Citrus Sinensis ID: 044123

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MGRIHAARSSILKDCLDGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSDKYEESASEFPHL
ccEEEEcccHHHHHHHccccccccccccEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHHHccHHHHHHHHHcccc
cccEEEcccHHHHHHHccHHHHcccccEEEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccc
MGRIHAARSSILKdcldgkllpisstggmttmeVAEEGEVLKALVDFLytgslpreklQKHVVGLFAAGDNYEIEYLREVCLhhmpasfqssnardfqssnaIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSdkyeesasefphl
mgrihaarssilkdcldgkllpISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSDkyeesasefphl
MGRIHAARSSILKDCLDGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSDKYEESASEFPHL
**********ILKDCLDGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASF*******FQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFS*************
MGRIHAARSSILKDCLD**************MEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSDKYEESASEFPH*
********SSILKDCLDGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSD************
**R*HAARSSILKDCLDGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSDKYEESASEFPHL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRIHAARSSILKDCLDGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSDKYEESASEFPHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q9LYL9282 BTB/POZ domain-containing yes no 0.898 0.471 0.356 2e-16
Q9LQ95207 BTB/POZ domain-containing no no 0.885 0.632 0.349 3e-12
Q9SJ29215 Putative BTB/POZ domain-c no no 0.898 0.618 0.333 3e-11
O22891165 Putative BTB/POZ domain-c no no 0.662 0.593 0.352 2e-08
O81432192 Putative BTB/POZ domain-c no no 0.608 0.468 0.361 6e-07
O22890209 Putative BTB/POZ domain-c no no 0.5 0.354 0.397 1e-05
Q717B2364 TD and POZ domain-contain yes no 0.689 0.280 0.263 2e-05
Q7T330374 Speckle-type POZ protein no no 0.689 0.272 0.276 7e-05
Q9XHZ8326 BTB/POZ domain-containing no no 0.527 0.239 0.298 0.0002
Q5NVK7374 Speckle-type POZ protein yes no 0.689 0.272 0.267 0.0002
>sp|Q9LYL9|Y3623_ARATH BTB/POZ domain-containing protein At3g56230 OS=Arabidopsis thaliana GN=At3g56230 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 83/143 (58%), Gaps = 10/143 (6%)

Query: 6   AARSSILKDCLDGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGL 65
           A++S I K+ LD      +    +T  E+    E L+AL++FLYTG+L  +KL+K+V  L
Sbjct: 132 ASKSEIFKNILDSDGCKTAPEYAITLQEL--NSEQLQALLEFLYTGTLASDKLEKNVYAL 189

Query: 66  FAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFI 125
           F A D Y I YL+E+C  +M +S   S+       N +D   +G +     L++A + F+
Sbjct: 190 FIAADKYMIHYLQELCEQYMLSSLDISSVL-----NVLDVSDLGSS---KTLKEACVGFV 241

Query: 126 VKKVEELVFSDKYEESASEFPHL 148
           V+ ++++VFSDKYE  + +  HL
Sbjct: 242 VRNMDDVVFSDKYEPFSQKNQHL 264
May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LQ95|Y1164_ARATH BTB/POZ domain-containing protein At1g01640 OS=Arabidopsis thaliana GN=At1g01640 PE=1 SV=1 Back     alignment and function description
>sp|Q9SJ29|Y2533_ARATH Putative BTB/POZ domain-containing protein At2g05330 OS=Arabidopsis thaliana GN=At2g05330 PE=3 SV=1 Back     alignment and function description
>sp|O22891|Y2044_ARATH Putative BTB/POZ domain-containing protein At2g40440 OS=Arabidopsis thaliana GN=At2g40440 PE=3 SV=2 Back     alignment and function description
>sp|O81432|Y4409_ARATH Putative BTB/POZ domain-containing protein At4g04090 OS=Arabidopsis thaliana GN=At4g04090 PE=3 SV=1 Back     alignment and function description
>sp|O22890|Y2045_ARATH Putative BTB/POZ domain-containing protein At2g40450 OS=Arabidopsis thaliana GN=At2g40450 PE=3 SV=1 Back     alignment and function description
>sp|Q717B2|TDPZ2_MOUSE TD and POZ domain-containing protein 2 OS=Mus musculus GN=Tdpoz2 PE=2 SV=2 Back     alignment and function description
>sp|Q7T330|SPOP_DANRE Speckle-type POZ protein OS=Danio rerio GN=spop PE=2 SV=1 Back     alignment and function description
>sp|Q9XHZ8|Y1178_ARATH BTB/POZ domain-containing protein At1g21780 OS=Arabidopsis thaliana GN=At1g21780 PE=1 SV=1 Back     alignment and function description
>sp|Q5NVK7|SPOP_PONAB Speckle-type POZ protein OS=Pongo abelii GN=SPOP PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
224128746189 predicted protein [Populus trichocarpa] 0.898 0.703 0.419 9e-20
449441572 266 PREDICTED: BTB/POZ domain-containing pro 0.885 0.492 0.383 2e-15
297820382 276 hypothetical protein ARALYDRAFT_348708 [ 0.898 0.481 0.363 6e-15
297736526 281 unnamed protein product [Vitis vinifera] 0.898 0.473 0.384 9e-15
359486352 270 PREDICTED: BTB/POZ domain-containing pro 0.898 0.492 0.384 9e-15
15228868 282 BTB/POZ domain-containing protein [Arabi 0.898 0.471 0.356 2e-14
255559613 267 protein binding protein, putative [Ricin 0.898 0.498 0.377 9e-13
15223447207 BTB/POZ domain-containing protein [Arabi 0.885 0.632 0.349 2e-10
294462007 313 unknown [Picea sitchensis] 0.851 0.402 0.279 2e-10
33589788207 At3g01790 [Arabidopsis thaliana] gi|1107 0.885 0.632 0.342 4e-10
>gi|224128746|ref|XP_002328956.1| predicted protein [Populus trichocarpa] gi|222839190|gb|EEE77541.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 81/143 (56%), Gaps = 10/143 (6%)

Query: 6   AARSSILKDCLDGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGL 65
           AARS I K+ LD       ++  +   E+  +   L++L++FLY+G+LP EKL+KHV  L
Sbjct: 44  AARSEIFKNMLDSDAYKAPASDTIMLPELNHQE--LESLLEFLYSGNLPSEKLEKHVYSL 101

Query: 66  FAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFI 125
             A D Y+I YL + C  HM         R   SSNA+D L I        L++ ALNFI
Sbjct: 102 TLAADKYDIPYLLKFCERHM--------LRFLNSSNALDVLEISDTCSNKTLKETALNFI 153

Query: 126 VKKVEELVFSDKYEESASEFPHL 148
           VK +E++VFS KYE    E PHL
Sbjct: 154 VKNMEDVVFSTKYEAFVPENPHL 176

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449441572|ref|XP_004138556.1| PREDICTED: BTB/POZ domain-containing protein At3g56230-like [Cucumis sativus] gi|449499220|ref|XP_004160755.1| PREDICTED: BTB/POZ domain-containing protein At3g56230-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297820382|ref|XP_002878074.1| hypothetical protein ARALYDRAFT_348708 [Arabidopsis lyrata subsp. lyrata] gi|297323912|gb|EFH54333.1| hypothetical protein ARALYDRAFT_348708 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297736526|emb|CBI25397.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486352|ref|XP_003633433.1| PREDICTED: BTB/POZ domain-containing protein At3g56230-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|15228868|ref|NP_191182.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|75264422|sp|Q9LYL9.1|Y3623_ARATH RecName: Full=BTB/POZ domain-containing protein At3g56230 gi|7572921|emb|CAB87422.1| putative protein [Arabidopsis thaliana] gi|45825155|gb|AAS77485.1| At3g56230 [Arabidopsis thaliana] gi|51970740|dbj|BAD44062.1| putative protein [Arabidopsis thaliana] gi|332645978|gb|AEE79499.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255559613|ref|XP_002520826.1| protein binding protein, putative [Ricinus communis] gi|223539957|gb|EEF41535.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15223447|ref|NP_171670.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|30678163|ref|NP_849574.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|75311457|sp|Q9LQ95.1|Y1164_ARATH RecName: Full=BTB/POZ domain-containing protein At1g01640 gi|8671833|gb|AAF78396.1|AC009273_2 Contains similarity to the speckle-type POZ protein from Homo sapiens gb|AJ000644. It contains a BTB/POZ domain PF|00651 [Arabidopsis thaliana] gi|332189194|gb|AEE27315.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|332189195|gb|AEE27316.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|294462007|gb|ADE76559.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|33589788|gb|AAQ22660.1| At3g01790 [Arabidopsis thaliana] gi|110739209|dbj|BAF01519.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2078421282 AT3G56230 [Arabidopsis thalian 0.898 0.471 0.356 1.6e-17
TAIR|locus:2198140207 AT1G01640 [Arabidopsis thalian 0.885 0.632 0.349 2.1e-13
TAIR|locus:2051294215 AT2G05330 [Arabidopsis thalian 0.885 0.609 0.337 7.1e-13
TAIR|locus:2061873209 AT2G40450 [Arabidopsis thalian 0.898 0.636 0.303 3.5e-11
TAIR|locus:2136622192 AT4G04090 [Arabidopsis thalian 0.608 0.468 0.361 1.6e-08
TAIR|locus:2166066224 AT5G48510 [Arabidopsis thalian 0.918 0.607 0.258 3.4e-07
ZFIN|ZDB-GENE-040426-1378374 spop "speckle-type POZ protein 0.689 0.272 0.267 8.5e-06
FB|FBgn0032485 627 CG9426 [Drosophila melanogaste 0.641 0.151 0.276 2.3e-05
RGD|1311613335 Spop "speckle-type POZ protein 0.689 0.304 0.267 3.8e-05
UNIPROTKB|E1C049374 SPOP "Uncharacterized protein" 0.689 0.272 0.267 4.6e-05
TAIR|locus:2078421 AT3G56230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 1.6e-17, P = 1.6e-17
 Identities = 51/143 (35%), Positives = 83/143 (58%)

Query:     6 AARSSILKDCLDGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGL 65
             A++S I K+ LD      +    +T  E+    E L+AL++FLYTG+L  +KL+K+V  L
Sbjct:   132 ASKSEIFKNILDSDGCKTAPEYAITLQEL--NSEQLQALLEFLYTGTLASDKLEKNVYAL 189

Query:    66 FAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFI 125
             F A D Y I YL+E+C  +M +S   S+       N +D   +G +     L++A + F+
Sbjct:   190 FIAADKYMIHYLQELCEQYMLSSLDISSVL-----NVLDVSDLGSS---KTLKEACVGFV 241

Query:   126 VKKVEELVFSDKYEESASEFPHL 148
             V+ ++++VFSDKYE  + +  HL
Sbjct:   242 VRNMDDVVFSDKYEPFSQKNQHL 264
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2198140 AT1G01640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051294 AT2G05330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061873 AT2G40450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136622 AT4G04090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166066 AT5G48510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1378 spop "speckle-type POZ protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0032485 CG9426 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1311613 Spop "speckle-type POZ protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C049 SPOP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.87.106.1
hypothetical protein (189 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 5e-05
pfam00651101 pfam00651, BTB, BTB/POZ domain 6e-04
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information 
 Score = 41.7 bits (98), Expect = 5e-05
 Identities = 21/99 (21%), Positives = 46/99 (46%), Gaps = 11/99 (11%)

Query: 39  EVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASFQSSNARDFQ 98
           +    ++ ++YTG +       +V  + +  +   I++L  +C++++          D  
Sbjct: 57  DSFNEVIKYIYTGKI--NITSNNVKDILSIANYLIIDFLINLCINYI-----IKIIDD-- 107

Query: 99  SSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSDK 137
            +N ID  R  + Y   +L  AA N+I   + EL+++D 
Sbjct: 108 -NNCIDIYRFSFFYGCKKLYSAAYNYIRNNI-ELIYNDP 144

Length = 534
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
PHA02790 480 Kelch-like protein; Provisional 99.95
PHA02713 557 hypothetical protein; Provisional 99.94
KOG4441 571 consensus Proteins containing BTB/POZ and Kelch do 99.93
PHA03098 534 kelch-like protein; Provisional 99.93
KOG4350 620 consensus Uncharacterized conserved protein, conta 99.86
KOG2075 521 consensus Topoisomerase TOP1-interacting protein B 99.7
KOG4591280 consensus Uncharacterized conserved protein, conta 99.69
KOG4682 488 consensus Uncharacterized conserved protein, conta 99.67
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.61
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.6
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.54
KOG0511516 consensus Ankyrin repeat protein [General function 98.87
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 98.41
KOG2838401 consensus Uncharacterized conserved protein, conta 98.12
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 98.03
KOG2716230 consensus Polymerase delta-interacting protein PDI 97.87
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 97.56
KOG3473112 consensus RNA polymerase II transcription elongati 97.53
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.68
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 96.6
KOG0783 1267 consensus Uncharacterized conserved protein, conta 96.56
KOG1724162 consensus SCF ubiquitin ligase, Skp1 component [Po 96.35
KOG1665 302 consensus AFH1-interacting protein FIP2, contains 95.7
KOG2838 401 consensus Uncharacterized conserved protein, conta 95.67
KOG1778 319 consensus CREB binding protein/P300 and related TA 95.56
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 95.29
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 94.87
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 93.82
KOG2714 465 consensus SETA binding protein SB1 and related pro 93.78
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 93.47
KOG2075 521 consensus Topoisomerase TOP1-interacting protein B 82.83
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 81.85
KOG2715210 consensus Uncharacterized conserved protein, conta 80.99
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information 
Probab=99.95  E-value=1.6e-28  Score=195.13  Aligned_cols=127  Identities=20%  Similarity=0.295  Sum_probs=118.6

Q ss_pred             CceeecCCHHHHHhh-cCCCCCCCCCCCeee--cccCCcHHHHHHHHHHHhCCCCCchhhHHHHHHHHHhccccchHHHH
Q 044123            2 GRIHAARSSILKDCL-DGKLLPISSTGGMTT--MEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLR   78 (148)
Q Consensus         2 ~~vLaa~S~~F~~~f-~~~~e~~~~~~~i~l--~~~~~~~~~~~~~l~yiYtg~~~~~~~~~~~~~ll~~A~~~~i~~L~   78 (148)
                      .+||||.|+||++|| ++++|+++   +|.+  .+++  +++++.+|+|+|||++.+  +.+++.+++.+|+.++++.++
T Consensus        37 R~VLAa~S~YFraMF~~~~~Es~~---~v~~~~~~v~--~~~l~~lldy~YTg~l~i--t~~nV~~ll~aA~~Lqi~~v~  109 (480)
T PHA02790         37 STILKKLSPYFRTHLRQKYTKNKD---PVTRVCLDLD--IHSLTSIVIYSYTGKVYI--DSHNVVNLLRASILTSVEFII  109 (480)
T ss_pred             hhhhhhcCHHHHHHhcCCcccccc---ceEEEecCcC--HHHHHHHHHhheeeeEEE--ecccHHHHHHHHHHhChHHHH
Confidence            379999999999999 99999954   3554  3899  999999999999999999  999999999999999999999


Q ss_pred             HHHHhhhchhcccccccccchhhHHHHHHHhhcCChHHHHHHHHHHHHHchHHhhcc--hhHHHHHh
Q 044123           79 EVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFS--DKYEESAS  143 (148)
Q Consensus        79 ~~c~~~l~~~l~~~n~~~~~~~~~~~~~~~a~~~~~~~L~~~~~~~i~~~~~~~~~~--~~f~~l~~  143 (148)
                      +.|++||.++++++|        |++++.+|+.|++.+|.+.+.+||.+||.++.++  ++|.+|+.
T Consensus       110 ~~C~~fL~~~l~~~N--------Cl~i~~~A~~y~~~~L~~~a~~fi~~nF~~v~~~~~~ef~~L~~  168 (480)
T PHA02790        110 YTCINFILRDFRKEY--------CVECYMMGIEYGLSNLLCHTKDFIAKHFLELEDDIIDNFDYLSM  168 (480)
T ss_pred             HHHHHHHHhhCCcch--------HHHHHHHHHHhCHHHHHHHHHHHHHHhHHHHhcccchhhhhCCH
Confidence            999999999999999        9999999999999999999999999999999986  89988653

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG1778 consensus CREB binding protein/P300 and related TAZ Zn-finger proteins [Transcription] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG2715 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3hqi_A312 Structures Of Spop-Substrate Complexes: Insights In 2e-04
>pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 Back     alignment and structure 
Iteration: 1

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 10/89 (11%)
Query: 37  EGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVCLHHMPASFQSSNARD 96
           E EV K ++ F+YTG  P   L K    L AA D Y +E L+ +C        + +   +
Sbjct: 222 EPEVFKEMMCFIYTGKAPN--LDKMADDLLAAADKYALERLKVMC--------EDALCSN 271
Query: 97  FQSSNAIDFLRIGYNYQLDELRDAALNFI 125
               NA + L +   +  D+L+  A++FI
Sbjct: 272 LSVENAAEILILADLHSADQLKTQAVDFI 300

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 1e-13
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 2e-11
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 1e-08
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 3e-08
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 4e-08
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 2e-06
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
 Score = 63.4 bits (155), Expect = 1e-13
 Identities = 32/132 (24%), Positives = 58/132 (43%), Gaps = 15/132 (11%)

Query: 6   AARSSILKDCLDGKLLPISSTGGMTTMEVAE-EGEVLKALVDFLYTGSLPREKLQKHVVG 64
           AARS +     + ++           +E+ + E EV K ++ F+YTG  P   L K    
Sbjct: 54  AARSPVFSAMFEHEM----EESKKNRVEINDVEPEVFKEMMCFIYTGKAP--NLDKMADD 107

Query: 65  LFAAGDNYEIEYLREVCLHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNF 124
           L AA D Y +E L+ +C   +          +    NA + L +   +  D+L+  A++F
Sbjct: 108 LLAAADKYALERLKVMCEDAL--------CSNLSVENAAEILILADLHSADQLKTQAVDF 159

Query: 125 IVKKVEELVFSD 136
           I     +++ + 
Sbjct: 160 INYHATDVLETS 171
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.95
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.95
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.94
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.94
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.89
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.82
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.81
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.8
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.8
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.8
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.78
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.78
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.76
2vpk_A116 Myoneurin; transcription regulation, transcription 99.76
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.72
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.71
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.71
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.69
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.62
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.61
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.45
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 99.06
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.04
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.9
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 98.73
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.35
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.14
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.11
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.73
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 97.68
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 96.27
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 91.18
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 91.15
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 90.33
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 86.96
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 86.45
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 85.62
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 85.53
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 85.25
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 82.66
2vpk_A116 Myoneurin; transcription regulation, transcription 81.48
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 81.34
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 81.33
3b84_A119 Zinc finger and BTB domain-containing protein 48; 80.6
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=2e-28  Score=169.26  Aligned_cols=121  Identities=26%  Similarity=0.404  Sum_probs=109.8

Q ss_pred             ceeecCCHHHHHhh-cCCCCCCCCCCCeeecccCCcHHHHHHHHHHHhCCCCCchhhHHHHHHHHHhccccchHHHHHHH
Q 044123            3 RIHAARSSILKDCL-DGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVC   81 (148)
Q Consensus         3 ~vLaa~S~~F~~~f-~~~~e~~~~~~~i~l~~~~~~~~~~~~~l~yiYtg~~~~~~~~~~~~~ll~~A~~~~i~~L~~~c   81 (148)
                      +||+++|+||++|| ++|+|+..  ..|.+++++  +++|+.+|+|+|||+++.  +.+++.+++.+|++|+++.|++.|
T Consensus        51 ~iL~~~S~~F~~~f~~~~~e~~~--~~i~l~~~~--~~~f~~~l~~~Yt~~~~~--~~~~~~~ll~~A~~~~~~~l~~~c  124 (172)
T 3htm_A           51 AILAARSPVFSAMFEHEMEESKK--NRVEINDVE--PEVFKEMMCFIYTGKAPN--LDKMADDLLAAADKYALERLKVMC  124 (172)
T ss_dssp             HHHHHHCHHHHHHHHSCCCGGGT--TEEEECSSC--HHHHHHHHHHHHHSCCTT--GGGTHHHHHHHHHHTTCHHHHHHH
T ss_pred             HHHHHcCHHHHHHHccCccccCC--CeEEecCCC--HHHHHHHHHHHhCCCCCC--cHHHHHHHHHHHHHhCcHHHHHHH
Confidence            58999999999999 99999987  889999999  999999999999999988  889999999999999999999999


Q ss_pred             HhhhchhcccccccccchhhHHHHHHHhhcCChHHHHHHHHHHHHHchHHhhcchh
Q 044123           82 LHHMPASFQSSNARDFQSSNAIDFLRIGYNYQLDELRDAALNFIVKKVEELVFSDK  137 (148)
Q Consensus        82 ~~~l~~~l~~~n~~~~~~~~~~~~~~~a~~~~~~~L~~~~~~~i~~~~~~~~~~~~  137 (148)
                      +++|.+.++.+|        |+.++.+|..|+++.|++.|.+||.+||.++..+++
T Consensus       125 ~~~l~~~l~~~n--------~~~~~~~A~~~~~~~L~~~~~~~i~~~~~~v~~s~~  172 (172)
T 3htm_A          125 EDALCSNLSVEN--------AAEILILADLHSADQLKTQAVDFINYHATDVLETSG  172 (172)
T ss_dssp             HHHHHHTCCTTT--------HHHHHHHHHHTTCHHHHHHHHHHHHHTC--------
T ss_pred             HHHHHHhCCHHH--------HHHHHHHHHHhCcHHHHHHHHHHHHHHHHHHHcCCC
Confidence            999999999999        999999999999999999999999999999988764
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.78
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.74
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.57
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.51
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 95.4
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 94.66
d3kvta_103 akv3.1 voltage-gated potassium channel {California 91.93
d1t1da_100 Shaker potassium channel {California sea hare (Apl 91.89
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 91.54
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 91.26
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 87.08
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 85.82
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 80.43
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.78  E-value=2.9e-20  Score=120.40  Aligned_cols=79  Identities=20%  Similarity=0.268  Sum_probs=73.0

Q ss_pred             ceeecCCHHHHHhh-cCCCCCCCCCCCeeecccCCcHHHHHHHHHHHhCCCCCchhhHHHHHHHHHhccccchHHHHHHH
Q 044123            3 RIHAARSSILKDCL-DGKLLPISSTGGMTTMEVAEEGEVLKALVDFLYTGSLPREKLQKHVVGLFAAGDNYEIEYLREVC   81 (148)
Q Consensus         3 ~vLaa~S~~F~~~f-~~~~e~~~~~~~i~l~~~~~~~~~~~~~l~yiYtg~~~~~~~~~~~~~ll~~A~~~~i~~L~~~c   81 (148)
                      +||+++|+||++|| +++.|+..  ..+.+++++  +++|+.+++|+|||++.+  +.+++.+++.+|++|+++.|++.|
T Consensus        42 ~vLa~~S~~F~~~f~~~~~e~~~--~~~~~~~v~--~~~f~~ll~~~Ytg~~~i--~~~~v~~ll~~A~~l~i~~L~~~C  115 (122)
T d1r29a_          42 TVLMACSGLFYSIFTDQLKRNLS--VINLDPEIN--PEGFNILLDFMYTSRLNL--REGNIMAVMATAMYLQMEHVVDTC  115 (122)
T ss_dssp             HHHHHHCHHHHHHHTSTTTTTCS--EEECCTTSC--HHHHHHHHHHHHHSCCCC--CTTTHHHHHHHHHHTTCHHHHHHH
T ss_pred             HHhhhCCHHHHHHhccchhhhcc--eeeeecccC--HHHHHHHHhhhcCCeecC--chhhHHHHHHHHHHHCcHHHHHHH
Confidence            68999999999999 99998876  666678899  999999999999999988  888999999999999999999999


Q ss_pred             Hhhhch
Q 044123           82 LHHMPA   87 (148)
Q Consensus        82 ~~~l~~   87 (148)
                      .++|.+
T Consensus       116 ~~~L~~  121 (122)
T d1r29a_         116 RKFIKA  121 (122)
T ss_dssp             HHHHHT
T ss_pred             HHHHHh
Confidence            999865
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure