Citrus Sinensis ID: 044140

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MGDQTKPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQGSAGSAHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMPKSKH
cccccccEEEEEEcccHHHHHHHHHHHHHcccccccccccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHHccccEEEEcccccccccHHHcccHHHHHHccccccEEEEccccccc
cccccccEEEEEEcccHHHHHHHHHHHHHHccccccccccEEEEEEEccccccHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHccccEEEEcccccHHHHHHHHccHHHHHHccccccEEEEEcccccc
mgdqtkpiMMVAIDDSNHSYYALEWAldyffppfapnhtFQLVLIharpnppsllglsgagqgsagsaHVINLVELDTKKRAQKVADKATSIcakrevndmpvhvmqgdprnvMTEAVERFHPTILVlgshgygaVKRAVLgsvsdysahhcSCTVMivkmpkskh
MGDQTKPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQGSAGSAHVINLVELDTKKRAQKVADKatsicakrevndmpvhvMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTvmivkmpkskh
MGDQTKPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPsllglsgagqgsagsaHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMPKSKH
*******IMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARP******************AHVINLVELDT**********ATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVK******
****TKPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQGSAGSAHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTV***KM*****
MGDQTKPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGL********GSAHVINLVELDTKK********ATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMPKSKH
*****KPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQGSAGSAHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDQTKPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQGSAGSAHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMPKSKH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
Q8LGG8175 Universal stress protein no no 0.337 0.32 0.375 7e-07
P42297148 Universal stress protein yes no 0.843 0.945 0.262 6e-05
P74148154 Universal stress protein N/A no 0.855 0.922 0.246 0.0001
Q57951170 Universal stress protein yes no 0.373 0.364 0.306 0.0003
>sp|Q8LGG8|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2 Back     alignment and function desciption
 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 105 VMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVK 160
           +  GDP++V+ + V+R  P  LV+GS G G  ++  +G+VS +   H  C VM +K
Sbjct: 107 IKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIK 162

Arabidopsis thaliana (taxid: 3702)
>sp|P42297|YXIE_BACSU Universal stress protein YxiE OS=Bacillus subtilis (strain 168) GN=yxiE PE=3 SV=1 Back     alignment and function description
>sp|P74148|Y1388_SYNY3 Universal stress protein Sll1388 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1388 PE=3 SV=1 Back     alignment and function description
>sp|Q57951|Y531_METJA Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0531 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
194466125181 universal stress protein [Arachis hypoga 0.951 0.872 0.583 4e-48
359480262161 PREDICTED: universal stress protein MJ05 0.969 1.0 0.560 2e-47
357442527167 Universal stress protein [Medicago trunc 0.957 0.952 0.564 1e-46
255564142161 conserved hypothetical protein [Ricinus 0.969 1.0 0.542 3e-46
357442529164 Universal stress protein [Medicago trunc 0.939 0.951 0.552 6e-46
388507360165 unknown [Lotus japonicus] 0.951 0.957 0.546 8e-45
312281613162 unnamed protein product [Thellungiella h 0.945 0.969 0.512 1e-43
18407428162 adenine nucleotide alpha hydrolases-like 0.933 0.956 0.531 2e-43
297828493162 universal stress protein family protein 0.951 0.975 0.524 2e-43
449436499162 PREDICTED: universal stress protein MJ05 0.969 0.993 0.526 5e-43
>gi|194466125|gb|ACF74293.1| universal stress protein [Arachis hypogaea] Back     alignment and taxonomy information
 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 122/161 (75%), Gaps = 3/161 (1%)

Query: 6   KPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQGSA 65
           K +M+VA+DDS HS YAL+W LD+FF    PN  F+LVL+HA+P+  S +GL  AG   A
Sbjct: 9   KQVMIVAVDDSEHSSYALQWTLDHFFTTL-PNPIFKLVLLHAKPSATSAVGL--AGPAYA 65

Query: 66  GSAHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTI 125
           G+A V+ +V+ D KK A +V D A  IC+KR V D+   V++GDPRNV+ +AVE++H +I
Sbjct: 66  GAAEVLPIVDSDLKKIAARVVDNAKQICSKRSVTDVITEVVEGDPRNVLCDAVEKYHASI 125

Query: 126 LVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMPKSKH 166
           LV+GSHGYGA+KRAVLG+VSDY AHH  CTVMIVK PK+KH
Sbjct: 126 LVVGSHGYGAIKRAVLGNVSDYCAHHAHCTVMIVKRPKTKH 166

Source: Arachis hypogaea

Species: Arachis hypogaea

Genus: Arachis

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359480262|ref|XP_002265742.2| PREDICTED: universal stress protein MJ0531-like isoform 2 [Vitis vinifera] gi|297743874|emb|CBI36844.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357442527|ref|XP_003591541.1| Universal stress protein [Medicago truncatula] gi|355480589|gb|AES61792.1| Universal stress protein [Medicago truncatula] gi|388517911|gb|AFK47017.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255564142|ref|XP_002523068.1| conserved hypothetical protein [Ricinus communis] gi|223537630|gb|EEF39253.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357442529|ref|XP_003591542.1| Universal stress protein [Medicago truncatula] gi|355480590|gb|AES61793.1| Universal stress protein [Medicago truncatula] gi|388501996|gb|AFK39064.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388507360|gb|AFK41746.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|312281613|dbj|BAJ33672.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|18407428|ref|NP_566108.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] gi|3738285|gb|AAC63627.1| expressed protein [Arabidopsis thaliana] gi|15451080|gb|AAK96811.1| Unknown protein [Arabidopsis thaliana] gi|20148413|gb|AAM10097.1| unknown protein [Arabidopsis thaliana] gi|330255785|gb|AEC10879.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297828493|ref|XP_002882129.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297327968|gb|EFH58388.1| universal stress protein family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449436499|ref|XP_004136030.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus] gi|449532390|ref|XP_004173164.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
TAIR|locus:2043273162 AT2G47710 "AT2G47710" [Arabido 0.951 0.975 0.493 4.8e-39
TAIR|locus:2154369150 AT5G49050 "AT5G49050" [Arabido 0.704 0.78 0.401 3.1e-19
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.915 0.745 0.343 3.6e-18
TAIR|locus:2024291171 AT1G09740 "AT1G09740" [Arabido 0.915 0.888 0.331 7.5e-18
TAIR|locus:2199282160 AT1G68300 "AT1G68300" [Arabido 0.921 0.956 0.323 3.7e-16
TAIR|locus:2200036242 AT1G11360 [Arabidopsis thalian 0.487 0.334 0.409 2.2e-15
TAIR|locus:2096089162 AT3G62550 "AT3G62550" [Arabido 0.915 0.938 0.322 2.6e-15
TAIR|locus:2131719260 PHOS34 "AT4G27320" [Arabidopsi 0.493 0.315 0.363 1.9e-13
TAIR|locus:2147319242 PHOS32 "AT5G54430" [Arabidopsi 0.475 0.326 0.352 3.7e-13
TAIR|locus:2086102163 AT3G17020 "AT3G17020" [Arabido 0.403 0.411 0.328 8e-11
TAIR|locus:2043273 AT2G47710 "AT2G47710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 417 (151.9 bits), Expect = 4.8e-39, P = 4.8e-39
 Identities = 81/164 (49%), Positives = 105/164 (64%)

Query:     2 GDQTKPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPXXXXXXXXX 61
             GD  K +M+V +DDS  S YALEW LD FF P+APN+ F+L ++HA+PN           
Sbjct:     4 GDG-KSVMVVGVDDSEQSTYALEWTLDRFFAPYAPNYPFKLFIVHAKPN-----AVSAVG 57

Query:    62 XXXXXXXHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERF 121
                     V+  V+ D K  A KV +KA +IC  R V+   + V +GD RN++ E V++ 
Sbjct:    58 LAGPGTAEVVPYVDADLKHTAAKVVEKAKAICQSRSVHGAVIEVFEGDARNILCEVVDKH 117

Query:   122 HPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMPKSK 165
             H +ILV+GSHGYGA+KRAVLGS SDY AHH  C+VMIVK PK K
Sbjct:   118 HASILVVGSHGYGAIKRAVLGSTSDYCAHHAHCSVMIVKKPKIK 161
GO:0003674 "molecular_function" evidence=ND
GO:0005773 "vacuole" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0002238 "response to molecule of fungal origin" evidence=RCA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2154369 AT5G49050 "AT5G49050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200036 AT1G11360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086102 AT3G17020 "AT3G17020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00027986001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (161 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 6e-21
pfam00582139 pfam00582, Usp, Universal stress protein family 3e-20
COG0589154 COG0589, UspA, Universal stress protein UspA and r 2e-12
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 6e-08
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score = 82.4 bits (204), Expect = 6e-21
 Identities = 39/151 (25%), Positives = 65/151 (43%), Gaps = 22/151 (14%)

Query: 9   MMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQGSAGSA 68
           ++VA+D S  S  AL WA        A     +LVL+H    PP                
Sbjct: 2   ILVAVDGSEESERALRWAAR-----LARRLGAELVLLHVVDPPP---------------- 40

Query: 69  HVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVL 128
                +    ++ A+ + +      A+  V  +   V++GDP   + EA E     ++V+
Sbjct: 41  SSAAELAELLEEEARALLEALREALAEAGVK-VETVVLEGDPAEAILEAAEELGADLIVM 99

Query: 129 GSHGYGAVKRAVLGSVSDYSAHHCSCTVMIV 159
           GS G   ++R +LGSV++    H  C V++V
Sbjct: 100 GSRGRSGLRRLLLGSVAERVLRHAPCPVLVV 130

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
PRK15456142 universal stress protein UspG; Provisional 99.97
PRK15005144 universal stress protein F; Provisional 99.96
PRK09982142 universal stress protein UspD; Provisional 99.96
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.96
PRK15118144 universal stress global response regulator UspA; P 99.95
PRK10116142 universal stress protein UspC; Provisional 99.94
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.94
PRK11175 305 universal stress protein UspE; Provisional 99.94
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.93
cd01987124 USP_OKCHK USP domain is located between the N-term 99.92
PRK11175305 universal stress protein UspE; Provisional 99.89
cd00293130 USP_Like Usp: Universal stress protein family. The 99.88
COG0589154 UspA Universal stress protein UspA and related nuc 99.87
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.71
PRK10490 895 sensor protein KdpD; Provisional 99.47
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.4
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.58
PLN03159 832 cation/H(+) antiporter 15; Provisional 97.99
PLN03159832 cation/H(+) antiporter 15; Provisional 97.58
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.53
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 97.4
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 96.96
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 96.4
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 95.87
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 95.67
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 95.45
PRK03359256 putative electron transfer flavoprotein FixA; Revi 95.43
PRK12342 254 hypothetical protein; Provisional 95.3
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 95.28
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 95.22
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 94.95
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 94.93
PF02441129 Flavoprotein: Flavoprotein; InterPro: IPR003382 Th 94.71
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 94.69
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 94.4
PRK06029185 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Prov 94.39
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 94.15
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 94.14
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 93.99
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 93.78
cd01713173 PAPS_reductase This domain is found in phosphoaden 93.36
TIGR02852187 spore_dpaB dipicolinic acid synthetase, B subunit. 93.36
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 93.15
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 93.15
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 92.86
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 92.85
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 92.64
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 92.27
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 92.27
PRK13820 394 argininosuccinate synthase; Provisional 92.05
PRK08305196 spoVFB dipicolinate synthase subunit B; Reviewed 91.9
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 91.84
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 91.19
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 90.65
PRK10867 433 signal recognition particle protein; Provisional 90.64
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 90.59
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 90.28
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 89.98
COG0452 392 Dfp Phosphopantothenoylcysteine synthetase/decarbo 89.73
TIGR02699174 archaeo_AfpA archaeoflavoprotein AfpA. The prototy 89.7
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 89.2
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 89.16
PF03746242 LamB_YcsF: LamB/YcsF family; InterPro: IPR005501 T 89.16
cd07044309 CofD_YvcK Family of CofD-like proteins and protein 88.66
PRK09590104 celB cellobiose phosphotransferase system IIB comp 88.4
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 87.95
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 87.85
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 87.49
TIGR01826310 CofD_related conserved hypothetical protein, cofD- 86.71
PRK00109138 Holliday junction resolvase-like protein; Reviewed 86.28
TIGR00959 428 ffh signal recognition particle protein. This mode 86.02
PF01933300 UPF0052: Uncharacterised protein family UPF0052; I 85.64
PRK10674 472 deoxyribodipyrimidine photolyase; Provisional 85.61
cd07187308 YvcK_like family of mostly uncharacterized protein 85.03
COG1927 277 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltet 84.93
PF03652135 UPF0081: Uncharacterised protein family (UPF0081); 84.48
TIGR00237 432 xseA exodeoxyribonuclease VII, large subunit. This 84.35
PLN02948577 phosphoribosylaminoimidazole carboxylase 84.33
cd01995169 ExsB ExsB is a transcription regulator related pro 84.27
COG1606 269 ATP-utilizing enzymes of the PP-loop superfamily [ 84.09
PF1316795 GTP-bdg_N: GTP-binding GTPase N-terminal 83.5
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 83.24
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 83.04
cd01714202 ETF_beta The electron transfer flavoprotein (ETF) 82.94
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 82.62
cd07186303 CofD_like LPPG:FO 2-phospho-L-lactate transferase; 82.49
cd08550 349 GlyDH-like Glycerol_dehydrogenase-like. Families o 82.35
COG0415 461 PhrB Deoxyribodipyrimidine photolyase [DNA replica 82.33
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 82.09
PRK11070 575 ssDNA exonuclease RecJ; Provisional 81.56
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 81.36
PRK08185 283 hypothetical protein; Provisional 81.31
PRK05406246 LamB/YcsF family protein; Provisional 81.26
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 80.88
PRK12857 284 fructose-1,6-bisphosphate aldolase; Reviewed 80.5
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 80.41
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 80.27
COG1597 301 LCB5 Sphingosine kinase and enzymes related to euk 80.1
KOG0780 483 consensus Signal recognition particle, subunit Srp 80.1
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.97  E-value=5.6e-29  Score=166.84  Aligned_cols=140  Identities=21%  Similarity=0.227  Sum_probs=112.1

Q ss_pred             CCCEEEEEEcCCh--hHHHHHHHHHHhcCCCCCCCCceEEEEEEeecCCCCCcCCCCCCCCCCCchhhHHHHHHHHHHHH
Q 044140            5 TKPIMMVAIDDSN--HSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQGSAGSAHVINLVELDTKKRA   82 (166)
Q Consensus         5 ~~~~Ilv~vd~s~--~s~~al~~a~~la~~~~~~~~~~~l~lv~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (166)
                      |+++||||+|+|+  .+..++++|..+|+ . .+    +|+++||++...... ...       .......+.+...+..
T Consensus         1 m~~~ILv~vD~S~~~~s~~al~~A~~la~-~-~~----~l~llhv~~~~~~~~-~~~-------~~~~~~~~~~~~~~~~   66 (142)
T PRK15456          1 MYKTIIMPVDVFEMELSDKAVRHAEFLAQ-D-DG----VIHLLHVLPGSASLS-LHR-------FAADVRRFEEHLQHEA   66 (142)
T ss_pred             CCccEEEeccCCchhHHHHHHHHHHHHHh-c-CC----eEEEEEEecCccccc-ccc-------cccchhhHHHHHHHHH
Confidence            4899999999994  89999999999999 6 46    999999987643211 111       0011233445556666


Q ss_pred             HHHHHHHHHHHHhCCCCcccEEeecCCchhHHHHHHhhhCCcEEEEcccCCccchhhhcccHHHHHhhcCCccEEEEc
Q 044140           83 QKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVK  160 (166)
Q Consensus        83 ~~~l~~~~~~~~~~~i~~~~~~v~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~gs~~~~l~~~~~~pVlvv~  160 (166)
                      ++.++.+.+.+...+.+ ++.++..|++.+.|+++++++++||||||+++++ +.++++||++++|+++++||||+||
T Consensus        67 ~~~l~~~~~~~~~~~~~-v~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~-~~~~llGS~a~~v~~~a~~pVLvV~  142 (142)
T PRK15456         67 EERLQTMVSHFTIDPSR-IKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSVIRHANLPVLVVR  142 (142)
T ss_pred             HHHHHHHHHHhCCCCcc-eEEEEcCCChHHHHHHHHhhcCCCEEEEcCCCCC-ccceecCccHHHHHHcCCCCEEEeC
Confidence            67777777666556777 8899999999999999999999999999999976 7778999999999999999999996

>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PF02441 Flavoprotein: Flavoprotein; InterPro: IPR003382 This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [] Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK06029 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK08305 spoVFB dipicolinate synthase subunit B; Reviewed Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>COG0452 Dfp Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02699 archaeo_AfpA archaeoflavoprotein AfpA Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PF03746 LamB_YcsF: LamB/YcsF family; InterPro: IPR005501 This entry represents the uncharacterised protein family UPF0271, including LamB Back     alignment and domain information
>cd07044 CofD_YvcK Family of CofD-like proteins and proteins related to YvcK Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>TIGR01826 CofD_related conserved hypothetical protein, cofD-related Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF01933 UPF0052: Uncharacterised protein family UPF0052; InterPro: IPR002882 This entry contains LPPG:Fo 2-phospho-L-lactate transferase (CofD) and related sequences of unknown function belong to unidentified protein family UPF0052 Back     alignment and domain information
>PRK10674 deoxyribodipyrimidine photolyase; Provisional Back     alignment and domain information
>cd07187 YvcK_like family of mostly uncharacterized proteins similar to B Back     alignment and domain information
>COG1927 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PF13167 GTP-bdg_N: GTP-binding GTPase N-terminal Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>cd01714 ETF_beta The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07186 CofD_like LPPG:FO 2-phospho-L-lactate transferase; important in F420 biosynthesis Back     alignment and domain information
>cd08550 GlyDH-like Glycerol_dehydrogenase-like Back     alignment and domain information
>COG0415 PhrB Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11070 ssDNA exonuclease RecJ; Provisional Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05406 LamB/YcsF family protein; Provisional Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
2gm3_A175 Crystal Structure Of An Universal Stress Protein Fa 4e-07
>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175 Back     alignment and structure 
Iteration: 1

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%)
Query: 105 VMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVK 160
           +  GDP++V+ + V+R  P  LV+GS G G  ++  +G+VS +   H  C V  +K
Sbjct: 107 IKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVXTIK 162

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 1e-35
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 3e-28
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 8e-22
2z08_A137 Universal stress protein family; uncharacterized c 2e-21
3s3t_A146 Nucleotide-binding protein, universal stress PROT 2e-21
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 6e-21
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 2e-20
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 2e-20
3tnj_A150 Universal stress protein (USP); structural genomic 3e-17
3fg9_A156 Protein of universal stress protein USPA family; A 6e-16
3loq_A 294 Universal stress protein; structural genomics, PSI 8e-16
3loq_A294 Universal stress protein; structural genomics, PSI 7e-13
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 2e-15
3dlo_A155 Universal stress protein; unknown function, struct 4e-15
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 5e-15
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 2e-11
3fdx_A143 Putative filament protein / universal stress PROT; 2e-14
3olq_A319 Universal stress protein E; structural genomics, P 5e-13
3olq_A 319 Universal stress protein E; structural genomics, P 8e-13
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 7e-13
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 8e-07
3mt0_A290 Uncharacterized protein PA1789; structural genomic 1e-12
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 6e-07
1q77_A138 Hypothetical protein AQ_178; structural genomics, 1e-05
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score =  121 bits (304), Expect = 1e-35
 Identities = 37/164 (22%), Positives = 67/164 (40%), Gaps = 15/164 (9%)

Query: 9   MMVAIDDSNHSYY---------ALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSG 59
           +MVA++ S    Y         A EW L+      +    F+++L+H +           
Sbjct: 8   VMVAVNASTIKDYPNPSISCKRAFEWTLEKIV--RSNTSDFKILLLHVQVVDEDGFDDVD 65

Query: 60  AGQGSAGSAHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVE 119
           +      S      +    K +   + +   + C +  V      +  GDP++V+ + V+
Sbjct: 66  SI---YASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVG-CEAWIKTGDPKDVICQEVK 121

Query: 120 RFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMPK 163
           R  P  LV+GS G G  ++  +G+VS +   H  C VM +K   
Sbjct: 122 RVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNA 165
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.97
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.97
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.97
3fg9_A156 Protein of universal stress protein USPA family; A 99.97
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.96
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.96
3tnj_A150 Universal stress protein (USP); structural genomic 99.96
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.96
2z08_A137 Universal stress protein family; uncharacterized c 99.96
3dlo_A155 Universal stress protein; unknown function, struct 99.96
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.96
3fdx_A143 Putative filament protein / universal stress PROT; 99.94
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.94
3olq_A 319 Universal stress protein E; structural genomics, P 99.94
3loq_A 294 Universal stress protein; structural genomics, PSI 99.93
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.92
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.92
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.92
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.92
3olq_A319 Universal stress protein E; structural genomics, P 99.91
3loq_A294 Universal stress protein; structural genomics, PSI 99.9
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.9
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.9
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.84
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 97.06
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 96.22
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 96.15
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 95.32
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 95.17
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 94.91
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 94.83
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 94.66
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 94.53
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 94.48
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 94.44
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 94.39
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 94.29
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 93.99
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 93.85
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 93.85
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 93.83
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 93.58
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 93.35
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 93.14
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 93.11
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 93.1
2ejb_A189 Probable aromatic acid decarboxylase; phenylacryli 92.59
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 92.37
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 92.01
2hma_A 376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 90.76
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 90.51
1owl_A 484 Photolyase, deoxyribodipyrimidine photolyase; DNA 90.38
3tvs_A 538 Cryptochrome-1; circadian clock light entrainment, 89.97
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 89.91
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 89.54
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 89.21
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 89.19
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 88.99
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 88.62
2j4d_A 525 Cryptochrome 3, cryptochrome DASH; DNA-binding pro 87.23
4ds3_A209 Phosphoribosylglycinamide formyltransferase; struc 87.05
3fy4_A 537 6-4 photolyase; DNA repair, clock cryptochrome; HE 86.97
2e0i_A 440 432AA long hypothetical deoxyribodipyrimidine PHO; 86.54
2wsi_A 306 FAD synthetase; transferase, nucleotidyltransferas 85.79
1o97_C 264 Electron transferring flavoprotein beta-subunit; F 84.22
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 84.09
1nu0_A138 Hypothetical protein YQGF; structural genomics, st 83.92
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 83.58
2p0y_A 341 Hypothetical protein LP_0780; structural genomics, 83.15
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 82.93
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 82.91
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 82.86
3zqu_A209 Probable aromatic acid decarboxylase; lyase; HET: 82.72
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfi 82.67
2ppv_A 332 Uncharacterized protein; putative phosphotransfera 82.61
2q7x_A326 UPF0052 protein SP_1565; structural genomics, join 81.81
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 81.72
2o2z_A323 Hypothetical protein; structural genomics, joint c 80.63
1g63_A181 Epidermin modifying enzyme EPID; alpha, beta prote 80.6
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
Probab=99.97  E-value=4.2e-31  Score=176.44  Aligned_cols=144  Identities=17%  Similarity=0.284  Sum_probs=125.4

Q ss_pred             CCCCCCEEEEEEcCChhHHHHHHHHHHhcCCCCCCCCceEEEEEEeecCCCCCcCCCCCCCCCCCchhhHHHHHHHHHHH
Q 044140            2 GDQTKPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQGSAGSAHVINLVELDTKKR   81 (166)
Q Consensus         2 ~~~~~~~Ilv~vd~s~~s~~al~~a~~la~~~~~~~~~~~l~lv~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (166)
                      +++++++||||+|+|+.+..++++|+.+|+ .+++    +|+++||.+........         .........+...+.
T Consensus         1 s~~~~~~ILv~~D~s~~s~~al~~A~~la~-~~~a----~l~ll~v~~~~~~~~~~---------~~~~~~~~~~~~~~~   66 (146)
T 3s3t_A            1 SNARYTNILVPVDSSDAAQAAFTEAVNIAQ-RHQA----NLTALYVVDDSAYHTPA---------LDPVLSELLDAEAAH   66 (146)
T ss_dssp             -CCCCCEEEEECCSSHHHHHHHHHHHHHHH-HHTC----EEEEEEEEECCCCCCGG---------GHHHHHHHHHHHHHH
T ss_pred             CCCccceEEEEcCCCHHHHHHHHHHHHHHH-hcCC----EEEEEEEecCccccccc---------cccccHHHHHHHHHH
Confidence            468899999999999999999999999999 8888    99999998865433111         111344555667778


Q ss_pred             HHHHHHHHHHHHHhCCC-CcccEEeecCCchhHHHH-HHhhhCCcEEEEcccCCccchhhhcccHHHHHhhcCCccEEEE
Q 044140           82 AQKVADKATSICAKREV-NDMPVHVMQGDPRNVMTE-AVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIV  159 (166)
Q Consensus        82 ~~~~l~~~~~~~~~~~i-~~~~~~v~~g~~~~~I~~-~a~~~~~dliV~g~~~~~~~~~~~~gs~~~~l~~~~~~pVlvv  159 (166)
                      +++.++.+.+.+.+.|+ + +++.+..|++.+.|++ ++++.++||||||+++++.+.++++||++++++++++||||+|
T Consensus        67 ~~~~l~~~~~~~~~~g~~~-~~~~~~~g~~~~~I~~~~a~~~~~dliV~G~~~~~~~~~~~~Gs~~~~vl~~~~~pVlvV  145 (146)
T 3s3t_A           67 AKDAMRQRQQFVATTSAPN-LKTEISYGIPKHTIEDYAKQHPEIDLIVLGATGTNSPHRVAVGSTTSYVVDHAPCNVIVI  145 (146)
T ss_dssp             HHHHHHHHHHHHTTSSCCC-CEEEEEEECHHHHHHHHHHHSTTCCEEEEESCCSSCTTTCSSCHHHHHHHHHCSSEEEEE
T ss_pred             HHHHHHHHHHHHHhcCCcc-eEEEEecCChHHHHHHHHHhhcCCCEEEECCCCCCCcceEEEcchHHHHhccCCCCEEEe
Confidence            88889999999988899 7 9999999999999999 9999999999999999999999999999999999999999999


Q ss_pred             c
Q 044140          160 K  160 (166)
Q Consensus       160 ~  160 (166)
                      |
T Consensus       146 ~  146 (146)
T 3s3t_A          146 R  146 (146)
T ss_dssp             C
T ss_pred             C
Confidence            7
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>2ejb_A Probable aromatic acid decarboxylase; phenylacrylic acid decarboxylase, X-RAY diffraction, structural genomics, NPPSFA; 2.15A {Aquifex aeolicus} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>2j4d_A Cryptochrome 3, cryptochrome DASH; DNA-binding protein, flavoprotein, FAD, mitochondrion, plastid, chromophore, chloroplast; HET: FAD MHF; 1.9A {Arabidopsis thaliana} PDB: 2vtb_A* 2ijg_X* 2vtb_B* Back     alignment and structure
>4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Back     alignment and structure
>3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Back     alignment and structure
>2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>2p0y_A Hypothetical protein LP_0780; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 3.00A {Lactobacillus plantarum} Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>3zqu_A Probable aromatic acid decarboxylase; lyase; HET: FNR; 1.50A {Pseudomonas aeruginosa} SCOP: c.34.1.0 Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2ppv_A Uncharacterized protein; putative phosphotransferase, structural genomics, joint CENT structural genomics, JCSG; 2.00A {Staphylococcus epidermidis} Back     alignment and structure
>2q7x_A UPF0052 protein SP_1565; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; HET: MLY MSE; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>2o2z_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, NAD-binding protein; HET: NAD; 2.60A {Bacillus halodurans} PDB: 2hzb_A Back     alignment and structure
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 1e-20
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 1e-17
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 2e-16
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 1e-15
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 2e-10
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 6e-05
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 81.1 bits (199), Expect = 1e-20
 Identities = 37/162 (22%), Positives = 66/162 (40%), Gaps = 15/162 (9%)

Query: 10  MVAIDDSNHSYY---------ALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGA 60
           MVA++ S    Y         A EW L+        +  F+++L+H +       G    
Sbjct: 5   MVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSD--FKILLLHVQV--VDEDGFDDV 60

Query: 61  GQGSAGSAHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVER 120
               A      ++ +   K +   + +   + C           +  GDP++V+ + V+R
Sbjct: 61  DSIYASPEDFRDMRQ-SNKAKGLHLLEFFVNKC-HEIGVGCEAWIKTGDPKDVICQEVKR 118

Query: 121 FHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMP 162
             P  LV+GS G G  ++  +G+VS +   H  C VM +K  
Sbjct: 119 VRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRN 160
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 100.0
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.96
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.96
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.96
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.95
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.93
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 97.16
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 96.3
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 95.71
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 95.33
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.27
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 95.17
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.15
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.08
d1efpb_246 Small, beta subunit of electron transfer flavoprot 94.91
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 94.58
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 94.03
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 91.63
d1g5qa_174 Epidermin modifying enzyme (peptidyl-cysteine deca 91.14
d1efvb_252 Small, beta subunit of electron transfer flavoprot 90.69
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 89.95
d2pjua1 186 Propionate catabolism operon regulatory protein Pr 88.37
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 88.04
d1dnpa2200 DNA photolyase {Escherichia coli [TaxId: 562]} 87.02
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 86.77
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 86.69
d2dfaa1250 Hypothetical protein TTHB195 {Thermus thermophilus 86.27
d1v6ta_254 Hypothetical protein PH0986 {Pyrococcus horikoshii 85.94
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli 85.24
d1u3da2185 Cryptochrome {Thale cress (Arabidopsis thaliana) [ 85.0
d1xw8a_247 Hypothetical protein YbgL {Escherichia coli [TaxId 84.84
d1s8na_ 190 Probable two-component system transcriptional regu 84.11
d3clsd1192 Large, alpha subunit of electron transfer flavopro 84.02
d3bzka5149 Transcriptional accessory factor Tex {Pseudomonas 81.86
d2hzba1311 Hypothetical protein BH3568 {Bacillus halodurans [ 81.59
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 81.27
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 81.2
d1uf3a_ 228 Hypothetical protein TT1561 {Thermus thermophilus 80.93
d1ls1a2207 GTPase domain of the signal sequence recognition p 80.92
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 80.9
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 80.8
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 80.49
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 80.25
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=100.00  E-value=2.2e-33  Score=188.99  Aligned_cols=154  Identities=16%  Similarity=0.137  Sum_probs=128.4

Q ss_pred             CCCCEEEEEEcCChhHHHHHHHHHHhcCCCCCCCCceEEEEEEeecCCCCCcCCCCCCC-----CCCCchhhHHHHHHHH
Q 044140            4 QTKPIMMVAIDDSNHSYYALEWALDYFFPPFAPNHTFQLVLIHARPNPPSLLGLSGAGQ-----GSAGSAHVINLVELDT   78 (166)
Q Consensus         4 ~~~~~Ilv~vd~s~~s~~al~~a~~la~~~~~~~~~~~l~lv~v~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~   78 (166)
                      +||+|||||+|+|+.+.+++++|+.+|+ .+++    +|+++||.++............     ......+......+..
T Consensus         1 ~m~~~ILvavD~s~~s~~al~~a~~la~-~~~a----~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   75 (160)
T d1mjha_           1 VMYKKILYPTDFSETAEIALKHVKAFKT-LKAE----EVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKL   75 (160)
T ss_dssp             CCCCEEEEECCSCHHHHHHHHHHHHTCC-SSCC----EEEEEEEEEGGGTC-----------------CHHHHHHHHHHH
T ss_pred             CCcCeEEEEECCCHHHHHHHHHHHHHHH-hcCC----EEEEEEecccccccccccccccccccccchhHHHHHHHHHHHH
Confidence            5899999999999999999999999999 9998    9999999866543322111100     0012234455566677


Q ss_pred             HHHHHHHHHHHHHHHHhCCCCcccEEeecCCchhHHHHHHhhhCCcEEEEcccCCccchhhhcccHHHHHhhcCCccEEE
Q 044140           79 KKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPTILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMI  158 (166)
Q Consensus        79 ~~~~~~~l~~~~~~~~~~~i~~~~~~v~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~gs~~~~l~~~~~~pVlv  158 (166)
                      .+.+++.++.+.+.+...|++ ++..+..|++.+.|++++++.++||||||+++++.+.++|+||++++|+++++|||++
T Consensus        76 ~~~~~~~l~~~~~~~~~~gv~-~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~pVlv  154 (160)
T d1mjha_          76 TEEAKNKMENIKKELEDVGFK-VKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLV  154 (160)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCE-EEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEE
T ss_pred             HHHHHHHHHHHHHHHHhcCCe-EEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCCCEEE
Confidence            788888999999999999999 9999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcCCC
Q 044140          159 VKMPK  163 (166)
Q Consensus       159 v~~~~  163 (166)
                      ||++.
T Consensus       155 V~~~~  159 (160)
T d1mjha_         155 VKRKN  159 (160)
T ss_dssp             ECCCC
T ss_pred             EcCCC
Confidence            99864
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g5qa_ c.34.1.1 (A:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis [TaxId: 1282]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dnpa2 c.28.1.1 (A:1-200) DNA photolyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dfaa1 c.6.2.5 (A:1-250) Hypothetical protein TTHB195 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v6ta_ c.6.2.5 (A:) Hypothetical protein PH0986 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xw8a_ c.6.2.5 (A:) Hypothetical protein YbgL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hzba1 c.143.1.1 (A:2-312) Hypothetical protein BH3568 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure