Citrus Sinensis ID: 044222

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLSLDDDAAVRVTPFLHKLFKDYVDPDEVPTPLPNHKTCVALEVVGHPSEFCL
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccEEccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccEEEEEccccccccc
MELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQqglkgnsyrllfgdLKESTIMLKKAkarplsldddaavrVTPFLHKLFkdyvdpdevptplpnhktcvalevvghpsefcl
MELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLrqqglkgnsyrllfgdLKESTIMLKKAkarplsldddaaVRVTPFLHKLFKDYVDPDEVPTPLPNHKTCVALEVVGHPSEFCL
MELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLSLDDDAAVRVTPFLHKLFKDYVDPDEVPTPLPNHKTCVALEVVGHPSEFCL
****LKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLSLDDDAAVRVTPFLHKLFKDYVDPDEVPTPLPNHKTCVALEVVG*******
**LTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLK*****************DDAAVRVTPFLHKLFKDYVDPDEVPTPLPNHKTCVALEVVGHPSEFCL
MELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLSLDDDAAVRVTPFLHKLFKDYVDPDEVPTPLPNHKTCVALEVVGHPSEFCL
*ELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLSLDDDAAVRVTPFLHKLFKDYVDPDEVPTPLPNHKTCVALEVVGHPSEFCL
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLSLDDDAAVRVTPFLHKLFKDYVDPDEVPTPLPNHKTCVALEVVGHPSEFCL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
Q9SHG5 519 Cytochrome P450 72C1 OS=A no no 0.688 0.161 0.464 1e-18
Q05047 524 Secologanin synthase OS=C N/A no 0.745 0.173 0.413 1e-16
O48786 520 Cytochrome P450 734A1 OS= no no 0.639 0.15 0.362 5e-07
Q6Z6D6 557 Cytochrome P450 734A2 OS= no no 0.532 0.116 0.358 8e-06
Q69XM6 538 Cytochrome P450 734A4 OS= no no 0.565 0.128 0.338 7e-05
Q8LIF2 537 Cytochrome P450 734A5 OS= no no 0.532 0.121 0.343 0.0001
B9X287 542 Cytochrome P450 734A6 OS= no no 0.565 0.127 0.333 0.0003
>sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 Back     alignment and function desciption
 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%)

Query: 3  LTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESTIM 62
          +T++ V     ++ ++ W W  +NW+WLRPK+LEK+L++QG  GNSYR+L GD++ES  M
Sbjct: 5  ITVRKVFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQM 64

Query: 63 LKKAKARPLSLDDDAAVRVTPFLH 86
           + A + PL LD D   R+ PFLH
Sbjct: 65 DQVAHSLPLPLDADFLPRMMPFLH 88
Atypical cytochrome P450 involved in brassinosteroids (BRs) inactivation and regulation of BRs homeostasis. Does not possess carbon 26 hydroxylase activity and may inactivate BRs by hydroxylation of carbons other than C-26. Acts in association with CYP734A1 to inactivate BRs and modulate photomorphogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
22411914696 predicted protein [Populus trichocarpa] 0.786 1.0 0.562 4e-24
224119126 518 cytochrome P450 [Populus trichocarpa] gi 0.754 0.177 0.565 8e-24
224119134 518 cytochrome P450 [Populus trichocarpa] gi 0.754 0.177 0.565 1e-23
224105979 518 cytochrome P450 [Populus trichocarpa] gi 0.754 0.177 0.554 3e-23
224113635104 cytochrome P450 [Populus trichocarpa] gi 0.754 0.884 0.554 5e-23
147816915 299 hypothetical protein VITISV_032612 [Viti 0.721 0.294 0.522 2e-22
359494197 526 PREDICTED: secologanin synthase-like [Vi 0.688 0.159 0.571 4e-22
147795635 518 hypothetical protein VITISV_015554 [Viti 0.754 0.177 0.526 5e-22
359494591 391 PREDICTED: secologanin synthase-like [Vi 0.688 0.214 0.571 5e-22
296082828 443 unnamed protein product [Vitis vinifera] 0.754 0.207 0.516 1e-21
>gi|224119146|ref|XP_002331336.1| predicted protein [Populus trichocarpa] gi|222873919|gb|EEF11050.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (70%)

Query: 1  MELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKEST 60
          M +T+ S+  +IV V +V WAW VLNW+W RPKK+E+ LRQQG  G  YRLLFGD KES+
Sbjct: 1  MTVTVSSILVSIVYVAVVRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKESS 60

Query: 61 IMLKKAKARPLSLDDDAAVRVTPFLHKLFKDYVDPD 96
           MLK+A+ +P+ L D    RV PFLH+L KDY   D
Sbjct: 61 DMLKEARTKPIGLSDALLPRVMPFLHQLVKDYGGND 96

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224119126|ref|XP_002331331.1| cytochrome P450 [Populus trichocarpa] gi|222873914|gb|EEF11045.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224119134|ref|XP_002331333.1| cytochrome P450 [Populus trichocarpa] gi|222873916|gb|EEF11047.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105979|ref|XP_002333744.1| cytochrome P450 [Populus trichocarpa] gi|222838385|gb|EEE76750.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113635|ref|XP_002332522.1| cytochrome P450 [Populus trichocarpa] gi|222832634|gb|EEE71111.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147816915|emb|CAN71060.1| hypothetical protein VITISV_032612 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494197|ref|XP_002265784.2| PREDICTED: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147795635|emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494591|ref|XP_003634812.1| PREDICTED: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082828|emb|CBI22129.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
TAIR|locus:2089521 512 CYP72A15 ""cytochrome P450, fa 0.754 0.179 0.434 1.9e-18
TAIR|locus:2089586 512 CYP72A11 ""cytochrome P450, fa 0.754 0.179 0.380 2.8e-16
TAIR|locus:2089561 514 CYP72A10 ""cytochrome P450, fa 0.754 0.178 0.391 7.7e-16
TAIR|locus:2089531 515 CYP72A8 ""cytochrome P450, fam 0.745 0.176 0.423 7.7e-16
TAIR|locus:2089596 512 CYP72A13 ""cytochrome P450, fa 0.754 0.179 0.391 9.8e-16
TAIR|locus:2089621 512 CYP72A14 ""cytochrome P450, fa 0.754 0.179 0.391 5.6e-15
TAIR|locus:2089546 508 CYP72A9 ""cytochrome P450, fam 0.713 0.171 0.387 1.1e-13
TAIR|locus:2089526 512 CYP72A7 ""cytochrome P450, fam 0.688 0.164 0.333 1.4e-13
TAIR|locus:2043823 520 BAS1 "PHYB ACTIVATION TAGGED S 0.639 0.15 0.362 4.4e-07
UNIPROTKB|Q69XM6 538 CYP734A4 "Cytochrome P450 734A 0.721 0.163 0.311 2.6e-06
TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 230 (86.0 bits), Expect = 1.9e-18, P = 1.9e-18
 Identities = 40/92 (43%), Positives = 61/92 (66%)

Query:     1 MELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKEST 60
             ME+++ SV  ++V+  +  W W  L W+W +PK LE +LR+QGL G  Y  L GDLK++ 
Sbjct:     1 MEISVASVTISVVLAVVSWWIWRTLQWVWFKPKMLEHYLRRQGLAGTPYTPLVGDLKKNF 60

Query:    61 IMLKKAKARPLSLDDDAAVRVTPFLHKLFKDY 92
              ML +A+++PL L DD + RV P+  ++FK Y
Sbjct:    61 TMLSEARSKPLKLTDDISPRVVPYPLQMFKTY 92
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2089586 CYP72A11 ""cytochrome P450, family 72, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089531 CYP72A8 ""cytochrome P450, family 72, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089596 CYP72A13 ""cytochrome P450, family 72, subfamily A, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089526 CYP72A7 ""cytochrome P450, family 72, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043823 BAS1 "PHYB ACTIVATION TAGGED SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q69XM6 CYP734A4 "Cytochrome P450 734A4" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-06
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information 
 Score = 44.4 bits (105), Expect = 2e-06
 Identities = 18/84 (21%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 1  MELTLKSVAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKEST 60
          + + LK +   I +  L+  A+  ++  +L P++++K + +QG++G   R L G++ + +
Sbjct: 2  LGVVLKVLL-VIFLTLLLRVAYDTISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVS 60

Query: 61 IMLKKAKARPL-SLDDDAAVRVTP 83
           ++ ++ ++ + S+  D   R+ P
Sbjct: 61 ALVSQSTSKDMDSIHHDIVGRLLP 84

Length = 516

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
PLN02290 516 cytokinin trans-hydroxylase 99.71
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.2
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.1
PTZ00404 482 cytochrome P450; Provisional 98.96
PLN00168 519 Cytochrome P450; Provisional 98.77
PLN02183 516 ferulate 5-hydroxylase 98.75
PLN03234 499 cytochrome P450 83B1; Provisional 98.68
PLN02971 543 tryptophan N-hydroxylase 98.67
PLN02687 517 flavonoid 3'-monooxygenase 98.66
PLN03112 514 cytochrome P450 family protein; Provisional 98.65
PLN02966 502 cytochrome P450 83A1 98.63
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 98.62
PLN02500 490 cytochrome P450 90B1 98.58
PLN02302 490 ent-kaurenoic acid oxidase 98.57
PLN02394 503 trans-cinnamate 4-monooxygenase 98.55
PLN02196 463 abscisic acid 8'-hydroxylase 98.55
PLN02774 463 brassinosteroid-6-oxidase 98.44
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 98.33
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 98.32
PLN02655 466 ent-kaurene oxidase 98.32
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 98.29
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 98.26
PLN02738 633 carotene beta-ring hydroxylase 98.14
PLN03195 516 fatty acid omega-hydroxylase; Provisional 98.11
PLN02987 472 Cytochrome P450, family 90, subfamily A 98.09
PLN03018 534 homomethionine N-hydroxylase 97.82
PLN02936 489 epsilon-ring hydroxylase 96.72
PLN02648 480 allene oxide synthase 95.65
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 93.47
PLN02426 502 cytochrome P450, family 94, subfamily C protein 85.77
COG3898 531 Uncharacterized membrane-bound protein [Function u 83.42
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information 
Probab=99.71  E-value=2e-16  Score=131.01  Aligned_cols=104  Identities=17%  Similarity=0.321  Sum_probs=84.8

Q ss_pred             HHHHHHHHHHHHHHhcchhhHHHHHHcCCCCCCCccCCCCHHHHHHHHHHhhcCCCC-CCCCcccchhHHHHHHHhhhCC
Q 044222           16 TLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLS-LDDDAAVRVTPFLHKLFKDYVD   94 (122)
Q Consensus        16 ~~~~~~~~~~~~~w~~P~rl~~~l~~qGI~GP~p~~l~GN~~e~~~~~~~a~~~~~~-~~hdi~~~v~p~~~~w~k~YGk   94 (122)
                      .+.-++++.+.+++++|+++.++|+++|+|||+|.+++||+.++......+..++++ ..+|+..+..+++.+|.++||+
T Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGP~~~P~iGnl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~   95 (516)
T PLN02290         16 LLLRVAYDTISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALVSQSTSKDMDSIHHDIVGRLLPHYVAWSKQYGK   95 (516)
T ss_pred             HHHHHHHHHHHHHhccHHHHHHHHHHcCCCCCCCCcCCCCHHHHHHHHHHhhcCCCCCCCcccccccchHHHHHHHHhCC
Confidence            344467888899999999999999999999999999999999986544444344443 2455556666788899999999


Q ss_pred             Cc---cCCcceEEEeh-hHHHHHhhcCCc
Q 044222           95 PD---EVPTPLPNHKT-CVALEVVGHPSE  119 (122)
Q Consensus        95 vf---~G~~P~l~Isd-~~ikeIl~K~~~  119 (122)
                      +|   .|..|.++++| +.+|||+.+.+.
T Consensus        96 i~~~~~g~~~~vvv~dp~~v~~il~~~~~  124 (516)
T PLN02290         96 RFIYWNGTEPRLCLTETELIKELLTKYNT  124 (516)
T ss_pred             eEEEccCCccEEEECCHHHHHHHHhcCCC
Confidence            88   99999999999 999999987644

>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.09
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 98.77
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 98.68
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 98.64
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 98.45
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 98.45
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 98.42
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 98.42
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 98.38
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 98.36
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.33
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 98.29
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 98.28
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 98.24
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 98.23
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 98.23
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 98.18
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 98.17
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 98.14
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 98.1
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 98.08
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 98.01
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 97.98
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 97.96
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 97.88
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 97.83
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 97.19
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 96.74
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 96.71
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 96.55
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 96.54
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 96.53
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 96.33
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 96.09
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 96.04
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 96.0
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 95.99
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 95.83
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 95.81
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 95.81
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 95.78
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 95.77
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 95.7
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 95.69
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 95.6
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 95.59
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 95.41
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 95.38
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 95.25
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 95.16
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 95.05
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 94.43
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 94.11
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 93.81
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 93.64
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 93.15
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 93.07
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 91.17
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 90.81
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 90.64
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 90.45
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 90.38
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 90.27
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 90.0
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 89.23
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 88.74
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 88.32
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 86.15
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 81.08
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.09  E-value=7.8e-11  Score=93.72  Aligned_cols=64  Identities=13%  Similarity=0.128  Sum_probs=54.6

Q ss_pred             HHHHHHcCCCCCCCccCCCCHHHHHHHHHHhhcCCCCCCCCcccchhHHHHHHHhhhCCCc---cCCcceEEEeh-hHHH
Q 044222           36 EKFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLSLDDDAAVRVTPFLHKLFKDYVDPD---EVPTPLPNHKT-CVAL  111 (122)
Q Consensus        36 ~~~l~~qGI~GP~p~~l~GN~~e~~~~~~~a~~~~~~~~hdi~~~v~p~~~~w~k~YGkvf---~G~~P~l~Isd-~~ik  111 (122)
                      ..+|+++|+|||++.|++||+.++.+                  ....++.+|.++||++|   .|.+|.++|+| +.+|
T Consensus         8 ~~~~k~~~~PGP~~~PliGn~~~~~~------------------~~~~~~~~~~~~yG~i~~~~~g~~~~vvv~dp~~i~   69 (485)
T 3nxu_A            8 HGLFKKLGIPGPTPLPFLGNILSYHK------------------GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIK   69 (485)
T ss_dssp             TTHHHHHTCCCCCCBTTTBTGGGGGG------------------CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHH
T ss_pred             chHHhhCCCCCCCCcCeecCcHHhhc------------------ChHHHHHHHHHHcCCeEEEEeCCCCEEEECCHHHHH
Confidence            45999999999999999999976521                  11234679999999999   79999999999 9999


Q ss_pred             HHhhcC
Q 044222          112 EVVGHP  117 (122)
Q Consensus       112 eIl~K~  117 (122)
                      +||.++
T Consensus        70 ~il~~~   75 (485)
T 3nxu_A           70 TVLVKE   75 (485)
T ss_dssp             HHHTTT
T ss_pred             HHHhcc
Confidence            999887
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.05
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 98.54
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 98.54
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 98.45
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 98.39
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 98.11
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 96.83
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 96.55
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 95.87
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 90.96
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 90.22
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 87.82
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 87.79
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 84.04
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.05  E-value=9.1e-11  Score=90.10  Aligned_cols=64  Identities=13%  Similarity=0.127  Sum_probs=54.2

Q ss_pred             HHHHHcCCCCCCCccCCCCHHHHHHHHHHhhcCCCCCCCCcccchhHHHHHHHhhhCCCc---cCCcceEEEeh-hHHHH
Q 044222           37 KFLRQQGLKGNSYRLLFGDLKESTIMLKKAKARPLSLDDDAAVRVTPFLHKLFKDYVDPD---EVPTPLPNHKT-CVALE  112 (122)
Q Consensus        37 ~~l~~qGI~GP~p~~l~GN~~e~~~~~~~a~~~~~~~~hdi~~~v~p~~~~w~k~YGkvf---~G~~P~l~Isd-~~ike  112 (122)
                      ..|+|.|||||++.|++||+.++.+                  ...-++.+|.++||++|   .|.+|.++|+| +.+|+
T Consensus         4 ~~~~~~~iPGP~~~P~iG~~~~~~~------------------~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~   65 (472)
T d1tqna_           4 GLFKKLGIPGPTPLPFLGNILSYHK------------------GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKT   65 (472)
T ss_dssp             THHHHTTCCCCCCBTTTBTGGGGGG------------------CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHH
T ss_pred             cchhhcCCCCCCCcCceeEHHHhhC------------------CHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHH
Confidence            4789999999999999999977632                  11235779999999998   89999999999 99999


Q ss_pred             HhhcCC
Q 044222          113 VVGHPS  118 (122)
Q Consensus       113 Il~K~~  118 (122)
                      ||.+..
T Consensus        66 il~~~~   71 (472)
T d1tqna_          66 VLVKEC   71 (472)
T ss_dssp             HHTTTT
T ss_pred             HHhcCC
Confidence            998764
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure