Citrus Sinensis ID: 044144


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
GINNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLESLILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLSTVVNHSSTVVNCSKMKEIFAIGEEVDNSIEKIELAQLRYLSLGNLPEVTSFCREVKTPSASPNRPASQEESTTTYSSSEITLDTSTLLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIISENRADEVIPYFVFPQLTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIFAADLSQNNENDQLGIPAQQPPCRWK
ccccccEEEEccccccccccccccccccccccEEEEEcccccEEEccccccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccEEEEccccccccccHHccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccEEccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEcccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccc
ccccHHHEEHHHcccccHHHHHcccccccccEEEEEEcccccEEEEcccccccccccccHcEEEEcccHcHHHHcccccccccccccEEEEEEccccccEEEcHHHHccccEEEccHHHHHHHHHccccccccccEEEcccccEEEccccHHHHHHHHcccccccccEEEccccHHEEEccccccEEcccccccccccccccccEEEEcccccEEEEccccccccccccccccEEEEEEcccccHHEccHHHHHHHHHHcEEEEcccHHHHHEEccccccccccEEEcccccEEEEcccccccEcccccccccccccEEEEEEccccEEEEcccccccccccEEEEcccccccccc
GINNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWvqnnpdffcivdsramvacdaFPLLESLILHNLINMERIWIDQLKVESFNELKIIQAyncdklsniFWLSTVVNHSSTVVNCSKMKEIFAIGEEVDNSIEKIELAQLRYLslgnlpevtsfcrevktpsaspnrpasqeestttyssseitldtstllfnekvalpnleaLEISAINVdkiwhynqipaavfprfqNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIISenradevipyfvfpqLTTLILQYlpklrclypgmhtsewpaleifSVFRCDKLKIFAADLsqnnendqlgipaqqppcrwk
GINNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLESLILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLSTVVNHSSTVVNCSKMKEIFAIGEEVDNSIEKIELAQLRYLSLGNLPEVTSFCREVktpsaspnrpasqeestttyssseiTLDTSTLLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIISENRADEVIPYFVFPQLTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIFAADLsqnnendqlgipaqqppcrwk
GINNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLESLILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLstvvnhsstvvncsKMKEIFAIGEEVDNSIEKIELAQLRYLSLGNLPEVTSFCREVKTPSASPNRPAsqeestttyssseITLDTSTLLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIISENRADEVIPYFVFPQLTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIFAADLSQNNENDQLGIPAQQPPCRWK
***NVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLESLILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLSTVVNHSSTVVNCSKMKEIFAIGEEVDNSIEKIELAQLRYLSLGNLPEVTSFCR***************************TLDTSTLLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIISENRADEVIPYFVFPQLTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIFAADL*********************
GINNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLESLILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLSTVVNHSSTVVNCSKMKEIFAIGEEVDNSIEKIELAQLRYLSLGNLPEVTSFCREVKTPSASPNRPASQEESTTTYSSSEITLDTSTLLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQE**************VFPQLTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKI******************QQPPCRWK
GINNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLESLILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLSTVVNHSSTVVNCSKMKEIFAIGEEVDNSIEKIELAQLRYLSLGNLPEVTSFCRE*************************ITLDTSTLLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIISENRADEVIPYFVFPQLTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIFAADLSQNNENDQLGIPA********
GINNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLESLILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLSTVVNHSSTVVNCSKMKEIFAIGEEVDNSIEKIELAQLRYLSLGNLPEVTSFCREVKTPSASPNRPASQEESTTTYSSSEITLDTSTLLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIISENRADEVIPYFVFPQLTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIFAADLSQNNENDQLGIPAQQP***W*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GINNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLESLILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLSTVVNHSSTVVNCSKMKEIFAIGEEVDNSIEKIELAQLRYLSLGNLPEVTSFCREVKTPSASPNRPASQEESTTTYSSSEITLDTSTLLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIISENRADEVIPYFVFPQLTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIFAADLSQNNENDQLGIPAQQPPCRWK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query356 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.348 0.134 0.328 9e-07
Q42484909 Disease resistance protei no no 0.578 0.226 0.232 3e-05
O64973889 Disease resistance protei no no 0.317 0.127 0.314 0.0001
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 67/131 (51%), Gaps = 7/131 (5%)

Query: 201 PNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMI-GSLKHL 259
           PNLE L +  +N++ I   N        R Q L  L V  C +LK +FS  ++ G+L +L
Sbjct: 768 PNLEELSLDNVNLESIGELNGFLGM---RLQKLKLLQVSGCRQLKRLFSDQILAGTLPNL 824

Query: 260 QHLEVRFCEDLQEIISENRAD-EVIPYFVFPQLTTLILQYLPKLRCLYPGMHTSEWPALE 318
           Q ++V  C  L+E+ + +    +     + P+LT + L+YLP+LR L       E  +LE
Sbjct: 825 QEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLE--SLE 882

Query: 319 IFSVFRCDKLK 329
              V  C+ LK
Sbjct: 883 HLEVESCESLK 893




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.943 0.142 0.377 7e-47
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.957 0.259 0.356 1e-41
255563252 1603 Disease resistance protein RPS5, putativ 0.918 0.203 0.360 2e-40
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.898 0.238 0.367 4e-40
296087872 1152 unnamed protein product [Vitis vinifera] 0.904 0.279 0.323 6e-40
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.929 0.247 0.353 1e-38
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.814 0.253 0.376 8e-38
353685492 2756 Rpp4C3 [Phaseolus vulgaris] 0.876 0.113 0.358 3e-37
357439641 1261 Cc-nbs resistance protein, partial [Medi 0.797 0.225 0.352 2e-34
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.910 0.131 0.355 2e-34
>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  194 bits (492), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 204/352 (57%), Gaps = 16/352 (4%)

Query: 2    INNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLE 61
            +N  E L+L +++G+ N++  LD EGF  LK L ++N+ +   I+ +  MV+ +AFP+LE
Sbjct: 730  LNRTEDLYLFEIEGV-NIIQELDREGFPHLKHLQLRNSFEIQYIISTMEMVSSNAFPILE 788

Query: 62   SLILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLSTVVNHSS----TVVNC 117
            SLIL++L ++++I    L+VESF +L+II   +C+KL+N+F        S      +  C
Sbjct: 789  SLILYDLSSLKKICHGALRVESFAKLRIIAVEHCNKLTNLFSFFVARGLSQLQKIKIAFC 848

Query: 118  SKMKEIFA-----IGEEVDNSIEKIELAQLRYLSLGNLPEVTSFCREVKTPSASPNRPA- 171
             KM+E+ A     +G++ +  ++ I+  QL  LSL  LP + +F  +VK  S S  +P  
Sbjct: 849  MKMEEVVAEESDELGDQ-NEVVDVIQFTQLYSLSLQYLPHLMNFYSKVKPSSLSRTQPKP 907

Query: 172  SQEESTTTYSSSEITLDTSTLLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVFPRFQ 231
            S  E+ +    SE  L T T LFNEK+  PNLE L + AIN+DK+W+ +Q P ++    Q
Sbjct: 908  SITEARSEEIISEDELRTPTQLFNEKILFPNLEDLNLYAINIDKLWN-DQHP-SISVSIQ 965

Query: 232  NLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIIS-ENRADEVIPYFVFPQ 290
            NL RL+V  C  LKY+F +S++  L  L+HL +  C  ++EII+     +E     VFP+
Sbjct: 966  NLQRLVVNQCGSLKYLFPSSLVNILVQLKHLSITNCMSVEEIIAIGGLKEEETTSTVFPK 1025

Query: 291  LTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIFAADLSQNNEND 342
            L  + L  LPKLR    G  + E P L+   +  C + K FAAD S  N ND
Sbjct: 1026 LEFMELSDLPKLRRFCIG-SSIECPLLKRMRICACPEFKTFAADFSCANIND 1076




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|353685492|gb|AER13169.1| Rpp4C3 [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|357439641|ref|XP_003590098.1| Cc-nbs resistance protein, partial [Medicago truncatula] gi|355479146|gb|AES60349.1| Cc-nbs resistance protein, partial [Medicago truncatula] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.348 0.134 0.328 2e-06
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.401 0.157 0.261 3.8e-06
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.334 0.133 0.310 0.00057
TAIR|locus:2171589 948 AT5G47260 [Arabidopsis thalian 0.384 0.144 0.260 0.00071
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 142 (55.0 bits), Expect = 2.0e-06, P = 2.0e-06
 Identities = 43/131 (32%), Positives = 67/131 (51%)

Query:   201 PNLEALEISAINVDKIWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMI-GSLKHL 259
             PNLE L +  +N++ I   N        R Q L  L V  C +LK +FS  ++ G+L +L
Sbjct:   768 PNLEELSLDNVNLESIGELNGFLGM---RLQKLKLLQVSGCRQLKRLFSDQILAGTLPNL 824

Query:   260 QHLEVRFCEDLQEIISENRAD-EVIPYFVFPQLTTLILQYLPKLRCLYPGMHTSEWPALE 318
             Q ++V  C  L+E+ + +    +     + P+LT + L+YLP+LR L       E  +LE
Sbjct:   825 QEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKLKYLPQLRSLCNDRVVLE--SLE 882

Query:   319 IFSVFRCDKLK 329
                V  C+ LK
Sbjct:   883 HLEVESCESLK 893




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_scaffold_329000001
cc-nbs-lrr resistance protein (2359 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 356
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.78
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.74
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.56
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.52
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.21
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.19
KOG4341483 consensus F-box protein containing LRR [General fu 99.16
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.02
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.98
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.92
KOG4341483 consensus F-box protein containing LRR [General fu 98.85
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.51
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.36
KOG0617264 consensus Ras suppressor protein (contains leucine 98.3
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.2
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.19
PRK15386 426 type III secretion protein GogB; Provisional 98.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.1
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.06
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.06
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.05
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.04
KOG0617264 consensus Ras suppressor protein (contains leucine 98.04
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.03
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.01
PRK15386 426 type III secretion protein GogB; Provisional 98.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.86
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.82
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.68
KOG4237498 consensus Extracellular matrix protein slit, conta 97.64
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.56
KOG4237498 consensus Extracellular matrix protein slit, conta 97.45
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.97
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.96
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.83
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.69
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 95.87
PLN03150623 hypothetical protein; Provisional 95.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.7
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 95.48
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.4
PLN03150623 hypothetical protein; Provisional 95.39
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.38
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 95.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.09
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 94.99
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 94.51
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.49
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 94.41
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.87
KOG2123 388 consensus Uncharacterized conserved protein [Funct 92.7
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.6
KOG2982 418 consensus Uncharacterized conserved protein [Funct 92.31
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 91.54
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.0
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 89.64
KOG2123 388 consensus Uncharacterized conserved protein [Funct 87.46
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 86.69
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 85.48
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.27
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 82.6
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.78  E-value=1.7e-18  Score=183.77  Aligned_cols=47  Identities=19%  Similarity=0.166  Sum_probs=41.4

Q ss_pred             cCCccCeeeccccccceeecCCCCcCCCCcccEEeeccCcCcccccccc
Q 044144          287 VFPQLTTLILQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIFAADL  335 (356)
Q Consensus       287 ~l~~L~~L~l~~c~~L~~~~~~~~~~~~~~L~~L~i~~C~~l~~l~~~~  335 (356)
                      .+++|+.|++.+|++|+.++...  ..+++|+.+++.+|++++.++...
T Consensus       867 ~l~~L~~L~L~~C~~L~~l~~~~--~~L~~L~~L~l~~C~~L~~~~l~~  913 (1153)
T PLN03210        867 KFSNLSFLDMNGCNNLQRVSLNI--SKLKHLETVDFSDCGALTEASWNG  913 (1153)
T ss_pred             cCCCCCEEECCCCCCcCccCccc--ccccCCCeeecCCCcccccccCCC
Confidence            48899999999999999998876  678999999999999999877644



syringae 6; Provisional

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 51.0 bits (121), Expect = 4e-07
 Identities = 50/279 (17%), Positives = 77/279 (27%), Gaps = 98/279 (35%)

Query: 11  DKLQGIENVLFNLD--TEGFSQ---LKLL--WVQNNPDFFCIVDSRAMVACDAFPLLESL 63
           D L        +LD  +   +      LL  ++       C             P   S+
Sbjct: 279 DFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLD------CRPQDLPREVLTTNPRRLSI 332

Query: 64  ILHNLINMERIWIDQLKVESFNELKIIQAYNCDKLSNIFWLSTVVNHSSTVVNCSKMKEI 123
           I  ++ +    W D  K             NCDKL+ I                      
Sbjct: 333 IAESIRDGLATW-DNWK-----------HVNCDKLTTI---------------------- 358

Query: 124 FAIGEEVDNSIEKIELAQLR--YLSLGNLPEVTSFCREVKTPSA---------SPNRPAS 172
                 +++S+  +E A+ R  +  L   P           P+            +    
Sbjct: 359 ------IESSLNVLEPAEYRKMFDRLSVFPP------SAHIPTILLSLIWFDVIKSDVMV 406

Query: 173 QEESTTTYSSSEITLDTST-----LLFNEKVALPNLEALEISAINVDKIWHYNQIPAAVF 227
                  YS  E     ST     +    KV L N  AL  S ++     HYN IP    
Sbjct: 407 VVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVD-----HYN-IPKTFD 460

Query: 228 PRFQNLTRLIVWHCNKL---KYIFSASMIGSLKHLQHLE 263
                               +Y +  S IG   HL+++E
Sbjct: 461 S----------DDLIPPYLDQYFY--SHIG--HHLKNIE 485


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.75
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.73
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.7
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.7
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.68
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.66
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.66
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.66
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.65
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.65
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.65
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.65
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.64
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.64
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.64
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.63
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.63
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.62
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.61
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.6
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.59
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.58
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.58
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.57
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.56
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.56
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.55
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.55
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.55
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.55
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.55
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.54
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.54
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.54
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.53
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.51
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.49
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.49
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.49
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.48
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.48
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.47
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.47
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.46
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.46
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.46
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.44
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.43
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.43
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.42
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.41
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.41
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.41
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.39
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.39
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.39
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.38
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.38
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.35
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.35
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.35
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.34
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.33
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.33
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.32
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.31
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.29
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.28
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.27
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.26
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.2
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.19
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.14
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.12
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.11
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.06
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.01
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.01
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.99
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.98
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.94
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.92
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.92
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.89
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.86
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.75
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.72
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.72
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.66
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.65
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.6
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.59
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.53
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.44
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.37
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.19
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.1
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.99
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.9
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.85
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.85
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.8
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.71
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.38
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.29
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.15
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 94.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 93.76
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.96
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 92.48
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 85.18
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
Probab=99.75  E-value=3.9e-17  Score=150.75  Aligned_cols=154  Identities=17%  Similarity=0.180  Sum_probs=87.0

Q ss_pred             ccccccccEEecCCCCCcceeecCCCCCCCCCCCCCCccccccccccceeecCCccccccccccCCCcCeEEecceeeeE
Q 044144          136 KIELAQLRYLSLGNLPEVTSFCREVKTPSASPNRPASQEESTTTYSSSEITLDTSTLLFNEKVALPNLEALEISAINVDK  215 (356)
Q Consensus       136 ~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~i~~~~~~~l~~~~~~l~~L~~L~l~~~~l~~  215 (356)
                      +..+++|++|+++++. ++.++.               ...+..++.+.++.+.-..... +..+++|+.|++.+|+++.
T Consensus       173 ~~~l~~L~~L~l~~n~-l~~~~~---------------~~~l~~L~~L~l~~n~l~~~~~-~~~~~~L~~L~l~~n~l~~  235 (347)
T 4fmz_A          173 IANLTDLYSLSLNYNQ-IEDISP---------------LASLTSLHYFTAYVNQITDITP-VANMTRLNSLKIGNNKITD  235 (347)
T ss_dssp             GGGCTTCSEEECTTSC-CCCCGG---------------GGGCTTCCEEECCSSCCCCCGG-GGGCTTCCEEECCSSCCCC
T ss_pred             hccCCCCCEEEccCCc-cccccc---------------ccCCCccceeecccCCCCCCch-hhcCCcCCEEEccCCccCC
Confidence            4566778888877753 222221               1133345666665554322222 5567777777777776655


Q ss_pred             EcccCCCCCCCCCCCcCccEEeeccCcCccccchhhhhhhcCCCCeEEEecCcccceeeccCCCCcCcccccCCccCeee
Q 044144          216 IWHYNQIPAAVFPRFQNLTRLIVWHCNKLKYIFSASMIGSLKHLQHLEVRFCEDLQEIISENRADEVIPYFVFPQLTTLI  295 (356)
Q Consensus       216 ~~~~~~~p~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~l~~L~~L~i~~c~~l~~i~~~~~~~~~~~~~~l~~L~~L~  295 (356)
                            .+.  +..+++|+.|++++| .+..+   ..+..+++|+.|++++|. +..+   .....      +++|++|+
T Consensus       236 ------~~~--~~~l~~L~~L~l~~n-~l~~~---~~~~~l~~L~~L~l~~n~-l~~~---~~~~~------l~~L~~L~  293 (347)
T 4fmz_A          236 ------LSP--LANLSQLTWLEIGTN-QISDI---NAVKDLTKLKMLNVGSNQ-ISDI---SVLNN------LSQLNSLF  293 (347)
T ss_dssp             ------CGG--GTTCTTCCEEECCSS-CCCCC---GGGTTCTTCCEEECCSSC-CCCC---GGGGG------CTTCSEEE
T ss_pred             ------Ccc--hhcCCCCCEEECCCC-ccCCC---hhHhcCCCcCEEEccCCc-cCCC---hhhcC------CCCCCEEE
Confidence                  222  446677777777765 45554   235566777777777764 4443   12222      66777777


Q ss_pred             ccccccceeecCCCCcCCCCcccEEeeccCcCcccc
Q 044144          296 LQYLPKLRCLYPGMHTSEWPALEIFSVFRCDKLKIF  331 (356)
Q Consensus       296 l~~c~~L~~~~~~~~~~~~~~L~~L~i~~C~~l~~l  331 (356)
                      +.+| .++...... ...+++|+.|++.+|+ ++.+
T Consensus       294 L~~n-~l~~~~~~~-l~~l~~L~~L~L~~n~-l~~~  326 (347)
T 4fmz_A          294 LNNN-QLGNEDMEV-IGGLTNLTTLFLSQNH-ITDI  326 (347)
T ss_dssp             CCSS-CCCGGGHHH-HHTCTTCSEEECCSSS-CCCC
T ss_pred             CcCC-cCCCcChhH-hhccccCCEEEccCCc-cccc
Confidence            7776 343332221 1456777777777776 4443



>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.47
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.45
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.42
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.4
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.31
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.29
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.27
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.26
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.21
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.21
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.21
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.19
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.17
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.16
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.13
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.09
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.07
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.06
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.98
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.98
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.81
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.9
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.04
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.64
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.45
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.75
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 89.41
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 85.57
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 83.85
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.47  E-value=1.4e-12  Score=119.17  Aligned_cols=79  Identities=20%  Similarity=0.310  Sum_probs=57.0

Q ss_pred             CCcceEEeeCcccCceeeccccCccccCCCcEEEEecCCCceEeecCCcccccccCcccceeeccccccccccccccccc
Q 044144            2 INNVECLWLDKLQGIENVLFNLDTEGFSQLKLLWVQNNPDFFCIVDSRAMVACDAFPLLESLILHNLINMERIWIDQLKV   81 (356)
Q Consensus         2 ~~~l~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~   81 (356)
                      +++++.|++.++ +++++ .  .++.+++|++|+++++ +++.+      ..++.+++|++|+++++. +.+++    +.
T Consensus        43 l~~l~~L~l~~~-~I~~l-~--gl~~L~nL~~L~Ls~N-~l~~l------~~l~~L~~L~~L~L~~n~-i~~i~----~l  106 (384)
T d2omza2          43 LDQVTTLQADRL-GIKSI-D--GVEYLNNLTQINFSNN-QLTDI------TPLKNLTKLVDILMNNNQ-IADIT----PL  106 (384)
T ss_dssp             HTTCCEEECCSS-CCCCC-T--TGGGCTTCCEEECCSS-CCCCC------GGGTTCTTCCEEECCSSC-CCCCG----GG
T ss_pred             hCCCCEEECCCC-CCCCc-c--ccccCCCCCEEeCcCC-cCCCC------ccccCCcccccccccccc-ccccc----cc
Confidence            357888888776 34443 2  3457899999999998 67755      347788999999999864 55542    23


Q ss_pred             cCCCCccEEEEccCC
Q 044144           82 ESFNELKIIQAYNCD   96 (356)
Q Consensus        82 ~~l~~L~~L~l~~c~   96 (356)
                      ..+++|+.|++.++.
T Consensus       107 ~~l~~L~~L~~~~~~  121 (384)
T d2omza2         107 ANLTNLTGLTLFNNQ  121 (384)
T ss_dssp             TTCTTCCEEECCSSC
T ss_pred             ccccccccccccccc
Confidence            568899999987754



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure