91.64
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	91.62
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	91.6
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	91.53
TIGR02236		310	recomb_radA DNA repair and recombination protein R	91.51
PF01935		229	DUF87: Domain of unknown function DUF87; InterPro:	91.51
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	91.49
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	91.43
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	91.42
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	91.36
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	91.34
KOG2170		344	consensus ATPase of the AAA+ superfamily [General	91.34
COG1484		254	DnaC DNA replication protein [DNA replication, rec	91.33
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	91.32
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	91.29
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	91.27
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	91.12
PF01580		205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	91.11
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	91.06
PRK10751		173	molybdopterin-guanine dinucleotide biosynthesis pr	91.0
KOG3062		281	consensus RNA polymerase II elongator associated p	90.98
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	90.95
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	90.92
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	90.91
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	90.87
PF00005		137	ABC_tran: ABC transporter This structure is on hol	90.84
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	90.83
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	90.8
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	90.76
PRK08939		306	primosomal protein DnaI; Reviewed	90.74
PF08477		119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	90.69
COG1703		323	ArgK Putative periplasmic protein kinase ArgK and	90.67
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	90.59
PLN03232		1495	ABC transporter C family member; Provisional	90.48
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	90.46
TIGR03743		634	SXT_TraD conjugative coupling factor TraD, SXT/TOL	90.46
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	90.45
cd01853		249	Toc34_like Toc34-like (Translocon at the Outer-env	90.44
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	90.43
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	90.43
PF13481		193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	90.4
PF13476		202	AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V	90.37
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	90.34
KOG3078		235	consensus Adenylate kinase [Nucleotide transport a	90.34
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	90.33
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	90.29
PRK09354		349	recA recombinase A; Provisional	90.26
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	90.25
PRK10536		262	hypothetical protein; Provisional	90.23
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	90.22
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	90.2
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	90.2
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	90.18
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	90.17
cd03269		210	ABC_putative_ATPase This subfamily is involved in	90.12
PRK05564		313	DNA polymerase III subunit delta'; Validated	90.09
TIGR03754		643	conj_TOL_TraD conjugative coupling factor TraD, TO	90.07
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	90.05
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	90.05
PF01591		222	6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130	89.98
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	89.92
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	89.86
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	89.85
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	89.85
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	89.81
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	89.81
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	89.78
cd03278		197	ABC_SMC_barmotin Barmotin is a tight junction-asso	89.76
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	89.7
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	89.68
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	89.65
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	89.62
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	89.61
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	89.58
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	89.55
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	89.44
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	89.44
PF03205		140	MobB: Molybdopterin guanine dinucleotide synthesis	89.43
cd03246		173	ABCC_Protease_Secretion This family represents the	89.43
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	89.41
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	89.4
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	89.39
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	89.39
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	89.38
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	89.37
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	89.34
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	89.31
PRK08533		230	flagellar accessory protein FlaH; Reviewed	89.31
cd00882		157	Ras_like_GTPase Ras-like GTPase superfamily. The R	89.3
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	89.26
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	89.21
COG0378		202	HypB Ni2+-binding GTPase involved in regulation of	89.2
cd03273		251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	89.18
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	89.18
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	89.17
cd03116		159	MobB Molybdenum is an essential trace element in t	89.16
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	89.13
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	89.12
cd02034		116	CooC The accessory protein CooC, which contains a	89.12
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	89.1
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	89.05
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	88.97

>PLN02748 tRNA dimethylallyltransferase	Back alignment and domain information

Probab=100.00  E-value=3.9e-76  Score=568.69  Aligned_cols=262  Identities=45%  Similarity=0.820  Sum_probs=230.0

Q ss_pred             CCCCcCchhHHHHHHHHHcCCeeeeCCccceecCCccccCCCCHhhhcCCCceecccCCCCCCCCHHHHHHHHHHHHHHH
Q 044048            1 MGATATGKTKLSIDLAIHFSGEAINSDKIQVYKGLDIATNKVTESERQGVPHHLLGFVDPEADYPVEEFCEHALRAIDKI   80 (269)
Q Consensus         1 ~GpTgsGKS~la~~LA~~~~~eiIs~Ds~QvYk~l~I~Takpt~~e~~~v~hhl~~~~~~~~~~~~~~f~~~a~~~i~~i   80 (269)
                      +||||||||+||+.||+.++++|||+|||||||||||||||||.+|+.+|||||+|+++|+++||+++|+++|.++|++|
T Consensus        28 ~GptgsGKs~la~~la~~~~~eii~~DsmQVYrgLdIgTaKpt~eE~~~VpHHLid~v~p~e~ysv~~F~~~A~~~I~~I  107 (468)
T PLN02748         28 MGPTGSGKSKLAVDLASHFPVEIINADSMQVYSGLDVLTNKVPLHEQKGVPHHLLGVISPSVEFTAKDFRDHAVPLIEEI  107 (468)
T ss_pred             ECCCCCCHHHHHHHHHHhcCeeEEcCchheeeCCcchhcCCCCHHHHcCCCCeeEeecCCCCcCcHHHHHHHHHHHHHHH
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCceEEEcccHHHHHHHHcchh-------------------------h-----------------------------
Q 044048           81 IENGHLPIIVGGSNTYIEALVEDSI-------------------------I-----------------------------  106 (269)
Q Consensus        81 ~~~~~~pIivGGt~~Y~~~ll~g~~-------------------------~-----------------------------  106 (269)
                      +++|++||||||||||++||++|..                         .                             
T Consensus       108 ~~rgk~PIlVGGTglYi~aLl~g~~~~~~p~~~~~~~~~~~~~~r~~l~~~~~~~~~g~~~l~~~L~~vDP~~A~rihpn  187 (468)
T PLN02748        108 LSRNGLPVIVGGTNYYIQALVSPFLLDDMAEETEDCTFVVASVLDEHMDVESGLGNDDEDHGYELLKELDPVAANRIHPN  187 (468)
T ss_pred             HhcCCCeEEEcChHHHHHHHHcCcccccCCccccccccccCHHHHHHHHHHHHHHhcCHHHHHHHHHhhCHHHHhhcCCc
Confidence            9999999999999999999997531                         0                             


Q ss_pred             --------------------hh-c------------cccceEEEEEeCCHHHHHHHHHHHHHHHHHcCcHHHHHhhcCCC
Q 044048          107 --------------------NF-R------------ANYDCCFIWMDVDPLVLYKYVGIRVDKMVETGLVDEVRDMFDPN  153 (269)
Q Consensus       107 --------------------~~-~------------~~~~~~~~~l~~~~e~L~~Ri~~Rv~~Ml~~Gll~Ev~~l~~~~  153 (269)
                                          .+ .            .+|++++|||++|+++|++||++||+.|+++||++||+.|++.+
T Consensus       188 D~rRI~RALEI~~~TG~~~S~~~~~~~~~~~~~~~~~~~~~~~i~l~~~r~~L~~RI~~Rvd~Mle~GlleEv~~l~~~~  267 (468)
T PLN02748        188 NHRKINRYLELYATTGVLPSKLYQGKAAENWGRISNSRFDCCFICVDADTAVLDRYVNQRVDCMIDAGLLDEVYDIYDPG  267 (468)
T ss_pred             cHHHHHHHHHHHHHHCcCHHHHhhhccccccccccCCCCceEEEEeCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHhcC
Confidence                                00 0            14778999999999999999999999999999999999999876


Q ss_pred             CCcccccccccCHHHHHHHHh--------cccCc-------cc--------cccccchHHHHHHHHHHHHHHHHHHHHHH
Q 044048          154 ADYNRGIRRSIGAPELHEYLK--------LESNV-------KN--------ETTNNNKDLLLKKAIQEIKDNTCKLVDKQ  210 (269)
Q Consensus       154 ~~~~~~~~qaIGykE~~~yl~--------~~~~~-------d~--------~~~~~~~~~~~~~~ie~ik~~TrqyAkrQ  210 (269)
                      .+++.|++|+||||||.+||+        |+.+.       ++        ...+.....++++|++.||.+||||||||
T Consensus       268 ~~~~~~~~qaIGykE~~~yL~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~eaie~ik~~Tr~yAKRQ  347 (468)
T PLN02748        268 ADYTRGLRQAIGVREFEDFLRLYLSRNENGELTSSSNNDKVMKENSRKILNFPHDDKLKILLDEAIDQVKLNTRRLVRRQ  347 (468)
T ss_pred             CCCCcccceeEcHHHHHHHHHhcccccccccccccccccchhhhhhhccccccchhhhhhhHHHHHHHHHHHHHHHHHHH
Confidence            667889999999999999998        33200       00        00112333579999999999999999999


Q ss_pred             HHHHhchhcccCCeeEEeccchhhhhhcccccchHHHHHHHhhhHHHHHHHHHhcccc
Q 044048          211 VQKIKRLRNELGWKIHRIDATYVLEGRMKDAEDAEDAWEEVVLKPGVAIVEDFLNKIK  268 (269)
Q Consensus       211 ~tW~r~~~~~~~~~i~~~d~t~~~~~~~~~~~~~~~~W~~~V~~pa~~i~~~fl~~~~  268 (269)
                      +|||+++....+|+++++|+|+++...      .++.|++.|.+||++||++||.++.
T Consensus       348 ~tw~~rl~~~~~~~i~~lD~t~~~~~~------~~~~W~~~V~~pa~~iv~~fL~~~~  399 (468)
T PLN02748        348 KRRLHRLNTVFGWNIHYIDATEAILCK------SEESWNAKVVKPAVEIVRRFLSDDT  399 (468)
T ss_pred             HHHHhhhhhcccCCeeEeechhhhhhc------cHhHHHHHhHHHHHHHHHHHHcCCC
Confidence            999999766557899999999987322      3589999999999999999999853

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional	Back alignment and domain information

>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00174 miaA tRNA isopentenyltransferase (miaA)	Back alignment and domain information

>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed	Back alignment and domain information

>PLN02840 tRNA dimethylallyltransferase	Back alignment and domain information

>PF01715 IPPT: IPP transferase; InterPro: IPR002627 tRNA isopentenyltransferases 2	Back alignment and domain information

>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid []	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>PRK11545 gntK gluconate kinase 1; Provisional	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PRK05057 aroK shikimate kinase I; Reviewed	Back alignment and domain information

>PRK13946 shikimate kinase; Provisional	Back alignment and domain information

>PRK00625 shikimate kinase; Provisional	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>PRK06217 hypothetical protein; Validated	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>PRK13949 shikimate kinase; Provisional	Back alignment and domain information

>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2	Back alignment and domain information

>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PRK03731 aroL shikimate kinase II; Reviewed	Back alignment and domain information

>smart00072 GuKc Guanylate kinase homologues	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PLN02199 shikimate kinase	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional	Back alignment and domain information

>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>PRK09825 idnK D-gluconate kinase; Provisional	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>PRK04182 cytidylate kinase; Provisional	Back alignment and domain information

>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional	Back alignment and domain information

>PRK05541 adenylylsulfate kinase; Provisional	Back alignment and domain information

>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>PRK08233 hypothetical protein; Provisional	Back alignment and domain information

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+)	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>PRK14738 gmk guanylate kinase; Provisional	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>TIGR02173 cyt_kin_arch cytidylate kinase, putative	Back alignment and domain information

>PRK12338 hypothetical protein; Provisional	Back alignment and domain information

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>PRK14530 adenylate kinase; Provisional	Back alignment and domain information

>TIGR00017 cmk cytidylate kinase	Back alignment and domain information

>TIGR01351 adk adenylate kinases	Back alignment and domain information

>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>PRK01184 hypothetical protein; Provisional	Back alignment and domain information

>PRK12337 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>PLN02200 adenylate kinase family protein	Back alignment and domain information

>TIGR00152 dephospho-CoA kinase	Back alignment and domain information

>PRK00081 coaE dephospho-CoA kinase; Reviewed	Back alignment and domain information

>PRK00279 adk adenylate kinase; Reviewed	Back alignment and domain information

>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism]	Back alignment and domain information

>PRK12339 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PTZ00301 uridine kinase; Provisional	Back alignment and domain information

>PRK08356 hypothetical protein; Provisional	Back alignment and domain information

>PRK02496 adk adenylate kinase; Provisional	Back alignment and domain information

>PTZ00088 adenylate kinase 1; Provisional	Back alignment and domain information

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PRK00889 adenylylsulfate kinase; Provisional	Back alignment and domain information

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>COG0645 Predicted kinase [General function prediction only]	Back alignment and domain information

>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional	Back alignment and domain information

>PRK05480 uridine/cytidine kinase; Provisional	Back alignment and domain information

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2	Back alignment and domain information

>TIGR00554 panK_bact pantothenate kinase, bacterial type	Back alignment and domain information

>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>PRK14731 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed	Back alignment and domain information

>PRK07667 uridine kinase; Provisional	Back alignment and domain information

>TIGR00235 udk uridine kinase	Back alignment and domain information

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2	Back alignment and domain information

>PRK00023 cmk cytidylate kinase; Provisional	Back alignment and domain information

>PRK04040 adenylate kinase; Provisional	Back alignment and domain information

>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells	Back alignment and domain information

>PRK14734 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>PRK13808 adenylate kinase; Provisional	Back alignment and domain information

>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05439 pantothenate kinase; Provisional	Back alignment and domain information

>TIGR00455 apsK adenylylsulfate kinase (apsK)	Back alignment and domain information

>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK00698 tmk thymidylate kinase; Validated	Back alignment and domain information

>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae	Back alignment and domain information

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated	Back alignment and domain information

>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II []	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK03846 adenylylsulfate kinase; Provisional	Back alignment and domain information

>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor	Back alignment and domain information

>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic	Back alignment and domain information

>PLN02348 phosphoribulokinase	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs)	Back alignment and domain information

>PLN02674 adenylate kinase	Back alignment and domain information

>PRK14526 adenylate kinase; Provisional	Back alignment and domain information

>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional	Back alignment and domain information

>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional	Back alignment and domain information

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK)	Back alignment and domain information

>PRK14732 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>PLN02459 probable adenylate kinase	Back alignment and domain information

>PRK07429 phosphoribulokinase; Provisional	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK14529 adenylate kinase; Provisional	Back alignment and domain information

>PLN02318 phosphoribulokinase/uridine kinase	Back alignment and domain information

>PRK14730 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02422 dephospho-CoA kinase	Back alignment and domain information

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional	Back alignment and domain information

>PRK13975 thymidylate kinase; Provisional	Back alignment and domain information

>PLN02842 nucleotide kinase	Back alignment and domain information

>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2	Back alignment and domain information

>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism]	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00041 DTMP_kinase thymidylate kinase	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed	Back alignment and domain information

>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK13973 thymidylate kinase; Provisional	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK14733 coaE dephospho-CoA kinase; Provisional	Back alignment and domain information

>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion]	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK06761 hypothetical protein; Provisional	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00451 dephospho-CoA kinase; Provisional	Back alignment and domain information

>KOG0707 consensus Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>COG4639 Predicted kinase [General function prediction only]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>PRK15453 phosphoribulokinase; Provisional	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK13974 thymidylate kinase; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>COG2087 CobU Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase [Coenzyme metabolism]	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK07933 thymidylate kinase; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A	Back alignment and domain information

>PLN03046 D-glycerate 3-kinase; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only]	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>TIGR00750 lao LAO/AO transport system ATPase	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]	Back alignment and domain information

>PLN02796 D-glycerate 3-kinase	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK13976 thymidylate kinase; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PF07475 Hpr_kinase_C: HPr Serine kinase C-terminal domain; InterPro: IPR011104 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases []	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK09169 hypothetical protein; Validated	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PLN02924 thymidylate kinase	Back alignment and domain information

>PF02283 CobU: Cobinamide kinase / cobinamide phosphate guanyltransferase; InterPro: IPR003203 This family is composed of a group of bifunctional cobalbumin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PHA02624 large T antigen; Provisional	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11784 tRNA 2-selenouridine synthase; Provisional	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms]	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>cd03114 ArgK-like The function of this protein family is unkown	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK05428 HPr kinase/phosphorylase; Provisional	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>COG4185 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13768 GTPase; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00880 Era_like Era (E	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01618 phage_P_loop phage nucleotide-binding protein	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>cd04163 Era Era subfamily	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>TIGR02236 recomb_radA DNA repair and recombination protein RadA	Back alignment and domain information

>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only]	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional	Back alignment and domain information

>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only]	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases	Back alignment and domain information

>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C	Back alignment and domain information

>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]	Back alignment and domain information

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH)	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

Homologous Structure Templates