Citrus Sinensis ID: 044176


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
LSNNRIRGRISKSDSQRWKSLTYLDISNNFLTQIEQHPWKNITVLNLQNNTIQGTILVPPPSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSFARPDLYTNA
cccccccccccHHHHHccccccEEEccccccccccccccccccEEEccccccEEccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHHHccccccEEEccccccEEEcccccccccccccEEEcccccccccccHHHHHcccccEEEcccccccccccHHccccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHHHHHHccccccccccccccccccccEEEEEEEEEcccEEEcccccccEEEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEccccccccccccHHccccccccccccccccccc
cccccccccccHHHHHHcccccEEEccccccccccccccccccEEEccccccccccccccccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEcccccccccccHHccccccccEEEEcccccccccccHHHHHHHHHHHHEEccccccccccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccHHEEEccccccc
lsnnrirgrisksdsqRWKSLTYLDISNNFLTqieqhpwknitvlnlqnntiqgtilvpppstraflfsnnklfgqippsiyslSSLEYISLshnnlsgtippclgnfstqLTILHLNNnylqgripdafangscdlrslglnsnklrgsfpryladctglevvnvgnnmigdtfpswlgslpglkilvlrsnrfygplcevnimlpFEALRIIDLshneftgflpRWIFVSLETMknvdekgsdglymqgeedyyqdsvtvtvKGRDLVLKRIITIFTTidlssnqfqgeipqvlGDFKSLIVLNLshngltgsipvSFANMIVLESLdlssnklhgripeqfvdaeicssfarpdlytna
lsnnrirgrisksdsqrwkSLTYLDISNNFLTQIEQHPWKNITVLNLQNNTIQGTILVPPPSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFttidlssnqfQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQfvdaeicssfarpdlytna
LSNNRIRGRISKSDSQRWKSLTYLDISNNFLTQIEQHPWKNITVLNLQNNTIQGTILVPPPSTRAFLFSNNKLFGQippsiyslssleyislsHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSFARPDLYTNA
*****************WKSLTYLDISNNFLTQIEQHPWKNITVLNLQNNTIQGTILVPPPSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSFA********
LSNNRIRGRISKSDSQRWKSLTYLDISNNFLTQIEQHPWKNITVLNLQNNTIQGTILVPPPSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKN********LYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSFARPDLYTN*
LSNNRIRGRISKSDSQRWKSLTYLDISNNFLTQIEQHPWKNITVLNLQNNTIQGTILVPPPSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSFARPDLYTNA
**NNRIRGRISKSDSQRWKSLTYLDISNNFLTQIEQHPWKNITVLNLQNNTIQGTILVPPPSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSFARPDL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LSNNRIRGRISKSDSQRWKSLTYLDISNNFLTQIEQHPWKNITVLNLQNNTIQGTILVPPPSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSFARPDLYTNA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query362 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.944 0.403 0.396 7e-57
O22476 1196 Protein BRASSINOSTEROID I no no 0.911 0.275 0.296 1e-28
Q8VZG8 1045 Probable LRR receptor-lik no no 0.779 0.269 0.322 1e-27
Q42371 976 LRR receptor-like serine/ no no 0.806 0.299 0.325 3e-27
Q9FL28 1173 LRR receptor-like serine/ no no 0.953 0.294 0.294 3e-27
O82318 960 Probably inactive leucine no no 0.914 0.344 0.308 2e-26
Q9FZ59 1088 Leucine-rich repeat recep no no 0.922 0.306 0.334 2e-26
C0LGJ1 1106 Probable LRR receptor-lik no no 0.881 0.288 0.303 4e-26
Q9ZPS9 1143 Serine/threonine-protein no no 0.933 0.295 0.309 4e-26
Q9FN37 1036 Phytosulfokine receptor 2 no no 0.850 0.297 0.325 4e-26
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  221 bits (563), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 148/373 (39%), Positives = 207/373 (55%), Gaps = 31/373 (8%)

Query: 1   LSNNRIRGRISKSDSQRWKSLTYLDIS-NNFLTQIEQHPWK--NITVLNLQNNTIQG--- 54
           L  NR+ G I +S S R  +L  LDIS NNF   I     K  N+  L+L  N ++G   
Sbjct: 358 LGRNRLHGPIPESIS-RLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVP 416

Query: 55  -------TILVPPPSTRAFL-------------FSNNKLFGQIPPSIYSLSSLEYISLSH 94
                  T+++   S  +F               ++N   G IP  I  LSSL ++ LS+
Sbjct: 417 ACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSN 476

Query: 95  NNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRY 154
           N  SG+IP C+ NFS  +  L+L +N   G +PD F+  + +L SL ++ N+L G FP+ 
Sbjct: 477 NLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKAT-ELVSLDVSHNQLEGKFPKS 535

Query: 155 LADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRII 214
           L +C  LE+VNV +N I D FPSWL SLP L +L LRSN+FYGPL   +  + F++LRII
Sbjct: 536 LINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRII 595

Query: 215 DLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGL--YMQGEEDYYQDSVTVTVKGRDLVLK 272
           D+SHN F+G LP + F + + M  + E+    +  + +  + YY +   V  KG D+  +
Sbjct: 596 DISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYADSYYHEMEMVN-KGVDMSFE 654

Query: 273 RIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLS 332
           RI   F  ID S N+  G IP+ LG  K L VLNLS N  T  IP   AN+  LE+LD+S
Sbjct: 655 RIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDIS 714

Query: 333 SNKLHGRIPEQFV 345
            NKL G+IP+   
Sbjct: 715 RNKLSGQIPQDLA 727




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGJ1|Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
255568090 1014 serine/threonine-protein kinase bri1, pu 0.950 0.339 0.481 6e-86
225455498 980 PREDICTED: receptor-like protein 12-like 0.939 0.346 0.507 3e-83
147793123 951 hypothetical protein VITISV_032542 [Viti 0.939 0.357 0.507 3e-83
224116970 921 predicted protein [Populus trichocarpa] 0.941 0.370 0.501 6e-83
359493479 814 PREDICTED: receptor-like protein 12-like 0.939 0.417 0.498 2e-82
359493539 1001 PREDICTED: receptor-like protein 12-like 0.939 0.339 0.504 9e-82
359493546 985 PREDICTED: LRR receptor-like serine/thre 0.939 0.345 0.495 5e-80
359493544 978 PREDICTED: receptor-like protein 12-like 0.939 0.347 0.495 2e-79
225459979 979 PREDICTED: receptor-like protein 12-like 0.939 0.347 0.492 3e-79
296089526 616 unnamed protein product [Vitis vinifera] 0.914 0.537 0.492 2e-75
>gi|255568090|ref|XP_002525021.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223535683|gb|EEF37348.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  323 bits (829), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 170/353 (48%), Positives = 238/353 (67%), Gaps = 9/353 (2%)

Query: 1   LSNNRIRGRISKSDSQRWKSLTYLDISNNFLTQIEQHPWKNITVLNLQNNTIQGTILVPP 60
           LSNNRI G+ SK  S+ WKSL +L++S NFLT ++QHPW+NI  L+L  N +QG + VPP
Sbjct: 533 LSNNRIHGQFSKQKSEGWKSLQFLNLSGNFLTGLDQHPWQNIDTLDLNFNWLQGQLSVPP 592

Query: 61  PSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNN 120
           PS R F+ SNN+L G+IP  I +L S++ + LS+N  SG IP CLG     L IL L NN
Sbjct: 593 PSIRQFMVSNNRLSGEIPSFICNLGSIQVLDLSNNGFSGLIPKCLGIMMNWLVILDLRNN 652

Query: 121 YLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLG 180
              G+IP+ F N S  L  L L+ N   G  P  L +C+GL +++ GNN I DTFP WL 
Sbjct: 653 NFSGKIPEVFGN-SGSLVYLNLHGNNFEGPLPPSLGNCSGLRILDFGNNNIRDTFPHWLE 711

Query: 181 SLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVD 240
           +LP L+IL+LRSN F+G + + ++  PF +L+I+DLSHN FTGF+P  +  +L+++  VD
Sbjct: 712 ALPNLEILILRSNSFHGEVGDPSVDHPFPSLQILDLSHNHFTGFVPIKLMQNLKSVVYVD 771

Query: 241 EKGS------DGLYMQGEEDYYQDS--VTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEI 292
           +  +      D L++   + +  D+  +++ +KG  + L++I+TI T +D SSN+F+GEI
Sbjct: 772 KDANLPEYVGDKLFVGRYQYFLVDAPLISLIIKGWGVELRKILTILTVVDCSSNEFRGEI 831

Query: 293 PQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFV 345
           P+ +G  KSL+VLN SHN LTG IP+SFAN+  +ESLDLSSNKL G IP Q  
Sbjct: 832 PEEIGMLKSLVVLNFSHNSLTGRIPLSFANLTNMESLDLSSNKLVGEIPSQLT 884




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225455498|ref|XP_002264793.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147793123|emb|CAN75335.1| hypothetical protein VITISV_032542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493479|ref|XP_003634609.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493539|ref|XP_002267388.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493546|ref|XP_002267585.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089526|emb|CBI39345.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query362
TAIR|locus:2090754 711 RLP43 "receptor like protein 4 0.961 0.489 0.419 7.3e-59
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.878 0.332 0.423 2.3e-58
TAIR|locus:2205005 1019 RLP7 "AT1G47890" [Arabidopsis 0.941 0.334 0.385 3.4e-58
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.889 0.360 0.428 2.9e-57
TAIR|locus:2046397589 RLP22 "receptor like protein 2 0.917 0.563 0.386 4.6e-57
TAIR|locus:2825762 994 RLP6 "AT1G45616" [Arabidopsis 0.933 0.340 0.398 6.1e-57
TAIR|locus:2173777792 RLP54 "receptor like protein 5 0.928 0.424 0.387 4.2e-56
TAIR|locus:2078112 868 RLP32 "receptor like protein 3 0.872 0.364 0.413 4.8e-56
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.875 0.355 0.410 6.2e-56
TAIR|locus:2119535725 RLP48 "receptor like protein 4 0.886 0.442 0.401 1.1e-55
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 604 (217.7 bits), Expect = 7.3e-59, P = 7.3e-59
 Identities = 154/367 (41%), Positives = 199/367 (54%)

Query:     1 LSNNRIRGRISKSDSQRWKSLTYLDIS-NNFLTQIEQHPWK--NITVLNLQNNTIQGTIL 57
             L  N   G+I  S       LT LD+S NNF  +I    W   N+  +NL  NT  G   
Sbjct:   248 LCKNNFSGQIP-SFIGNLSQLTRLDLSSNNFFGEIPGWLWTLPNLFYVNLSYNTFIGFQR 306

Query:    58 V--PPPSTRAFLFSNNKLFGQXXXXXXXXXXXXXXXXXHNNLSGTIPPCLGNFSTQLTIL 115
                P PS    L SNN   G+                  NN SG IP C+GN  + L+ L
Sbjct:   307 PNKPEPSMGHLLGSNNNFTGKIPSFICELRSLETLDLSDNNFSGLIPRCMGNLKSNLSHL 366

Query:   116 HLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTF 175
             +L  N L G +P         LRSL +  N+L G  PR L   + LEV+NV +N I DTF
Sbjct:   367 NLRQNNLSGGLPKHIFE---ILRSLDVGHNQLVGKLPRSLRFFSTLEVLNVESNRINDTF 423

Query:   176 PSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLET 235
             P WL SLP L++LVLRSN F+GP+ E +    F  LRIID+SHN F G LP   FV    
Sbjct:   424 PFWLTSLPKLQVLVLRSNAFHGPIHEAS----FLKLRIIDISHNHFNGTLPSDYFVKWSA 479

Query:   236 MKNV--DEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIP 293
             M ++  DE  S+  YM G   YYQDS+ +  KG +  L RI+TI+T +D S N+F+GEIP
Sbjct:   480 MSSLGTDEDRSNANYM-GSV-YYQDSMVLMNKGVESELIRILTIYTALDFSGNKFEGEIP 537

Query:   294 QVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEI--CS 351
             + +G  K L+VLNLS+N  TG IP S   +  LESLD+S NKL+G IP++  +     C 
Sbjct:   538 KSIGLLKELLVLNLSNNAFTGHIPSSMGKLTALESLDVSQNKLYGEIPQEIGNLSFLSCM 597

Query:   352 SFARPDL 358
             +F+   L
Sbjct:   598 NFSHNQL 604


GO:0005886 "plasma membrane" evidence=ISM
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046397 RLP22 "receptor like protein 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173777 RLP54 "receptor like protein 54" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_scaffold_182000003
hypothetical protein (921 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-30
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-26
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-11
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  143 bits (363), Expect = 1e-37
 Identities = 114/342 (33%), Positives = 160/342 (46%), Gaps = 45/342 (13%)

Query: 1   LSNNRIRGRISKSDSQRWKSLTYLDISNNFLT-QIEQHPWKNITVLNLQNNTIQGTILVP 59
           L  N++ G I  S     + L  LD+S+N L+ +I +       V+ LQN  I       
Sbjct: 267 LYQNKLSGPIPPSIFS-LQKLISLDLSDNSLSGEIPE------LVIQLQNLEI------- 312

Query: 60  PPSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNN 119
                  LFSNN   G+IP ++ SL  L+ + L  N  SG IP  LG     LT+L L+ 
Sbjct: 313 -----LHLFSNN-FTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGK-HNNLTVLDLST 365

Query: 120 NYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWL 179
           N L G IP+   + S +L  L L SN L G  P+ L  C  L  V + +N      PS  
Sbjct: 366 NNLTGEIPEGLCS-SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEF 424

Query: 180 GSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNV 239
             LP +  L + +N   G +      +P  +L+++ L+ N+F G LP             
Sbjct: 425 TKLPLVYFLDISNNNLQGRINSRKWDMP--SLQMLSLARNKFFGGLP------------- 469

Query: 240 DEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDF 299
           D  GS  L      D  ++  +  V  +   L  ++ +     LS N+  GEIP  L   
Sbjct: 470 DSFGSKRL---ENLDLSRNQFSGAVPRKLGSLSELMQL----KLSENKLSGEIPDELSSC 522

Query: 300 KSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIP 341
           K L+ L+LSHN L+G IP SF+ M VL  LDLS N+L G IP
Sbjct: 523 KKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIP 564


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 362
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.42
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.3
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.22
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.05
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.05
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
PLN03150623 hypothetical protein; Provisional 98.87
PLN03150623 hypothetical protein; Provisional 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.82
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.71
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.55
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.49
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.47
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.33
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.26
KOG4341483 consensus F-box protein containing LRR [General fu 98.25
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.18
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.1
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
KOG4341483 consensus F-box protein containing LRR [General fu 98.05
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.98
PRK15386426 type III secretion protein GogB; Provisional 97.91
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.91
PRK15386 426 type III secretion protein GogB; Provisional 97.81
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.56
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.41
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.07
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.85
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.71
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.55
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.38
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.31
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.95
KOG4308 478 consensus LRR-containing protein [Function unknown 94.76
KOG4308 478 consensus LRR-containing protein [Function unknown 94.75
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.2
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.07
smart0037026 LRR Leucine-rich repeats, outliers. 92.64
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.64
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.61
smart0037026 LRR Leucine-rich repeats, outliers. 91.84
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.84
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 82.9
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.24
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 80.84
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.15
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.7e-36  Score=301.51  Aligned_cols=346  Identities=29%  Similarity=0.400  Sum_probs=180.6

Q ss_pred             CCCcccccCCccccccCCCCcEEEcCCCccc-cccc---CCcCCCcEEEccCCcCCCCCCC-CCCCccEEEccCcccccC
Q 044176            2 SNNRIRGRISKSDSQRWKSLTYLDISNNFLT-QIEQ---HPWKNITVLNLQNNTIQGTILV-PPPSTRAFLFSNNKLFGQ   76 (362)
Q Consensus         2 ~~n~~~~~~~~~~~~~~~~L~~L~ls~~~i~-~~~~---~~~~~L~~L~l~~n~~~~~~~~-~~~~L~~L~l~~~~~~~~   76 (362)
                      ++|+++|.+|.. +..+++|+.|++++|+++ .++.   ..+++|++|++++|.+.+..+. .+++|++|++++|.+.+.
T Consensus        77 ~~~~i~~~~~~~-~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~  155 (968)
T PLN00113         77 SGKNISGKISSA-IFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGE  155 (968)
T ss_pred             cCCCccccCChH-HhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCccccc
Confidence            455666555443 333466666666666665 2333   1455666666666666544333 256666666666666555


Q ss_pred             CcccccCCCCCCEEEcccCcccccCCCCcccccccccEEEcccccccCcchhhhhcCCCCccEEeccCCcccCCCchhhh
Q 044176           77 IPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLA  156 (362)
Q Consensus        77 ~~~~~~~l~~L~~L~L~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~  156 (362)
                      .|..++++++|++|++++|.+.+.+|..+..+ ++|++|++++|.+.+..|..+... ++|++|++++|.+.+..|..++
T Consensus       156 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l-~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~L~~n~l~~~~p~~l~  233 (968)
T PLN00113        156 IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNL-TSLEFLTLASNQLVGQIPRELGQM-KSLKWIYLGYNNLSGEIPYEIG  233 (968)
T ss_pred             CChHHhcCCCCCEEECccCcccccCChhhhhC-cCCCeeeccCCCCcCcCChHHcCc-CCccEEECcCCccCCcCChhHh
Confidence            56666666666666666666555555555555 456666666666555555555443 5566666666665555555556


Q ss_pred             cCCCCcEEEccCCCCCCCcchhccCCCCCCeEEccCCcCCCccccccccccCCcccEEeccCCcccCCCchhHHhhhhhh
Q 044176          157 DCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETM  236 (362)
Q Consensus       157 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~l  236 (362)
                      .+++|+.|++++|.+.+..|..++.+++|++|++++|.+.+..+...  ..+++|++|++++|.+.+..|.. +..+++|
T Consensus       234 ~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l--~~l~~L~~L~Ls~n~l~~~~p~~-~~~l~~L  310 (968)
T PLN00113        234 GLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSI--FSLQKLISLDLSDNSLSGEIPEL-VIQLQNL  310 (968)
T ss_pred             cCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhH--hhccCcCEEECcCCeeccCCChh-HcCCCCC
Confidence            66666666666665555555555555566666665555544333322  34455555555555554444433 3344444


Q ss_pred             hhccccCCCccccc-------------------------CCccccccceeeee--cC---cchHhhhhcccccEEeccCc
Q 044176          237 KNVDEKGSDGLYMQ-------------------------GEEDYYQDSVTVTV--KG---RDLVLKRIITIFTTIDLSSN  286 (362)
Q Consensus       237 ~~l~~~~~~~~~~~-------------------------~~~~~~~~~~~~~~--~~---~~~~~~~~~~~L~~L~l~~n  286 (362)
                      +.+++.++......                         ...........+..  ..   ........+++++.|++++|
T Consensus       311 ~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n  390 (968)
T PLN00113        311 EILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSN  390 (968)
T ss_pred             cEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCC
Confidence            44444443221110                         00000000000000  00   00111112344555555555


Q ss_pred             ccCCCcchhhcCCCCCcEEEccCCcCccCchhhhhcCCCcCEEEccCCcccccCchhhhhhHhhhcc
Q 044176          287 QFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSF  353 (362)
Q Consensus       287 ~~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~l  353 (362)
                      .+++..|..+..+++|+.|++++|.+++..|..+..++.|+.|++++|++++.+|..+..+++|+.|
T Consensus       391 ~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L  457 (968)
T PLN00113        391 SLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQML  457 (968)
T ss_pred             EecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEE
Confidence            5555555555555666666666666655555666666666666666666666555555555555554



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-25
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 6e-14
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 9e-06
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-25
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-14
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-06
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-07
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 112 bits (279), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 116/383 (30%), Positives = 165/383 (43%), Gaps = 71/383 (18%) Query: 1 LSNNRIRGRISKSDSQRWKSLTYLDIS-NNF----LTQIEQHPWKNITVLNLQNNTIQGT 55 LS N G + +S + SL LD+S NNF L + Q+P + L LQNN G Sbjct: 350 LSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK 409 Query: 56 ILVPPPSTRAFLFSNNKLFGQXXXXXXXXXXXXXXXXXHNNLSGTIPPCLGNFSTQLTIL 115 I PP+ SN N LSGTIP LG+ S +L L Sbjct: 410 I---PPT-----LSN-------------CSELVSLHLSFNYLSGTIPSSLGSLS-KLRDL 447 Query: 116 HLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTF 175 L N L+G IP L +L L+ N L G P L++CT L +++ NN + Sbjct: 448 KLWLNMLEGEIPQELMYVKT-LETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEI 506 Query: 176 PSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFE-----ALRIIDLSHNEFTGFLP---- 226 P W+G L L IL L +N F G +P E +L +DL+ N F G +P Sbjct: 507 PKWIGRLENLAILKLSNNSFSG-------NIPAELGDCRSLIWLDLNTNLFNGTIPAAMF 559 Query: 227 --------------RWIFVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLK 272 R++++ + MK + L QG + ++ + + Sbjct: 560 KQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLN--RLSTRNPCNITS 617 Query: 273 RIITIFTT-----------IDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFA 321 R+ T+ +D+S N G IP+ +G L +LNL HN ++GSIP Sbjct: 618 RVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVG 677 Query: 322 NMIVLESLDLSSNKLHGRIPEQF 344 ++ L LDLSSNKL GRIP+ Sbjct: 678 DLRGLNILDLSSNKLDGRIPQAM 700
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query362
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-65
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-60
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-56
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-53
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-52
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-49
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-47
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-29
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-44
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-26
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-31
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-29
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-27
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-16
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-16
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-10
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-19
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-05
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-14
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  218 bits (557), Expect = 9e-65
 Identities = 87/357 (24%), Positives = 131/357 (36%), Gaps = 66/357 (18%)

Query: 1   LSNNRIRGRISKSDSQRWKSLTYLDISNNFLT-QIEQHP-----WKNITVLNLQNNTIQG 54
           L NN   G+I  + S     L  L +S N+L+  I   P        +  L L  N ++G
Sbjct: 401 LQNNGFTGKIPPTLSN-CSELVSLHLSFNYLSGTI---PSSLGSLSKLRDLKLWLNMLEG 456

Query: 55  TILVPP-----PSTRAFLFSNNKLFGQIPPSIYSLSSLEYISLSHNNLSGTIPPCLGNFS 109
            I  P       +    +   N L G+IP  + + ++L +ISLS+N L+G IP  +G   
Sbjct: 457 EI--PQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLE 514

Query: 110 TQLTILHLNNNYLQGRIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNN 169
             L IL L+NN   G IP    +    L  L LN+N   G+ P  +   +G     +  N
Sbjct: 515 -NLAILKLSNNSFSGNIPAELGDCR-SLIWLDLNTNLFNGTIPAAMFKQSGK----IAAN 568

Query: 170 MIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIMLPFEALRIIDLSHNEFTGFLPRWI 229
            I      ++ +    K      N           +         +++   + G      
Sbjct: 569 FIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF 628

Query: 230 FVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIFTTIDLSSNQFQ 289
                                                              +D+S N   
Sbjct: 629 -------------------------------------------DNNGSMMFLDMSYNMLS 645

Query: 290 GEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVD 346
           G IP+ +G    L +LNL HN ++GSIP    ++  L  LDLSSNKL GRIP+    
Sbjct: 646 GYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSA 702


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.28
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.25
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.97
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.95
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.94
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.62
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.47
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.01
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.79
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.5
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.63
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-39  Score=317.69  Aligned_cols=353  Identities=30%  Similarity=0.409  Sum_probs=194.1

Q ss_pred             CCCCcccccCCccccccCCCCcEEEcCCCccccccc---CCcCCCcEEEccCCcCCCCC----CCCCCCccEEEccCccc
Q 044176            1 LSNNRIRGRISKSDSQRWKSLTYLDISNNFLTQIEQ---HPWKNITVLNLQNNTIQGTI----LVPPPSTRAFLFSNNKL   73 (362)
Q Consensus         1 L~~n~~~~~~~~~~~~~~~~L~~L~ls~~~i~~~~~---~~~~~L~~L~l~~n~~~~~~----~~~~~~L~~L~l~~~~~   73 (362)
                      |++|+++|.+|..++..+++|+.|++++|.++...+   ..+++|+.|++++|.+.+..    +..+++|++|++++|.+
T Consensus       276 L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l  355 (768)
T 3rgz_A          276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF  355 (768)
T ss_dssp             CCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEE
T ss_pred             CcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCcc
Confidence            355666666666665555666666666666554333   24455555555555544221    22344455555555544


Q ss_pred             ccCCcccccCCC-C--------------------------CCEEEcccCcccccCCCCcccccccccEEEcccccccCcc
Q 044176           74 FGQIPPSIYSLS-S--------------------------LEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQGRI  126 (362)
Q Consensus        74 ~~~~~~~~~~l~-~--------------------------L~~L~L~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~  126 (362)
                      .+.+|..+.+++ +                          |++|++++|.+++.+|..+..+ ++|++|++++|.+.+..
T Consensus       356 ~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~Ls~N~l~~~~  434 (768)
T 3rgz_A          356 SGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC-SELVSLHLSFNYLSGTI  434 (768)
T ss_dssp             EECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGC-TTCCEEECCSSEEESCC
T ss_pred             CccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcC-CCCCEEECcCCcccCcc
Confidence            444444443333 3                          3333333333333333334333 34445555554444444


Q ss_pred             hhhhhcCCCCccEEeccCCcccCCCchhhhcCCCCcEEEccCCCCCCCcchhccCCCCCCeEEccCCcCCCccccccccc
Q 044176          127 PDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLCEVNIML  206 (362)
Q Consensus       127 ~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~  206 (362)
                      |..+... ++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..|..++.+++|++|++++|.+.+..+..+  .
T Consensus       435 p~~l~~l-~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~--~  511 (768)
T 3rgz_A          435 PSSLGSL-SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWI--G  511 (768)
T ss_dssp             CGGGGGC-TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG--G
T ss_pred             cHHHhcC-CCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHH--h
Confidence            4444433 445555555555544445555555555555555555544445555555555555555555554444332  4


Q ss_pred             cCCcccEEeccCCcccCCCchhHHhhhhhhhhccccCCCcc-cccCCccc---------cc-------------------
Q 044176          207 PFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGL-YMQGEEDY---------YQ-------------------  257 (362)
Q Consensus       207 ~~~~L~~L~l~~n~~~~~~~~~~~~~~~~l~~l~~~~~~~~-~~~~~~~~---------~~-------------------  257 (362)
                      .+++|++|++++|.+.+..|.. +..+++|+.+++.++... .++.....         ..                   
T Consensus       512 ~l~~L~~L~L~~N~l~~~~p~~-l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  590 (768)
T 3rgz_A          512 RLENLAILKLSNNSFSGNIPAE-LGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGA  590 (768)
T ss_dssp             GCTTCCEEECCSSCCEEECCGG-GGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSS
T ss_pred             cCCCCCEEECCCCcccCcCCHH-HcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccc
Confidence            4555555555555555444443 444555555555544322 00000000         00                   


Q ss_pred             -------cc----------------eeeeecCcchHhhhhcccccEEeccCcccCCCcchhhcCCCCCcEEEccCCcCcc
Q 044176          258 -------DS----------------VTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTG  314 (362)
Q Consensus       258 -------~~----------------~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~i~~  314 (362)
                             ..                ...............+++|+.||+++|++++.+|..++.+++|+.|+|++|++++
T Consensus       591 ~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g  670 (768)
T 3rgz_A          591 GNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG  670 (768)
T ss_dssp             EEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             ccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCC
Confidence                   00                0000000011112235778899999999988889889999999999999999998


Q ss_pred             CchhhhhcCCCcCEEEccCCcccccCchhhhhhHhhhccCCCccccC
Q 044176          315 SIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSFARPDLYTN  361 (362)
Q Consensus       315 ~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~l~~~~l~~n  361 (362)
                      .+|..+..+++|+.||+++|++++.+|+.+..++.|++|   ++++|
T Consensus       671 ~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L---~ls~N  714 (768)
T 3rgz_A          671 SIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEI---DLSNN  714 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEE---ECCSS
T ss_pred             CCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEE---ECcCC
Confidence            899999999999999999999999999888887777776   66666



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 362
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-10
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-05
d1xwdc1 242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 84.0 bits (206), Expect = 7e-19
 Identities = 50/263 (19%), Positives = 89/263 (33%), Gaps = 6/263 (2%)

Query: 83  SLSSLEYISLSHNNLSG--TIPPCLGNFSTQLTILHLNNNYLQGRIPDAFANGSCDLRSL 140
               +  + LS  NL     IP  L N    L  L++                   L  L
Sbjct: 48  QTYRVNNLDLSGLNLPKPYPIPSSLANL-PYLNFLYIGGINNLVGPIPPAIAKLTQLHYL 106

Query: 141 GLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGPLC 200
            +    + G+ P +L+    L  ++   N +  T P  + SLP L  +    NR  G + 
Sbjct: 107 YITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP 166

Query: 201 EVNIMLPFEALRIIDLSHN--EFTGFLPRWIFVSLETMKNVDEKGSDGLYMQGEEDYYQD 258
           +           +    +            + ++   +     +G   +    +++  + 
Sbjct: 167 DSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKI 226

Query: 259 SVTVTVKGRDLVLKRIITIFTTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPV 318
            +       DL    +      +DL +N+  G +PQ L   K L  LN+S N L G IP 
Sbjct: 227 HLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP- 285

Query: 319 SFANMIVLESLDLSSNKLHGRIP 341
              N+   +    ++NK     P
Sbjct: 286 QGGNLQRFDVSAYANNKCLCGSP 308


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query362
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.05
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.19
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.87
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.45
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.96  E-value=1.6e-27  Score=212.17  Aligned_cols=312  Identities=20%  Similarity=0.262  Sum_probs=204.8

Q ss_pred             CCCcccccCCccccccCCCCcEEEcCCCccccccc-CCcCCCcEEEccCCcCCCCC-CCCCCCccEEEccCcccccCCcc
Q 044176            2 SNNRIRGRISKSDSQRWKSLTYLDISNNFLTQIEQ-HPWKNITVLNLQNNTIQGTI-LVPPPSTRAFLFSNNKLFGQIPP   79 (362)
Q Consensus         2 ~~n~~~~~~~~~~~~~~~~L~~L~ls~~~i~~~~~-~~~~~L~~L~l~~n~~~~~~-~~~~~~L~~L~l~~~~~~~~~~~   79 (362)
                      ..+.++|.+..+   .+.+|+.|+++++.|+++.+ ..+++|++|++++|.+++.. +..+++|++|++++|.+.+.  .
T Consensus        30 ~~~~~~~~~~~~---~l~~l~~L~l~~~~I~~l~gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i--~  104 (384)
T d2omza2          30 GKTNVTDTVSQT---DLDQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADI--T  104 (384)
T ss_dssp             TCSSTTSEECHH---HHTTCCEEECCSSCCCCCTTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCC--G
T ss_pred             CCCCCCCccCHH---HhCCCCEEECCCCCCCCccccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccc--c
Confidence            345566554442   24789999999999999876 67899999999999998865 56699999999999999854  3


Q ss_pred             cccCCCCCCEEEcccCcccccCCCCcccccccccEEEcccccccC-----------------------------------
Q 044176           80 SIYSLSSLEYISLSHNNLSGTIPPCLGNFSTQLTILHLNNNYLQG-----------------------------------  124 (362)
Q Consensus        80 ~~~~l~~L~~L~L~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~-----------------------------------  124 (362)
                      .++++++|+.|+++++.+++ ++... .. ..+.......+.+..                                   
T Consensus       105 ~l~~l~~L~~L~~~~~~~~~-~~~~~-~~-~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  181 (384)
T d2omza2         105 PLANLTNLTGLTLFNNQITD-IDPLK-NL-TNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLD  181 (384)
T ss_dssp             GGTTCTTCCEEECCSSCCCC-CGGGT-TC-TTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEE
T ss_pred             cccccccccccccccccccc-ccccc-cc-ccccccccccccccccccccccccccccccccccchhhhhcccccccccc
Confidence            48899999999999998873 22211 11 223333333222210                                   


Q ss_pred             ------cchhhhhcCCCCccEEeccCCcccCCCchhhhcCCCCcEEEccCCCCCCCcchhccCCCCCCeEEccCCcCCCc
Q 044176          125 ------RIPDAFANGSCDLRSLGLNSNKLRGSFPRYLADCTGLEVVNVGNNMIGDTFPSWLGSLPGLKILVLRSNRFYGP  198 (362)
Q Consensus       125 ------~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~  198 (362)
                            .....+. .+++++.+.+++|.+++..+  +..+++|+.+++++|.+++.  ..+..+++|+.+++++|.+.+.
T Consensus       182 ~~~~~~~~~~~~~-~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~--~~l~~l~~L~~L~l~~n~l~~~  256 (384)
T d2omza2         182 ISSNKVSDISVLA-KLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNL  256 (384)
T ss_dssp             CCSSCCCCCGGGG-GCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCSSCCCCC
T ss_pred             ccccccccccccc-cccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCc--chhhcccccchhccccCccCCC
Confidence                  0111122 22456666666666653322  34456666666666666432  2355566666666666665543


Q ss_pred             cccccccccCCcccEEeccCCcccCCCchhHHhhhhhhhhccccCCCcccccCCccccccceeeeecCcchHhhhhcccc
Q 044176          199 LCEVNIMLPFEALRIIDLSHNEFTGFLPRWIFVSLETMKNVDEKGSDGLYMQGEEDYYQDSVTVTVKGRDLVLKRIITIF  278 (362)
Q Consensus       199 ~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L  278 (362)
                      .+    +..+++|++++++++.+.+..+   +..+..++.+....+....                    ......++++
T Consensus       257 ~~----~~~~~~L~~L~l~~~~l~~~~~---~~~~~~l~~l~~~~n~l~~--------------------~~~~~~~~~l  309 (384)
T d2omza2         257 AP----LSGLTKLTELKLGANQISNISP---LAGLTALTNLELNENQLED--------------------ISPISNLKNL  309 (384)
T ss_dssp             GG----GTTCTTCSEEECCSSCCCCCGG---GTTCTTCSEEECCSSCCSC--------------------CGGGGGCTTC
T ss_pred             Cc----ccccccCCEeeccCcccCCCCc---ccccccccccccccccccc--------------------ccccchhccc
Confidence            22    2445666666666666653322   2333444444433332111                    1123347889


Q ss_pred             cEEeccCcccCCCcchhhcCCCCCcEEEccCCcCccCchhhhhcCCCcCEEEccCCcccccCchhhhhhHhhhccCCCcc
Q 044176          279 TTIDLSSNQFQGEIPQVLGDFKSLIVLNLSHNGLTGSIPVSFANMIVLESLDLSSNKLHGRIPEQFVDAEICSSFARPDL  358 (362)
Q Consensus       279 ~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~l~~~~l  358 (362)
                      +.|++++|++++..  .+..+++|++|++++|++++ + ..+..+++|++|++++|++++..|  +.++++|+.|   ++
T Consensus       310 ~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l~~-l-~~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L---~L  380 (384)
T d2omza2         310 TYLTLYFNNISDIS--PVSSLTKLQRLFFANNKVSD-V-SSLANLTNINWLSAGHNQISDLTP--LANLTRITQL---GL  380 (384)
T ss_dssp             SEEECCSSCCSCCG--GGGGCTTCCEEECCSSCCCC-C-GGGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEE---EC
T ss_pred             CeEECCCCCCCCCc--ccccCCCCCEEECCCCCCCC-C-hhHcCCCCCCEEECCCCcCCCChh--hccCCCCCEe---eC
Confidence            99999999998653  37889999999999999984 3 369999999999999999996544  7777777777   88


Q ss_pred             ccCC
Q 044176          359 YTNA  362 (362)
Q Consensus       359 ~~n~  362 (362)
                      ++||
T Consensus       381 ~~Na  384 (384)
T d2omza2         381 NDQA  384 (384)
T ss_dssp             CCEE
T ss_pred             CCCc
Confidence            8886



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure