Citrus Sinensis ID: 044234


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
NLKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEECKMLQNLPRLPASIHWILLNGCVSLEILSDVLKLNEHRLPSLSLYCVDCSKLTGNYALALSLLEEYIKNSEGRWRHFSIAVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYAMCCVFHVPKYSLPNYTHGFPYPVHELSMKSQPDIL
ccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccccccEEEcccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHccccccccEEEEEccccccccEEcccccccEEEEEcccccccccccEEEEEEEEEEccccccccccccccccccccccccccccc
ccHHccccccccccccEEEcccccHHHHccHHccccHHHHEEEccccccEcccccHHHHHcccEEEcccccHHHcccccHcccHHccEEEcccccHHHcccHHHHcHHHHHEEEcccccHHHcccHHHccccccccccEEcccccccHccccccHccHHHHHHHHccccccHHcccccHHHHHHHHHHHHccccccccccEEEcccccccHHHccccccccEEEEEcccccccccccccEEEEEEEEccccccccccccccccccccccccccccc
nlkslprnisglkslstlnlsgtskfrefpeitgrmehlsnlhlegtairELPVSIELLSGLVLLnlkdcrnlstlpitvSSLKCLRTlklsgcskivkfpesvismEDLSELFLDRTSITEECKMlqnlprlpaSIHWILLNGCVSLEILSDVLKlnehrlpslslycvdcskltGNYALALSLLEEYIKNsegrwrhfsiavpgseipewfeyqnnegssitistppktyknsklvgYAMCCvfhvpkyslpnythgfpypvhelsmksqpdil
nlkslprnisglkslstlnlsgtsKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCRNLSTlpitvsslkclrTLKLSGCSKivkfpesvismedLSELFLDRTSITEECKMLQNLPRLPASIHWILLNGCVSLEILSDVLKLNEHRLPSLSLYCVDCSKLTGNYALALSLLEEYIKNSEGRWRHFSIAVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYAMCCVFHVPKYSLPNYTHGFPYPVHELSMKSQPDIL
NLKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEECKMLQNLPRLPASIHWILLNGCVSLEILSDVLKLNEHRLPSLSLYCVDCSKLTGNYALALSLLEEYIKNSEGRWRHFSIAVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYAMCCVFHVPKYSLPNYTHGFPYPVHELSMKSQPDIL
****************************FPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEECKMLQNLPRLPASIHWILLNGCVSLEILSDVLKLNEHRLPSLSLYCVDCSKLTGNYALALSLLEEYIKNSEGRWRHFSIAVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYAMCCVFHVPKYSLPNYTHGFPYPVH***********
NLKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEECKMLQNLPRLPASIHWILLNGCVSLEILSDVLKL*EHRLPSLSLYCVDCSKLTGN*************NSEGRWRHFSIAVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYAMCCVFHVPKYSLPNYTHGFPYPVHELSMKSQPDIL
NLKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEECKMLQNLPRLPASIHWILLNGCVSLEILSDVLKLNEHRLPSLSLYCVDCSKLTGNYALALSLLEEYIKNSEGRWRHFSIAVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYAMCCVFHVPKYSLPNYTHGFPYPVHELS********
NLKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEECKMLQNLPRLPASIHWILLNGCVSLEILSDVLKLNEHRLPSLSLYCVDCSKLTGNYALALSLLEEYIKNSEGRWRHFSIAVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYAMCCVFHVPKYSLPNYTHGFPYPVHELSMKSQPDIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NLKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEECKMLQNLPRLPASIHWILLNGCVSLEILSDVLKLNEHRLPSLSLYCVDCSKLTGNYALALSLLEEYIKNSEGRWRHFSIAVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYAMCCVFHVPKYSLPNYTHGFPYPVHELSMKSQPDIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query276 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti no no 0.452 0.065 0.402 1e-14
O23530 1301 Protein SUPPRESSOR OF npr no no 0.518 0.109 0.370 2e-12
Q403921144 TMV resistance protein N N/A no 0.873 0.210 0.261 4e-10
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.510 0.087 0.297 2e-08
Q9FL92 1372 Probable WRKY transcripti no no 0.586 0.118 0.307 4e-08
O82500 1095 Putative disease resistan no no 0.789 0.199 0.284 3e-07
Q9D9Q0347 Leucine-rich repeat-conta yes no 0.398 0.317 0.370 3e-06
Q8VZC7 1222 Probable disease resistan no no 0.449 0.101 0.343 5e-06
Q7XBQ9 970 Disease resistance protei N/A no 0.336 0.095 0.372 9e-06
Q5ZLN0 603 Leucine-rich repeat-conta yes no 0.442 0.202 0.323 2e-05
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 82/139 (58%), Gaps = 14/139 (10%)

Query: 2    LKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSG 61
            L+++P  +  L+SL  LNLSG SK   FPEI+    ++  L++ GT I+E+P SI+ L  
Sbjct: 1318 LENIPSMVD-LESLEVLNLSGCSKLGNFPEIS---PNVKELYMGGTMIQEIPSSIKNLVL 1373

Query: 62   LVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSIT 121
            L  L+L++ R+L  LP ++  LK L TL LSGC  + +FP+S   M+ L  L L RT I 
Sbjct: 1374 LEKLDLENSRHLKNLPTSIYKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIK 1433

Query: 122  EECKMLQNLPRLPASIHWI 140
            E          LP+SI ++
Sbjct: 1434 E----------LPSSISYL 1442




Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZC7|DRL36_ARATH Probable disease resistance protein At5g45510 OS=Arabidopsis thaliana GN=At5g45510 PE=1 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
296081002 599 unnamed protein product [Vitis vinifera] 0.880 0.405 0.382 2e-33
297734813 2101 unnamed protein product [Vitis vinifera] 0.862 0.113 0.362 6e-32
297734815 1651 unnamed protein product [Vitis vinifera] 0.862 0.144 0.366 3e-30
224120770 1120 tir-nbs-lrr resistance protein [Populus 0.898 0.221 0.326 1e-29
224102677367 predicted protein [Populus trichocarpa] 0.876 0.659 0.322 1e-29
224114311 1144 tir-nbs-lrr resistance protein [Populus 0.902 0.217 0.316 1e-28
224116210 1017 tir-nbs-lrr resistance protein [Populus 0.884 0.239 0.321 4e-28
224146780 540 predicted protein [Populus trichocarpa] 0.840 0.429 0.323 7e-28
255537139 1137 leucine-rich repeat-containing protein, 0.876 0.212 0.347 1e-27
224108373 1279 tir-nbs-lrr resistance protein [Populus 0.833 0.179 0.336 2e-27
>gi|296081002|emb|CBI18506.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 155/285 (54%), Gaps = 42/285 (14%)

Query: 2   LKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSG 61
           LKSLP +I  LKSL TL LS  SK   FPEI   MEHL  L L+GTA+++L  SIE L+G
Sbjct: 169 LKSLPSSICKLKSLETLILSACSKLESFPEIMENMEHLKKLLLDGTALKQLHPSIEHLNG 228

Query: 62  LVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSIT 121
           LV LNL+DC+NL+TLP ++ +LK L TL +SGCSK+ + PE++ S++ L +L  D T + 
Sbjct: 229 LVSLNLRDCKNLATLPCSIGNLKSLETLIVSGCSKLQQLPENLGSLQCLVKLQADGTLVR 288

Query: 122 E---------ECKMLQNLPRLPASI------HWILLNGCVSL----EILSDVLKLNEHRL 162
           +           ++L N   LPA I       ++ LN C SL    E+ S ++++N    
Sbjct: 289 QPPSSIVLLRNLEILNNFFSLPAGISKLSKLRFLSLNHCKSLLQIPELPSSIIEVNAQYC 348

Query: 163 PSLSLYCVD---CSKLTGNYALALSLLEEYIKNSEGRWRH------------------FS 201
            SL+        C+       L  +L   +  ++E    +                  FS
Sbjct: 349 SSLNTILTPSSVCNNQPVCRWLVFTLPNCFNLDAENPCSNDMAIISPRMQINFLPDFGFS 408

Query: 202 IAVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYAMCCVF 246
           I +PGSEIP+W   Q N GS +TI  PP  ++ S  +G+A+CCVF
Sbjct: 409 IFLPGSEIPDWISNQ-NLGSEVTIELPPHWFE-SNFLGFAVCCVF 451




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297734813|emb|CBI17047.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734815|emb|CBI17049.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224120770|ref|XP_002330947.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222873141|gb|EEF10272.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102677|ref|XP_002334150.1| predicted protein [Populus trichocarpa] gi|222869839|gb|EEF06970.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114311|ref|XP_002332395.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832718|gb|EEE71195.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224116210|ref|XP_002331988.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832112|gb|EEE70589.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224146780|ref|XP_002336335.1| predicted protein [Populus trichocarpa] gi|222834747|gb|EEE73210.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224108373|ref|XP_002333401.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222836441|gb|EEE74848.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
TAIR|locus:2153207 1165 AT5G45060 [Arabidopsis thalian 0.463 0.109 0.461 2.2e-20
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.463 0.103 0.485 2.4e-20
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.869 0.190 0.301 5.1e-20
TAIR|locus:2170333 1197 CSA1 "constitutive shade-avoid 0.561 0.129 0.423 7.8e-20
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.445 0.100 0.472 8e-20
TAIR|locus:2158475 1217 RPS4 "RESISTANT TO P. SYRINGAE 0.576 0.130 0.380 3.2e-18
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.456 0.104 0.454 1.1e-17
TAIR|locus:2827639 1195 AT2G17060 [Arabidopsis thalian 0.442 0.102 0.464 2.2e-17
TAIR|locus:2122209 1179 AT4G36150 [Arabidopsis thalian 0.615 0.144 0.356 3.5e-17
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.423 0.061 0.429 2e-15
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 254 (94.5 bits), Expect = 2.2e-20, P = 2.2e-20
 Identities = 66/143 (46%), Positives = 93/143 (65%)

Query:     1 NLKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLS 60
             +L+SL R+++ L SL TL LS  S F+EFP I    E+L  L+L+GT+I +LP ++  L 
Sbjct:   695 SLESL-RDVN-LTSLKTLTLSNCSNFKEFPLIP---ENLKALYLDGTSISQLPDNVGNLK 749

Query:    61 GLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSI 120
              LVLLN+KDC+ L T+P  VS LK L+ L LSGCSK+ +FPE  I+   L  L LD TSI
Sbjct:   750 RLVLLNMKDCKVLETIPTCVSELKTLQKLVLSGCSKLKEFPE--INKSSLKILLLDGTSI 807

Query:   121 TEECKMLQNLPRLPASIHWILLN 143
                    + +P+LP S+ ++ L+
Sbjct:   808 -------KTMPQLP-SVQYLCLS 822


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827639 AT2G17060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
PLN03210 1153 PLN03210, PLN03210, Resistant to P 9e-16
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
PRK15386 426 PRK15386, PRK15386, type III secretion protein Gog 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 76.8 bits (189), Expect = 9e-16
 Identities = 80/307 (26%), Positives = 117/307 (38%), Gaps = 94/307 (30%)

Query: 1   NLKSLPRNISGLKSLSTLNLSGTSKFREFPEI-----------TGRMEHLSNLHLEG--- 46
           NL+ LP  I+ LKSL  LNLSG S+ + FP+I           T   E  SNL LE    
Sbjct: 693 NLEILPTGIN-LKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDE 751

Query: 47  -------------------------------------TAIRELPVSIELLSGLVLLNLKD 69
                                                 ++ ELP SI+ L  L  L +++
Sbjct: 752 LILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIEN 811

Query: 70  CRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEECKMLQN 129
           C NL TLP  + +L+ L +L LSGCS++  FP+  IS  ++S+L L RT I E    ++ 
Sbjct: 812 CINLETLPTGI-NLESLESLDLSGCSRLRTFPD--IST-NISDLNLSRTGIEEVPWWIEK 867

Query: 130 LPRLPASIHWILLNGCVSLEILS-DVLKLNEHRLPSLSLYCVDCSKLTGNYALALSLLEE 188
              L     ++ +NGC +L+ +S ++ KL        S    DC  LT   A       E
Sbjct: 868 FSNLS----FLDMNGCNNLQRVSLNISKLKHLETVDFS----DCGALT--EASWNGSPSE 917

Query: 189 YIKNSEGRWRHFSIAVP---------------------------GSEIPEWFEYQNNEGS 221
               ++         V                            G E+P +F ++    S
Sbjct: 918 VAMATDNIHSKLPSTVCINFINCFNLDQEALLQQQSIFKQLILSGEEVPSYFTHRTTGAS 977

Query: 222 SITISTP 228
              I   
Sbjct: 978 LTNIPLL 984


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 276
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.47
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.45
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.41
KOG0617264 consensus Ras suppressor protein (contains leucine 99.4
KOG0617264 consensus Ras suppressor protein (contains leucine 99.33
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.19
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.16
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.12
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.11
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.1
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.04
PLN03150623 hypothetical protein; Provisional 99.02
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.92
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.91
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.85
PLN03150623 hypothetical protein; Provisional 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.74
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.72
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.71
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.7
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.7
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.62
PRK15386 426 type III secretion protein GogB; Provisional 98.61
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.6
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.55
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.44
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.41
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.4
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.38
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.35
PRK15386 426 type III secretion protein GogB; Provisional 98.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.05
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.84
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.8
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.73
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.65
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.61
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.57
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.51
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.5
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.44
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.34
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.33
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.23
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.14
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.87
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.74
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.51
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.49
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.3
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.2
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.12
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.8
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.34
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.87
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.85
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.21
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.77
smart0037026 LRR Leucine-rich repeats, outliers. 92.27
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.27
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.95
KOG4341483 consensus F-box protein containing LRR [General fu 91.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 90.66
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.62
KOG1947482 consensus Leucine rich repeat proteins, some prote 89.95
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 88.82
KOG4341483 consensus F-box protein containing LRR [General fu 86.82
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.94
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.86
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.88  E-value=9.2e-22  Score=199.65  Aligned_cols=172  Identities=22%  Similarity=0.406  Sum_probs=103.0

Q ss_pred             CCcEEecCCCCCCCcccccCCCCCCCCEEeeeCCCCCCcCccccCCCCCCCeeeccCccccccC----cccc-------c
Q 044234           61 GLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEEC----KMLQ-------N  129 (276)
Q Consensus        61 ~L~~L~L~~~~~l~~lp~~~~~l~~L~~L~l~~~~~~~~lp~~l~~l~~L~~L~L~~n~i~~~~----~~L~-------~  129 (276)
                      +|+.|++++|.....+|..++++++|+.|++++|+.++.+|..+ .+++|+.|++++|.....+    .+++       .
T Consensus       779 sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~  857 (1153)
T PLN03210        779 SLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDISTNISDLNLSRTG  857 (1153)
T ss_pred             cchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCccccccccccccCEeECCCCC
Confidence            45566666666666677777777778888887777777777654 5566666666543211000    0000       0


Q ss_pred             CCCCC------CCccEEeccCCCCCccccchhhhcccCCCCc-cee----------------------------------
Q 044234          130 LPRLP------ASIHWILLNGCVSLEILSDVLKLNEHRLPSL-SLY----------------------------------  168 (276)
Q Consensus       130 L~~L~------~~L~~L~~~~c~~L~~~~~~~~~~~~~~~~l-~l~----------------------------------  168 (276)
                      +.++|      ++|+.|++.+|.+|+.++..    ...+..+ .++                                  
T Consensus       858 i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~----~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~  933 (1153)
T PLN03210        858 IEEVPWWIEKFSNLSFLDMNGCNNLQRVSLN----ISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTV  933 (1153)
T ss_pred             CccChHHHhcCCCCCEEECCCCCCcCccCcc----cccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchh
Confidence            00111      24455555555555555441    1222222 233                                  


Q ss_pred             ---ecCCCcchhhHHHHHHHHHHHHhccCCCccceEEecCCCCCCcccccCCCCCceEE-EEcCCCCCCCCCeeEEEEEE
Q 044234          169 ---CVDCSKLTGNYALALSLLEEYIKNSEGRWRHFSIAVPGSEIPEWFEYQNNEGSSIT-ISTPPKTYKNSKLVGYAMCC  244 (276)
Q Consensus       169 ---~~~c~~L~~~~~~~~~~l~~~~~~~~~~~~~~~~~~pg~~iP~Wf~~~~~~g~~i~-~~l~~~~~~~~~~~g~~~c~  244 (276)
                         |.||.+|+....          .+..  .....+++||.++|+||.||+ .|++++ |++|+.|. ...|.||++|+
T Consensus       934 ~l~f~nC~~L~~~a~----------l~~~--~~~~~~~l~g~evp~~f~hr~-~g~sl~~i~l~~~~~-~~~~~~f~~c~  999 (1153)
T PLN03210        934 CINFINCFNLDQEAL----------LQQQ--SIFKQLILSGEEVPSYFTHRT-TGASLTNIPLLHISP-CQPFFRFRACA  999 (1153)
T ss_pred             ccccccccCCCchhh----------hccc--ccceEEECCCccCchhccCCc-ccceeeeeccCCccc-CCCccceEEEE
Confidence               444544433221          0111  112357899999999999999 999998 99999888 77899999999


Q ss_pred             EEecCCC
Q 044234          245 VFHVPKY  251 (276)
Q Consensus       245 v~~~~~~  251 (276)
                      |+++...
T Consensus      1000 v~~~~~~ 1006 (1153)
T PLN03210       1000 VVDSESF 1006 (1153)
T ss_pred             EEecCcc
Confidence            9987654



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 5e-07
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 51.2 bits (121), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 52/169 (30%), Positives = 74/169 (43%), Gaps = 25/169 (14%) Query: 2 LKSLPRNISGLKSLSTLNLSGTSKFREFPE------ITGRMEHLSNLH---LEGTAIREL 52 L++LP +I+ L L L++ + E PE +G + L NL LE T IR L Sbjct: 139 LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSL 198 Query: 53 PVSIELLSGLVLLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSE 112 P SI L L L +++ LS L + L L L L GC+ + +P L Sbjct: 199 PASIANLQNLKSLKIRNS-PLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKR 257 Query: 113 LFLDRTSITEECKMLQNLPRLPASIHWIL------LNGCVSLEILSDVL 155 L L ++C NL LP IH + L GCV+L L ++ Sbjct: 258 LIL------KDCS---NLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLI 297

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 84.6 bits (210), Expect = 4e-19
 Identities = 40/162 (24%), Positives = 63/162 (38%), Gaps = 11/162 (6%)

Query: 4   SLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLV 63
                  GL +L +L L  T   R  P     +++L +L +  + +  L  +I  L  L 
Sbjct: 174 DASGEHQGLVNLQSLRLEWT-GIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLE 232

Query: 64  LLNLKDCRNLSTLPITVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEE 123
            L+L+ C  L   P        L+ L L  CS ++  P  +  +  L +L L        
Sbjct: 233 ELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDL------RG 286

Query: 124 CKMLQNLPRLPASIHWILLNGCVSLEILSDVLKLNEHRLPSL 165
           C  L  LP L A     L   C+ L       +L++HR  + 
Sbjct: 287 CVNLSRLPSLIAQ----LPANCIILVPPHLQAQLDQHRPVAR 324


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.64
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.63
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.6
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.6
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.58
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.58
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.58
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.57
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.57
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.57
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.57
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.57
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.56
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.56
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.55
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.55
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.55
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.55
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.53
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.52
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.52
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.52
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.52
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.52
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.52
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.52
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.51
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.5
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.5
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.5
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.49
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.49
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.49
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.49
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.49
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.49
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.48
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.47
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.47
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.46
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.46
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.46
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.46
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.45
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.45
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.44
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.44
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.44
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.44
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.41
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.41
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.4
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.4
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.39
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.39
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.38
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.38
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.37
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.36
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.36
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.35
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.35
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.34
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.34
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.34
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.32
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.3
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.3
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.3
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.28
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.28
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.26
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.25
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.23
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.21
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.03
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.02
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.0
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.87
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.66
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.59
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.43
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.4
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.4
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.39
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.37
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.37
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.29
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.09
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.96
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.96
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.96
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.91
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.52
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.39
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.31
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.29
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.42
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.25
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.23
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.80  E-value=9.2e-19  Score=154.13  Aligned_cols=164  Identities=25%  Similarity=0.437  Sum_probs=135.7

Q ss_pred             CCccCcccCCCCCCCEEeecCCCCCCccccccCCCCCCcEEEccCCCceecCccccCCCCCcEEecCCCCCCCcccccCC
Q 044234            2 LKSLPRNISGLKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCRNLSTLPITVS   81 (276)
Q Consensus         2 L~~LP~~l~~l~~L~~L~Ls~~~~l~~~p~~~~~l~~L~~L~L~~n~i~~lp~~i~~l~~L~~L~L~~~~~l~~lp~~~~   81 (276)
                      ++.+|+.+.++++|++|++++|. +..+|..++.+++|++|++++|.++.+|..++.+++|++|++++|...+.+|..++
T Consensus        93 l~~lp~~l~~l~~L~~L~L~~n~-l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~  171 (328)
T 4fcg_A           93 LPQFPDQAFRLSHLQHMTIDAAG-LMELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLA  171 (328)
T ss_dssp             CSSCCSCGGGGTTCSEEEEESSC-CCCCCSCGGGGTTCSEEEEESCCCCCCCGGGGGCTTCCEEEEEEETTCCCCCSCSE
T ss_pred             chhcChhhhhCCCCCEEECCCCC-ccchhHHHhccCCCCEEECCCCccccCcHHHhcCcCCCEEECCCCCCccccChhHh
Confidence            66789989999999999999995 55899999999999999999999999999999999999999999999999998776


Q ss_pred             C---------CCCCCEEeeeCCCCCCcCccccCCCCCCCeeeccCccccccCcccccCCCCCCCccEEeccCCCCCcccc
Q 044234           82 S---------LKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEECKMLQNLPRLPASIHWILLNGCVSLEILS  152 (276)
Q Consensus        82 ~---------l~~L~~L~l~~~~~~~~lp~~l~~l~~L~~L~L~~n~i~~~~~~L~~L~~L~~~L~~L~~~~c~~L~~~~  152 (276)
                      .         +++|++|++++|... .+|..++.+++|++|++++|.+++....+..+    ++|++|++++|.....++
T Consensus       172 ~~~~~~~~~~l~~L~~L~L~~n~l~-~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l----~~L~~L~Ls~n~~~~~~p  246 (328)
T 4fcg_A          172 STDASGEHQGLVNLQSLRLEWTGIR-SLPASIANLQNLKSLKIRNSPLSALGPAIHHL----PKLEELDLRGCTALRNYP  246 (328)
T ss_dssp             EEC-CCCEEESTTCCEEEEEEECCC-CCCGGGGGCTTCCEEEEESSCCCCCCGGGGGC----TTCCEEECTTCTTCCBCC
T ss_pred             hccchhhhccCCCCCEEECcCCCcC-cchHhhcCCCCCCEEEccCCCCCcCchhhccC----CCCCEEECcCCcchhhhH
Confidence            5         999999999997554 88988999999999999999987544444433    467999999988877776


Q ss_pred             chhhhcccCCCCc-ceeecCCCcc
Q 044234          153 DVLKLNEHRLPSL-SLYCVDCSKL  175 (276)
Q Consensus       153 ~~~~~~~~~~~~l-~l~~~~c~~L  175 (276)
                      ..    ...+..+ .|++.+|..+
T Consensus       247 ~~----~~~l~~L~~L~L~~n~~~  266 (328)
T 4fcg_A          247 PI----FGGRAPLKRLILKDCSNL  266 (328)
T ss_dssp             CC----TTCCCCCCEEECTTCTTC
T ss_pred             HH----hcCCCCCCEEECCCCCch
Confidence            52    2223333 4566777654



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 276
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 37.9 bits (86), Expect = 9e-04
 Identities = 22/76 (28%), Positives = 31/76 (40%), Gaps = 8/76 (10%)

Query: 12  LKSLSTLNLSGTSKFREFPEITGRMEHLSNLHLEGTAIRELPVSIELLSGLVLLNLKDCR 71
             SL  LN+S   K  E P +  R   L  L      + E+P   EL   L  L+++   
Sbjct: 283 PPSLEELNVSNN-KLIELPALPPR---LERLIASFNHLAEVP---ELPQNLKQLHVEYN- 334

Query: 72  NLSTLPITVSSLKCLR 87
            L   P    S++ LR
Sbjct: 335 PLREFPDIPESVEDLR 350


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.52
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.46
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.42
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.37
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.37
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.34
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.3
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.27
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.27
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.05
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.04
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.04
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.9
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.89
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.85
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.71
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.02
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.98
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.86
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.82
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.67
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.56
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.59
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.88
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Slit
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.59  E-value=6.4e-15  Score=117.71  Aligned_cols=122  Identities=24%  Similarity=0.282  Sum_probs=89.5

Q ss_pred             CCCccCcccCCCCCCCEEeecCCCCCCcc-ccccCCCCCCcEEEccCCCceecCc-cccCCCCCcEEecCCCCCCCcccc
Q 044234            1 NLKSLPRNISGLKSLSTLNLSGTSKFREF-PEITGRMEHLSNLHLEGTAIRELPV-SIELLSGLVLLNLKDCRNLSTLPI   78 (276)
Q Consensus         1 ~L~~LP~~l~~l~~L~~L~Ls~~~~l~~~-p~~~~~l~~L~~L~L~~n~i~~lp~-~i~~l~~L~~L~L~~~~~l~~lp~   78 (276)
                      +|+++|+.+.  +++++|+|++|...+.. +..+..+++|++|++++|.+..++. .+..+++|++|++++|......|.
T Consensus        19 ~L~~iP~~lp--~~l~~L~Ls~N~i~~~~~~~~f~~l~~L~~L~L~~N~i~~~~~~~~~~~~~L~~L~Ls~N~l~~l~~~   96 (192)
T d1w8aa_          19 GLKEIPRDIP--LHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNK   96 (192)
T ss_dssp             CCSSCCSCCC--TTCSEEECCSCCCCSBCCSCSGGGCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSCCCCEECSS
T ss_pred             CcCccCCCCC--CCCCEEEeCCCCCcccccccccCCCceEeeeeccccccccccccccccccccceeeeccccccccCHH
Confidence            3667777663  67888888888554433 4556778888888888888887754 477788888888888865555556


Q ss_pred             cCCCCCCCCEEeeeCCCCCCcCccccCCCCCCCeeeccCccccccC
Q 044234           79 TVSSLKCLRTLKLSGCSKIVKFPESVISMEDLSELFLDRTSITEEC  124 (276)
Q Consensus        79 ~~~~l~~L~~L~l~~~~~~~~lp~~l~~l~~L~~L~L~~n~i~~~~  124 (276)
                      .|.++++|++|+|++|.+.+..+..+..+++|++|++++|.+...|
T Consensus        97 ~F~~l~~L~~L~L~~N~l~~i~~~~f~~l~~L~~l~L~~N~~~~~~  142 (192)
T d1w8aa_          97 MFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCNC  142 (192)
T ss_dssp             SSTTCTTCCEEECCSSCCCEECTTSSTTCTTCCEEECTTCCBCCSG
T ss_pred             HHhCCCcccccccCCccccccCHHHhcCCccccccccccccccccc
Confidence            6778888888888887655555566778888888888888877555



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure