Citrus Sinensis ID: 044082


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MKCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSLASLRDLYLASSTLPSINRPSLSSMNSSTSLALLDLSSCGLSNSAYHWLFKISSNLLALDLNSN
ccccHHHHHHHHHHHcccccccccccccccccccccccccccEEEccccccEEEEEcccccccccccccccEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccccccccEEEccccccccccccHHHHccccccEEEcccc
cccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEccccEEEEcccccccEEccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEcccccccccccccHHHcccccccEEEcccccccccccccHHHHccccccEEEEcccccccccccHHHHHHHHHccEEEcccc
MKCIEKERQALLMFKQGlvddcgylsswgsdegrkdcckwsgvqcsnrtgHVIMLNLKykvdpvcpnrplrgninsSLLELQhlnyldlsvndflgnpipeFIGFFTKLRFLDLSLanfsgripyqlgnltnlqslnlgynslyvskFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSLASLRDLYlasstlpsinrpslssmnsstsLALLDLsscglsnsaYHWLFKISSNLLALDLNSN
MKCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSLASLRDLYLASStlpsinrpslsSMNSSTSLALLDLSSCGLSNSAYHWLFKISSnllaldlnsn
MKCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSLASLRDLYLASSTLPSINRPslssmnsstslalldlssCGLSNSAYHWLFKIssnllaldlnsn
********QALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSLASLRDLYLAS*******************LALLDLSSCGLSNSAYHWLFKISSNLLAL*****
*KCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSLASLRDLYLASSTLPSINRPSLSSMNSSTSLALLDLSSCGLSNSAYHWLFKISSNLLALDLNSN
MKCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSLASLRDLYLASSTLPSINRPS********SLALLDLSSCGLSNSAYHWLFKISSNLLALDLNSN
MKCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSLASLRDLYLASSTLPSINRPSLSSMNSSTSLALLDLSSCGLSNSAYHWLFKISSNLLALDLN**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSLASLRDLYLASSTLPSINRPSLSSMNSSTSLALLDLSSCGLSNSAYHWLFKISSNLLALDLNSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q8RY65 635 Protein NSP-INTERACTING K no no 0.633 0.242 0.371 3e-14
Q9C9H7 847 Receptor-like protein 12 no no 0.740 0.212 0.331 2e-13
C0LGX3 993 LRR receptor-like serine/ no no 0.728 0.178 0.311 5e-12
Q9LRT1 1016 Probably inactive leucine no no 0.502 0.120 0.388 9e-12
Q9LFS4 638 Protein NSP-INTERACTING K no no 0.790 0.300 0.333 9e-12
Q8VYT3 648 Probable LRR receptor-lik no no 0.617 0.231 0.358 2e-11
Q8VZG8 1045 Probable LRR receptor-lik no no 0.600 0.139 0.337 3e-11
Q9SCT4 836 Probably inactive leucine no no 0.613 0.178 0.318 5e-11
Q00874 372 DNA-damage-repair/tolerat no no 0.946 0.618 0.284 7e-11
C0LGF4 591 LRR receptor-like serine/ no no 0.625 0.257 0.312 7e-11
>sp|Q8RY65|NIK2_ARATH Protein NSP-INTERACTING KINASE 2 OS=Arabidopsis thaliana GN=NIK2 PE=1 SV=1 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 88/167 (52%), Gaps = 13/167 (7%)

Query: 2   KCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKV 61
           K +  E  AL+  K  L D  G L +W  D+   D C W+ + CS+  G VI L      
Sbjct: 37  KGVNFEVVALIGIKSSLTDPHGVLMNW--DDTAVDPCSWNMITCSD--GFVIRLE----- 87

Query: 62  DPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSG 121
               P++ L G ++SS+  L +L  + L  N   GN IP  IG   KL+ LDLS  NF+G
Sbjct: 88  ---APSQNLSGTLSSSIGNLTNLQTVLLQNNYITGN-IPHEIGKLMKLKTLDLSTNNFTG 143

Query: 122 RIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLS 168
           +IP+ L    NLQ L +  NSL  +    L+++ +LT LDL + +LS
Sbjct: 144 QIPFTLSYSKNLQYLRVNNNSLTGTIPSSLANMTQLTFLDLSYNNLS 190




Involved in defense response to geminivirus infection (By similarity). Phosphorylates RPL10A in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFS4|NIK1_ARATH Protein NSP-INTERACTING KINASE 1 OS=Arabidopsis thaliana GN=NIK1 PE=1 SV=1 Back     alignment and function description
>sp|Q8VYT3|Y4052_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g30520 OS=Arabidopsis thaliana GN=At4g30520 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 Back     alignment and function description
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|C0LGF4|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
225464712 1021 PREDICTED: receptor-like protein 12-like 0.991 0.236 0.586 3e-64
359490572 975 PREDICTED: probable LRR receptor-like se 0.983 0.245 0.534 7e-57
224105895 963 predicted protein [Populus trichocarpa] 0.995 0.251 0.512 3e-54
359490576 972 PREDICTED: LRR receptor-like serine/thre 0.888 0.222 0.504 1e-51
224125666 938 predicted protein [Populus trichocarpa] 0.967 0.250 0.530 4e-51
302143736 510 unnamed protein product [Vitis vinifera] 0.872 0.415 0.493 3e-49
302143738329 unnamed protein product [Vitis vinifera] 0.864 0.638 0.491 5e-49
224105891 1036 predicted protein [Populus trichocarpa] 0.987 0.231 0.495 8e-49
224116866 994 predicted protein [Populus trichocarpa] 0.987 0.241 0.495 1e-48
356577875 1523 PREDICTED: uncharacterized protein LOC10 0.967 0.154 0.479 3e-48
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 143/244 (58%), Positives = 171/244 (70%), Gaps = 3/244 (1%)

Query: 3   CIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLK-YKV 61
           C+EKERQALL FKQGLVDD G LSSWG++E R+DCCKW GVQCSNRT HVIML+L     
Sbjct: 52  CVEKERQALLDFKQGLVDDFGILSSWGNEEDRRDCCKWRGVQCSNRTSHVIMLDLHALPT 111

Query: 62  DPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSG 121
           D V   + LRG I+SSLLELQHLN+LDLS+NDF G+ +PEFIG F+KLR+L+LS A  +G
Sbjct: 112 DTVHKYQSLRGRISSSLLELQHLNHLDLSLNDFQGSYVPEFIGLFSKLRYLNLSEARLAG 171

Query: 122 RIPYQLGNLTNLQSLNLGYN-SLYVSKFGWLSHLNKLTQLDLDFVDLSEASDWLQVITSL 180
            IP  LGNL+NL  L+L  N  +      WLS L+ L  LDL  ++L +A  W  VI  L
Sbjct: 172 MIPSHLGNLSNLHFLDLSRNYGMSSETLEWLSRLSSLRHLDLSGLNLDKAIYWEHVINRL 231

Query: 181 ASLRDLYLASSTLPSINRPS-LSSMNSSTSLALLDLSSCGLSNSAYHWLFKISSNLLALD 239
            SL DL L  S LP I  PS LS  NSS SL +LDLS   LS+S Y WLF +SS+L+ LD
Sbjct: 232 PSLTDLLLHDSALPQIITPSALSYTNSSKSLVVLDLSWNFLSSSVYPWLFNLSSSLVHLD 291

Query: 240 LNSN 243
           L+ N
Sbjct: 292 LSIN 295




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224125666|ref|XP_002329688.1| predicted protein [Populus trichocarpa] gi|222870596|gb|EEF07727.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302143736|emb|CBI22597.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143738|emb|CBI22599.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105891|ref|XP_002333752.1| predicted protein [Populus trichocarpa] gi|222838400|gb|EEE76765.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116866|ref|XP_002331833.1| predicted protein [Populus trichocarpa] gi|222875071|gb|EEF12202.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356577875|ref|XP_003557047.1| PREDICTED: uncharacterized protein LOC100784241 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.917 0.246 0.392 2.6e-33
TAIR|locus:2119445 719 AT4G13820 [Arabidopsis thalian 0.740 0.250 0.358 1.5e-19
TAIR|locus:2119535 725 RLP48 "receptor like protein 4 0.683 0.228 0.357 6.3e-18
TAIR|locus:2825389 784 RLP11 "AT1G71390" [Arabidopsis 0.736 0.228 0.350 8.6e-17
TAIR|locus:2205005 1019 RLP7 "AT1G47890" [Arabidopsis 0.724 0.172 0.341 9.9e-17
TAIR|locus:2078112 868 RLP32 "receptor like protein 3 0.753 0.210 0.362 1.6e-16
TAIR|locus:2090754 711 RLP43 "receptor like protein 4 0.530 0.181 0.391 3.2e-16
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.522 0.129 0.393 6.7e-16
TAIR|locus:2119430 741 RLP47 "receptor like protein 4 0.534 0.175 0.390 9.2e-16
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.625 0.158 0.375 1.7e-15
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 373 (136.4 bits), Expect = 2.6e-33, P = 2.6e-33
 Identities = 95/242 (39%), Positives = 131/242 (54%)

Query:     2 KCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKV 61
             KCI  ERQALL F+  L D    L SW       DCC W GV C  RT HV+ ++L+   
Sbjct:    32 KCISTERQALLTFRAALTDLSSRLFSWSGP----DCCNWPGVLCDARTSHVVKIDLRNPS 87

Query:    62 DPVCPNR----PLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLA 117
               V  +      LRG I+ SL +L+ L+YLDLS NDF    IPEFIG    LR+L+LS +
Sbjct:    88 QDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSS 147

Query:   118 NFSGRIPYQLGNLTNLQSLNL--------GYNSLYVSKFGWLSHLNK-LTQLDLDFVDLS 168
             +FSG IP  LGNL+ L+SL+L        G  SL  S   WLS L+  L  L++ +V+LS
Sbjct:   148 SFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYVNLS 207

Query:   169 EASD-WLQVITSLASLRDLYLASSTLPSINRPXXXXXXXXXXXXXXXXXXCGLSNSAYHW 227
              A + WLQ  + +++L++L+L +S L ++  P                    L++   +W
Sbjct:   208 GAGETWLQDFSRISALKELHLFNSELKNLP-PTLSSSADLKLLEVLDLSENSLNSPIPNW 266

Query:   228 LF 229
             LF
Sbjct:   267 LF 268


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2119445 AT4G13820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00037814001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (996 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
 Score = 68.7 bits (168), Expect = 2e-13
 Identities = 44/108 (40%), Positives = 58/108 (53%), Gaps = 13/108 (12%)

Query: 40  WSGVQCS--NRTGHVIM--LNLKYKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFL 95
           WSG  C   +  G   +  L L         N+ LRG I + + +L+HL  ++LS N   
Sbjct: 404 WSGADCQFDSTKGKWFIDGLGLD--------NQGLRGFIPNDISKLRHLQSINLSGNSIR 455

Query: 96  GNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSL 143
           GN IP  +G  T L  LDLS  +F+G IP  LG LT+L+ LNL  NSL
Sbjct: 456 GN-IPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSL 502


Length = 623

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
PLN03150623 hypothetical protein; Provisional 99.69
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.65
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.56
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.54
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.48
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.43
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.42
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.42
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.41
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.4
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.4
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.38
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.37
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.35
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.3
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.27
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.26
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
PLN03150623 hypothetical protein; Provisional 99.11
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.07
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.98
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.78
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.66
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.6
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.49
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.38
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.28
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.27
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.06
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.06
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.02
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.0
PRK15386 426 type III secretion protein GogB; Provisional 97.94
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.94
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.87
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.51
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.49
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.44
PRK15386 426 type III secretion protein GogB; Provisional 97.43
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.78
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.66
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.11
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.29
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.77
KOG4308 478 consensus LRR-containing protein [Function unknown 94.76
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.58
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.57
KOG1947 482 consensus Leucine rich repeat proteins, some prote 93.41
KOG1947 482 consensus Leucine rich repeat proteins, some prote 92.99
KOG4341483 consensus F-box protein containing LRR [General fu 91.96
smart0037026 LRR Leucine-rich repeats, outliers. 91.81
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.81
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.39
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.21
KOG4341483 consensus F-box protein containing LRR [General fu 89.07
KOG0473 326 consensus Leucine-rich repeat protein [Function un 87.75
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 86.77
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 86.44
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.96  E-value=1.7e-28  Score=229.95  Aligned_cols=221  Identities=31%  Similarity=0.441  Sum_probs=138.4

Q ss_pred             CHHHHHHHHHhhhcccCCCCCCCCCCCCCCCCCCcccceEEecCCCCceEEEecCCCCCCCCCCCCcccccchhhccCCC
Q 044082            4 IEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVDPVCPNRPLRGNINSSLLELQH   83 (243)
Q Consensus         4 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~c~~~~~~l~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~   83 (243)
                      .+.|+.||++|++++.+|.+++.+|.   ...++|.|.|+.|.. .++|+.|||+++        .+.+.++..+..+++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~~--------~i~~~~~~~~~~l~~   94 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSGK--------NISGKISSAIFRLPY   94 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecCC--------CccccCChHHhCCCC
Confidence            45799999999999988888888997   578899999999974 568999999994        677777777777777


Q ss_pred             CcEEEccCCCCCCCCcchhhc-CCCCCcEEecCCccccccCCcCCCCCCCCcEEEccCCccccCCccccCCCCCCCEEEc
Q 044082           84 LNYLDLSVNDFLGNPIPEFIG-FFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDL  162 (243)
Q Consensus        84 L~~L~l~~n~l~~~~~~~~~~-~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l  162 (243)
                      |++|++++|.+.+. +|..+. .+++|++|++++|.+.+.+|.  +.+++|++|++++|.+++..|..++.+++|++|++
T Consensus        95 L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L  171 (968)
T PLN00113         95 IQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDL  171 (968)
T ss_pred             CCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEEC
Confidence            77777777777654 555443 666666666666666544443  23444555555555544444444444455555555


Q ss_pred             CCccccCC-cc---------------------hHHHhhccccccccccccccCCCCCCCCcccccCCCCCcEEECCCCcc
Q 044082          163 DFVDLSEA-SD---------------------WLQVITSLASLRDLYLASSTLPSINRPSLSSMNSSTSLALLDLSSCGL  220 (243)
Q Consensus       163 ~~n~l~~~-~~---------------------~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~~L~~L~L~~n~i  220 (243)
                      ++|.+.+. |.                     ++..+..+++|++|++++|.+.+..+  ..+..+ ++|++|++++|.+
T Consensus       172 ~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p--~~l~~l-~~L~~L~L~~n~l  248 (968)
T PLN00113        172 GGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIP--YEIGGL-TSLNHLDLVYNNL  248 (968)
T ss_pred             ccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCC--hhHhcC-CCCCEEECcCcee
Confidence            55444333 21                     11244444555555555555544444  344444 5555555555555


Q ss_pred             ccccchhHHhhhccCceeeCCCC
Q 044082          221 SNSAYHWLFKISSNLLALDLNSN  243 (243)
Q Consensus       221 ~~~~~~~l~~l~~~L~~L~l~~N  243 (243)
                      ++.+|..++++++ |++|++++|
T Consensus       249 ~~~~p~~l~~l~~-L~~L~L~~n  270 (968)
T PLN00113        249 TGPIPSSLGNLKN-LQYLFLYQN  270 (968)
T ss_pred             ccccChhHhCCCC-CCEEECcCC
Confidence            5555555555555 555555543



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-10
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-04
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-04
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Iteration: 1

Score = 61.6 bits (148), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 58/171 (33%), Positives = 82/171 (47%), Gaps = 12/171 (7%) Query: 3 CIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCK--WSGVQCSNRTGHVIMLNLKYK 60 C +++QALL K+ L + LSSW DCC W GV C T + NL Sbjct: 3 CNPQDKQALLQIKKDLGNPT-TLSSW---LPTTDCCNRTWLGVLCDTDTQTYRVNNL--- 55 Query: 61 VDPVCPNRPLRGNINSSLLELQHLNYLDL-SVNDFLGNPIPEFIGFFTKLRFLDLSLANF 119 D N P I SSL L +LN+L + +N+ +G PIP I T+L +L ++ N Sbjct: 56 -DLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVG-PIPPAIAKLTQLHYLYITHTNV 113 Query: 120 SGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLSEA 170 SG IP L + L +L+ YN+L + +S L L + D +S A Sbjct: 114 SGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGA 164
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-10
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-08
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 6e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-08
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-06
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-06
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  149 bits (378), Expect = 2e-41
 Identities = 63/263 (23%), Positives = 101/263 (38%), Gaps = 36/263 (13%)

Query: 3   CIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCKWSGVQCSNRTGHVIMLNLKYKVD 62
            + +E   L+ FK  L D    L  W S++   + C + GV C +    V  ++L     
Sbjct: 9   SLYREIHQLISFKDVLPDK-NLLPDWSSNK---NPCTFDGVTCRD--DKVTSIDLSS--- 59

Query: 63  PVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLANFSGR 122
              P       ++SSLL L  L  L LS +   G  +  F      L  LDLS  + SG 
Sbjct: 60  --KPLNVGFSAVSSSLLSLTGLESLFLSNSHING-SVSGF-KCSASLTSLDLSRNSLSGP 115

Query: 123 IP--YQLGNLTNLQSLNLGYNSLYVS-KFGWLSHLNKLTQLDLDFVDLS-EASDWLQVIT 178
           +     LG+ + L+ LN+  N+L    K      LN L  LDL    +S        +  
Sbjct: 116 VTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSD 175

Query: 179 SLASLRDLYLA----SSTLPSINRPSLSSMN--------------SSTSLALLDLSSCGL 220
               L+ L ++    S  +      +L  ++                ++L  LD+S   L
Sbjct: 176 GCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKL 235

Query: 221 SNSAYHWLFKISSNLLALDLNSN 243
           S      +    + L  L+++SN
Sbjct: 236 SGDFSRAISTC-TELKLLNISSN 257


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.84
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.8
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.8
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.78
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.78
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.78
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.78
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.75
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.75
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.74
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.74
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.74
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.73
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.73
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.72
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.66
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.66
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.46
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.44
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.38
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.37
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.34
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.32
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.32
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.28
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.25
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.21
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.01
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.96
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.76
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.76
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.74
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.51
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.93
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.71
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.55
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.53
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.49
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.43
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.38
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.62
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.45
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=1.2e-34  Score=238.22  Aligned_cols=221  Identities=31%  Similarity=0.414  Sum_probs=171.7

Q ss_pred             CCCHHHHHHHHHhhhcccCCCCCCCCCCCCCCCCCCcc--cceEEecCCC--CceEEEecCCCCCCCCCCCCccc--ccc
Q 044082            2 KCIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCCK--WSGVQCSNRT--GHVIMLNLKYKVDPVCPNRPLRG--NIN   75 (243)
Q Consensus         2 ~~~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~~~~~~--~~~~~c~~~~--~~l~~L~l~~~~~~~~~~~~~~~--~~~   75 (243)
                      .|.++|++||++||+++++|. .+.+|.   .+.+||.  |.||.|....  ++|++|++++        +.+.+  .+|
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~-~l~~W~---~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~--------~~l~~~~~~~   69 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG--------LNLPKPYPIP   69 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEEC--------CCCSSCEECC
T ss_pred             CCCHHHHHHHHHHHHhcCCcc-cccCCC---CCCCCCcCCCcceEeCCCCCCceEEEEECCC--------CCccCCcccC
Confidence            589999999999999998876 678998   5778998  9999997644  7999999999        47787  788


Q ss_pred             hhhccCCCCcEEEccC-CCCCCCCcchhhcCCCCCcEEecCCccccccCCcCCCCCCCCcEEEccCCccccCCccccCCC
Q 044082           76 SSLLELQHLNYLDLSV-NDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHL  154 (243)
Q Consensus        76 ~~~~~l~~L~~L~l~~-n~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l  154 (243)
                      ..++++++|++|++++ |.+.+. +|..+..+++|++|++++|.+.+..|..+..+++|++|++++|.+++..|..+..+
T Consensus        70 ~~l~~l~~L~~L~L~~~n~l~~~-~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l  148 (313)
T 1ogq_A           70 SSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSL  148 (313)
T ss_dssp             GGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGC
T ss_pred             hhHhCCCCCCeeeCCCCCccccc-CChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcC
Confidence            8888888888888884 777776 78888888888888888888887788888888888888888888887777778888


Q ss_pred             CCCCEEEcCCccccCC-cchHHHhhccc-cccccccccccCCCCCCCCcccccCCCCCcEEECCCCccccccchhHHhhh
Q 044082          155 NKLTQLDLDFVDLSEA-SDWLQVITSLA-SLRDLYLASSTLPSINRPSLSSMNSSTSLALLDLSSCGLSNSAYHWLFKIS  232 (243)
Q Consensus       155 ~~L~~L~l~~n~l~~~-~~~~~~~~~l~-~L~~L~l~~n~~~~~~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~l~~l~  232 (243)
                      ++|++|++++|.+.+. |.   .+..++ +|++|++++|.+++..+  ..+..+ + |+.|++++|.+++..|..+..++
T Consensus       149 ~~L~~L~L~~N~l~~~~p~---~l~~l~~~L~~L~L~~N~l~~~~~--~~~~~l-~-L~~L~Ls~N~l~~~~~~~~~~l~  221 (313)
T 1ogq_A          149 PNLVGITFDGNRISGAIPD---SYGSFSKLFTSMTISRNRLTGKIP--PTFANL-N-LAFVDLSRNMLEGDASVLFGSDK  221 (313)
T ss_dssp             TTCCEEECCSSCCEEECCG---GGGCCCTTCCEEECCSSEEEEECC--GGGGGC-C-CSEEECCSSEEEECCGGGCCTTS
T ss_pred             CCCCeEECcCCcccCcCCH---HHhhhhhcCcEEECcCCeeeccCC--hHHhCC-c-ccEEECcCCcccCcCCHHHhcCC
Confidence            8888888888888743 43   666666 77777777777776555  444444 4 66666666666655565566665


Q ss_pred             ccCceeeCCCC
Q 044082          233 SNLLALDLNSN  243 (243)
Q Consensus       233 ~~L~~L~l~~N  243 (243)
                      + |++|++++|
T Consensus       222 ~-L~~L~L~~N  231 (313)
T 1ogq_A          222 N-TQKIHLAKN  231 (313)
T ss_dssp             C-CSEEECCSS
T ss_pred             C-CCEEECCCC
Confidence            5 666666554



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 56.3 bits (134), Expect = 5e-10
 Identities = 56/170 (32%), Positives = 79/170 (46%), Gaps = 14/170 (8%)

Query: 3   CIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCC--KWSGVQCSN--RTGHVIMLNLK 58
           C  +++QALL  K+ L +    LSSW       DCC   W GV C    +T  V  L+L 
Sbjct: 3   CNPQDKQALLQIKKDLGNP-TTLSSWLPTT---DCCNRTWLGVLCDTDTQTYRVNNLDLS 58

Query: 59  YKVDPVCPNRPLRGNINSSLLELQHLNYLDLSVNDFLGNPIPEFIGFFTKLRFLDLSLAN 118
                   N P    I SSL  L +LN+L +   + L  PIP  I   T+L +L ++  N
Sbjct: 59  GL------NLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTN 112

Query: 119 FSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLNKLTQLDLDFVDLS 168
            SG IP  L  +  L +L+  YN+L  +    +S L  L  +  D   +S
Sbjct: 113 VSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRIS 162


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.64
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.6
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.15
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.0
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.93
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.8
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.69
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.58
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.95
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.69
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.55
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=4.1e-34  Score=232.90  Aligned_cols=223  Identities=31%  Similarity=0.399  Sum_probs=157.6

Q ss_pred             CCHHHHHHHHHhhhcccCCCCCCCCCCCCCCCCCCc--ccceEEecCCC--CceEEEecCCCCCCCCCCCCccc--ccch
Q 044082            3 CIEKERQALLMFKQGLVDDCGYLSSWGSDEGRKDCC--KWSGVQCSNRT--GHVIMLNLKYKVDPVCPNRPLRG--NINS   76 (243)
Q Consensus         3 ~~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~~~~~--~~~~~~c~~~~--~~l~~L~l~~~~~~~~~~~~~~~--~~~~   76 (243)
                      |.++|++||++||+++.+|. .+++|.   .+.+||  .|.||+|+...  .+|+.|||++        +.+.|  .+|+
T Consensus         3 c~~~e~~aLl~~k~~~~~~~-~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~--------~~l~g~~~lp~   70 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG--------LNLPKPYPIPS   70 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEEC--------CCCSSCEECCG
T ss_pred             CCHHHHHHHHHHHHHCCCCC-cCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCC--------CCCCCCCCCCh
Confidence            89999999999999997775 578998   578999  59999998644  4899999999        47776  4788


Q ss_pred             hhccCCCCcEEEccC-CCCCCCCcchhhcCCCCCcEEecCCccccccCCcCCCCCCCCcEEEccCCccccCCccccCCCC
Q 044082           77 SLLELQHLNYLDLSV-NDFLGNPIPEFIGFFTKLRFLDLSLANFSGRIPYQLGNLTNLQSLNLGYNSLYVSKFGWLSHLN  155 (243)
Q Consensus        77 ~~~~l~~L~~L~l~~-n~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~  155 (243)
                      .++++++|++|++++ |.+++. +|+.++.+++|++|++++|.+.+..+..+..+..|++++++.|.+....|..+..++
T Consensus        71 ~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~  149 (313)
T d1ogqa_          71 SLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLP  149 (313)
T ss_dssp             GGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCT
T ss_pred             HHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCc
Confidence            899999999999986 778876 888899999999999998888766666666677777777777776666666666666


Q ss_pred             CCCEEEcCCccccCC-cch---------------------------------------------HHHhhccccccccccc
Q 044082          156 KLTQLDLDFVDLSEA-SDW---------------------------------------------LQVITSLASLRDLYLA  189 (243)
Q Consensus       156 ~L~~L~l~~n~l~~~-~~~---------------------------------------------~~~~~~l~~L~~L~l~  189 (243)
                      .++++++++|.+.+. |..                                             +..+..+++++.++++
T Consensus       150 ~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~  229 (313)
T d1ogqa_         150 NLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLA  229 (313)
T ss_dssp             TCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECC
T ss_pred             ccceeecccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            666666666665432 220                                             1111122223333333


Q ss_pred             cccCCCCCCCCcccccCCCCCcEEECCCCccccccchhHHhhhccCceeeCCCC
Q 044082          190 SSTLPSINRPSLSSMNSSTSLALLDLSSCGLSNSAYHWLFKISSNLLALDLNSN  243 (243)
Q Consensus       190 ~n~~~~~~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~l~~l~~~L~~L~l~~N  243 (243)
                      +|.+.+.++   .+... ++|+.|++++|+++|.+|++++++++ |++|++++|
T Consensus       230 ~~~l~~~~~---~~~~~-~~L~~L~Ls~N~l~g~iP~~l~~L~~-L~~L~Ls~N  278 (313)
T d1ogqa_         230 KNSLAFDLG---KVGLS-KNLNGLDLRNNRIYGTLPQGLTQLKF-LHSLNVSFN  278 (313)
T ss_dssp             SSEECCBGG---GCCCC-TTCCEEECCSSCCEECCCGGGGGCTT-CCEEECCSS
T ss_pred             ccccccccc---ccccc-cccccccCccCeecccCChHHhCCCC-CCEEECcCC
Confidence            333322221   23333 67777777777777777777777776 777777765



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure