Citrus Sinensis ID: 044245

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690----
MSTQRMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPISPCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVKLMAKPVAVGFEESGRTDLCSSTLVEASFDPSNGELNVQHTFS
ccccccHHccccccccccccEEccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHccccccccccccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEcccccEEccccccccccEEEEcccccccccccHHHHHHHHHHcccccccEEEcccEEEEEEEEEcHHHHHHcccccccccccccccccccccccccccccccEEEEcccccccEEEEcccEEEEEEEcccccccccEEEEEEEEEEcccEEEEEEEEEEEEcccccEEEcccccccccccccccccccEEccccccEEEccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHcccccccccEEEEEcccccccccccccccccEEEcccccccccccccccHHHHHHHHHHcccccccccEEEcccEEEEEEEccccHHHHHccccccccccccccccHHHcccccccccccccccccccccccccccccccEEEEEEEcccccccccEEEEEEEEEccEEEEEEEEEEEEEcccccEEEcccccccccccEEEEcccEEEEccccccccccccccEEEEEEEccccEEEEEEEEc
cccHHHHHEcccccccccEEEEcccccccHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccHHcccccccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccEEEEEcccccccHccEEEEHHHcHHHHHHHHHHHHHHHHHHHcccccEEccccEEEEEEEEEcHHHHHHHHcccccccccccccccccccHHHccccHHHccccccccccccEEccccEEEEEEEccccccccccccEEEEEEEccEEEEEEEEEEEEEcccccEEEEccccccccccHHHHcHHEEEEccccEEEEEcccEEEEEEEcccccEEEcccccccccccccccccccccEEEEccHHHHHccccHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHcccccccEEEEEEcccHccccccccccEEEEEEcccEccccccccHHHHHHHHHHHHHHHHcccccEEEcccEEEEEEEEEcHHHHHHccccccccccccHHHHHHHHHHcccccccccccccccEcccccccEccccEEEEEEEccccccccEEEEEEEEcccccEcEEEEEEEEEEcccccEEEEccccccccccEEEEccccccccccccccccEEEEEEEEEEEcccccEEEEEEEEc
mstqrmfqlkldpltgnsewvvieenedvpessqepllaTTSYLDMLNDSYRNRAYRLAIDKMVTKSChvldigagTGLLSMMAARamgssdsttslntKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRsdelevgvdidsRADILVSEILdsellgegliptLQHAHDRllvenpltvpcrvttygQLVESTFLWKLHDLYNneakalddihlvpagmdsilhVKSQQYAMHCDAITKEIKLlsepfkifefdfwkrpdshgeaelqikstddgrVHAVVSWWVLQLdregtifystaprwistgnwcdhwkqcvwfipgkgmsickgEELLFHALHTETSVSYElksqipitderqhnlnakdfqlalpperiaiygdGEWRLSMVMAMRNALQGrvqplcvvaddsVFLTICVARLSKTAHVLsllpglgdkgaqylrtvadpncfsiDRVEILQKGkkcltmddTQQKKVDLLigepyyfgndgmlpwqnlrfwkerskldpvlskevIIMPFKGILKACAIFcpdiwnsrrslskiegfDHAVVNtslgacgdlpapkdgpclpfftwqcgeikkLSNVFTVMefdfskpispcqgkvqveftepglchgFALWIDWVldsensivistgpdkrywKQGVKLMAKPVAvgfeesgrtdlcsstlveasfdpsngelnvqhtfs
mstqrmfqlkldpltgnsEWVVIEEnedvpessqepLLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMAARAMGssdsttslnTKGMVTACESYLPMVKLMKKVLHVNgmgrnikvinkrsdelevgvdidsRADILVSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAElqikstddgrVHAVVSWWVLQLDREGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPISPCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVKLMAKPVAVGFEESGRTDLCSSTLveasfdpsngelnvqhtfs
MSTQRMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPISPCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVKLMAKPVAVGFEESGRTDLCSSTLVEASFDPSNGELNVQHTFS
*****************SEWVVI*************LLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMA**************TKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPD******LQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPISPCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVKLMAKPVAVGFEESGRTDLC***********************
****R***LKLDPLTGNSEWVV*EENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPISPCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVKLMAKPVAVGF********CSSTLVEASFDPSNGELNVQHTFS
MSTQRMFQLKLDPLTGNSEWVVIEE**********PLLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPISPCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVKLMAKPVAVGFEESGRTDLCSSTLVEASFDPSNGELNVQHTFS
****RMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPISPCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVKLMAKPVAVGFEESGRTDLCSSTLVEASFDPSNGELNVQHTFS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTQRMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPISPCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVKLMAKPVAVGFEESGRTDLCSSTLVEASFDPSNGELNVQHTFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query694 2.2.26 [Sep-21-2011]
Q944R7724 Protein arginine N-methyl yes no 0.976 0.936 0.627 0.0
A2Y8B9720 Protein arginine N-methyl N/A no 0.962 0.927 0.588 0.0
Q5VS72720 Protein arginine N-methyl yes no 0.962 0.927 0.586 0.0
Q9NVM4692 Protein arginine N-methyl yes no 0.865 0.868 0.306 9e-74
A6QQV6695 Protein arginine N-methyl yes no 0.865 0.864 0.294 9e-70
Q5ZIB9689 Protein arginine N-methyl yes no 0.930 0.937 0.303 2e-69
A2AV36683 Protein arginine N-methyl yes no 0.920 0.935 0.305 3e-68
Q922X9692 Protein arginine N-methyl yes no 0.935 0.937 0.290 3e-68
Q99MI9692 Protein arginine N-methyl N/A no 0.863 0.865 0.302 3e-68
Q5U4E8693 Protein arginine N-methyl yes no 0.939 0.940 0.283 3e-67
>sp|Q944R7|ANM16_ARATH Protein arginine N-methyltransferase 1.6 OS=Arabidopsis thaliana GN=PRMT16 PE=2 SV=2 Back     alignment and function desciption
 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/703 (62%), Positives = 526/703 (74%), Gaps = 25/703 (3%)

Query: 2   STQRMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAID 61
           S+QR+FQL+ DPLTGNSEW+VIE+N D P +S + LLATTSYLDMLNDS RN AYRLAI+
Sbjct: 37  SSQRVFQLRQDPLTGNSEWIVIEDN-DQPGTSTDGLLATTSYLDMLNDSRRNIAYRLAIE 95

Query: 62  KMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLH 121
           K +T+ CHVLDIGAGTGLLSMMA RAM         ++KGMVTACESYLPMVKLM+KV+H
Sbjct: 96  KTITEPCHVLDIGAGTGLLSMMAVRAMRG-------DSKGMVTACESYLPMVKLMRKVMH 148

Query: 122 VNGMGRNIKVINKRSDELEVGV-DIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVE 180
            NGM +NI +INKRSDEL+VG  DI SRAD+LVSEILDSELLGEGLIP+LQHAHD LLV+
Sbjct: 149 KNGMTKNINLINKRSDELKVGSEDIASRADVLVSEILDSELLGEGLIPSLQHAHDMLLVD 208

Query: 181 NPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHC 240
           NP TVP R TTY QLVESTFL  L DL NNEAK  D + LVP G++S+  +KSQQY+MH 
Sbjct: 209 NPKTVPYRATTYCQLVESTFLCNLQDLRNNEAKTSDGVRLVPPGLESLFGIKSQQYSMHV 268

Query: 241 DAITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKSTDDGRVHAVVSWWVLQLDREGTI 300
           DAI KEIKLLSEP KIFEFDFWKRP+S+GE ++ I++   G VHA++SWWVLQLD EGTI
Sbjct: 269 DAIEKEIKLLSEPVKIFEFDFWKRPESNGELDVHIEAKTTGSVHAIISWWVLQLDSEGTI 328

Query: 301 FYSTAPRWISTG------NWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELK 354
           FYSTAPRWI +       +WCDHWKQCVWF PG G+SI KGE++  HA HT T++ Y LK
Sbjct: 329 FYSTAPRWIDSNSEIGVRDWCDHWKQCVWFTPGTGVSISKGEKVHLHASHTCTNILYNLK 388

Query: 355 SQIPITDERQH-NLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVAD 413
               +T ER H  L+  D  L LPPER+AIYGD  +R S+  A R ALQG+  P C+V D
Sbjct: 389 KTQSLTHERTHFPLSTGDLHLTLPPERVAIYGDSIYRQSLFEATRKALQGKSYPQCLVID 448

Query: 414 DSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMD 473
           DS+ L +    +S  + VLSL PGL +  A+Y   +AD N FS DR E  + GK  L   
Sbjct: 449 DSLLLPLMALHISNRSRVLSLSPGLQENAARYFEAIADSNGFSKDRFEYFRDGKTNLA-- 506

Query: 474 DTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIF 533
                K+DLLIGEPYY G +  LPWQNLRFWK+R+ LD VLS++ ++MP+KG+L+ CA++
Sbjct: 507 KAYPGKIDLLIGEPYYSGLENGLPWQNLRFWKDRTLLDSVLSEDAVVMPYKGVLRGCAMY 566

Query: 534 CPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTV 593
            PD+W SR  L  +EGFDH +VNT+LG CGDLP+ KD PCLPFF WQCGE K LS  FTV
Sbjct: 567 LPDLWKSRCCLGSVEGFDHTLVNTTLGGCGDLPSGKDSPCLPFFIWQCGETKILSKEFTV 626

Query: 594 MEFDFSKPIS-PCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVK 652
           MEFDFSKPI+ PC G+VQ+EF +PG+CHG ALW+DWV+D ENS VISTGPD +YWKQGVK
Sbjct: 627 MEFDFSKPITGPCSGEVQIEFIKPGVCHGIALWMDWVMDEENSTVISTGPDDKYWKQGVK 686

Query: 653 LMAKPVAVGFEESGRTDLCSSTLVEASFD-PSNGELNVQHTFS 694
           L+ KPV V  E        SS  ++AS D  SN EL V HT S
Sbjct: 687 LLGKPVTVRMEGPS-----SSIGIQASLDLSSNSELIVTHTIS 724
Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA).
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|A2Y8B9|ANM7_ORYSI Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. indica GN=PRMT7 PE=3 SV=3 Back     alignment and function description
>sp|Q5VS72|ANM7_ORYSJ Protein arginine N-methyltransferase 7 OS=Oryza sativa subsp. japonica GN=PRMT7 PE=2 SV=1 Back     alignment and function description
>sp|Q9NVM4|ANM7_HUMAN Protein arginine N-methyltransferase 7 OS=Homo sapiens GN=PRMT7 PE=1 SV=1 Back     alignment and function description
>sp|A6QQV6|ANM7_BOVIN Protein arginine N-methyltransferase 7 OS=Bos taurus GN=PRMT7 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIB9|ANM7_CHICK Protein arginine N-methyltransferase 7 OS=Gallus gallus GN=PRMT7 PE=2 SV=1 Back     alignment and function description
>sp|A2AV36|ANM7_DANRE Protein arginine N-methyltransferase 7 OS=Danio rerio GN=prmt7 PE=2 SV=1 Back     alignment and function description
>sp|Q922X9|ANM7_MOUSE Protein arginine N-methyltransferase 7 OS=Mus musculus GN=Prmt7 PE=1 SV=1 Back     alignment and function description
>sp|Q99MI9|ANM7_CRILO Protein arginine N-methyltransferase 7 OS=Cricetulus longicaudatus GN=Prmt7 PE=1 SV=3 Back     alignment and function description
>sp|Q5U4E8|ANM7_RAT Protein arginine N-methyltransferase 7 OS=Rattus norvegicus GN=Prmt7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query694
359474371724 PREDICTED: protein arginine N-methyltran 0.998 0.957 0.731 0.0
297741194738 unnamed protein product [Vitis vinifera] 0.998 0.939 0.717 0.0
224071063699 predicted protein [Populus trichocarpa] 0.987 0.979 0.702 0.0
255576060697 protein arginine n-methyltransferase, pu 0.982 0.978 0.701 0.0
449469390738 PREDICTED: protein arginine N-methyltran 0.989 0.930 0.682 0.0
356514280696 PREDICTED: protein arginine N-methyltran 0.976 0.974 0.673 0.0
357476863 869 Protein arginine N-methyltransferase [Me 0.955 0.762 0.663 0.0
297804524729 predicted protein [Arabidopsis lyrata su 0.985 0.938 0.623 0.0
18414696724 protein arginine N-methyltransferase 7 [ 0.976 0.936 0.627 0.0
300669612720 RecName: Full=Protein arginine N-methylt 0.962 0.927 0.588 0.0
>gi|359474371|ref|XP_002266419.2| PREDICTED: protein arginine N-methyltransferase 1.6-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1078 bits (2787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/693 (73%), Positives = 586/693 (84%)

Query: 2   STQRMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAID 61
           S QR+FQLKLDPLTGNSEWVVI+E + V E+  EPLL+TTSYLDMLNDS RNRA+R AID
Sbjct: 32  SAQRLFQLKLDPLTGNSEWVVIDEEDQVSENPSEPLLSTTSYLDMLNDSRRNRAFREAID 91

Query: 62  KMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLH 121
           K VTK+C VLDIGAGTGLLSMMAARAMGS DS     T+GMVTACESYLPMVKLM+KVLH
Sbjct: 92  KTVTKNCRVLDIGAGTGLLSMMAARAMGSGDSVACPRTEGMVTACESYLPMVKLMRKVLH 151

Query: 122 VNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVEN 181
           +NGMGR I VINKRSDEL +GVDI SRAD+LVSEILDSELLGEGLIPTLQHAHD LLVEN
Sbjct: 152 LNGMGRKINVINKRSDELNIGVDITSRADVLVSEILDSELLGEGLIPTLQHAHDMLLVEN 211

Query: 182 PLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHCD 241
             TVP R TTYGQLVES FLWKLHDLYNNEAKALD++ LVPAG ++IL +K QQYAMHCD
Sbjct: 212 AKTVPYRATTYGQLVESKFLWKLHDLYNNEAKALDNVCLVPAGQETILSIKQQQYAMHCD 271

Query: 242 AITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKSTDDGRVHAVVSWWVLQLDREGTIF 301
           AI +EIKLLSEPFKIFEFDF KRPDSH E EL IK+ D+G VHAVVSWW+LQLD EGTIF
Sbjct: 272 AIKEEIKLLSEPFKIFEFDFSKRPDSHEETELHIKAIDNGSVHAVVSWWILQLDCEGTIF 331

Query: 302 YSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITD 361
           YSTAP+WIS G+WCDHWKQCVWFIPGKG+ + K EE+  HA+HT+ S+SY LK+Q+  T+
Sbjct: 332 YSTAPKWISAGDWCDHWKQCVWFIPGKGIYVSKHEEVHLHAIHTDISISYNLKTQLSRTE 391

Query: 362 ERQHNLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTIC 421
             QH+L A+D QL L PER+AIYGD EWRLSM+ A++N LQG+V  LCVV DDS+FL I 
Sbjct: 392 IGQHDLFARDSQLILSPERVAIYGDSEWRLSMLTAIKNTLQGKVISLCVVTDDSIFLAIL 451

Query: 422 VARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVD 481
           +A LS+T+HV+SL PGL DKG QYL+ VAD N FS+DRVE+LQ  K CLT  DT+QKKVD
Sbjct: 452 IAHLSRTSHVISLFPGLRDKGTQYLQAVADVNGFSMDRVEVLQNWKTCLTTLDTRQKKVD 511

Query: 482 LLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSR 541
           LLIGEP+Y+GN+GMLPWQNLRFWKER+ L+ VLS++V+IMP KGIL+ACA+  PD+WNSR
Sbjct: 512 LLIGEPFYYGNEGMLPWQNLRFWKERTMLNSVLSEDVVIMPCKGILRACAMSLPDLWNSR 571

Query: 542 RSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKP 601
           R L+KIEG DH+VVN +LGACGDLP  ++GPCLP+F WQCGEIK+LS + TVMEFDFSKP
Sbjct: 572 RCLNKIEGLDHSVVNATLGACGDLPEAQEGPCLPYFVWQCGEIKELSEILTVMEFDFSKP 631

Query: 602 ISPCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVKLMAKPVAVG 661
           I+PC GK  VEFTE G+CHGF LWIDWV+D+EN  V+ TGP  RYWKQGVKL++KP++VG
Sbjct: 632 INPCSGKAMVEFTETGICHGFVLWIDWVMDAENCTVLPTGPVHRYWKQGVKLLSKPISVG 691

Query: 662 FEESGRTDLCSSTLVEASFDPSNGELNVQHTFS 694
           F  S  T  C ST +EASFDPS+GEL V+HT S
Sbjct: 692 FHGSESTSGCFSTEIEASFDPSSGELIVKHTLS 724

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297741194|emb|CBI31925.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224071063|ref|XP_002303351.1| predicted protein [Populus trichocarpa] gi|222840783|gb|EEE78330.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255576060|ref|XP_002528925.1| protein arginine n-methyltransferase, putative [Ricinus communis] gi|223531627|gb|EEF33454.1| protein arginine n-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449469390|ref|XP_004152403.1| PREDICTED: protein arginine N-methyltransferase 1.6-like [Cucumis sativus] gi|449513269|ref|XP_004164280.1| PREDICTED: protein arginine N-methyltransferase 1.6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356514280|ref|XP_003525834.1| PREDICTED: protein arginine N-methyltransferase 1.6-like [Glycine max] Back     alignment and taxonomy information
>gi|357476863|ref|XP_003608717.1| Protein arginine N-methyltransferase [Medicago truncatula] gi|355509772|gb|AES90914.1| Protein arginine N-methyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|297804524|ref|XP_002870146.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297315982|gb|EFH46405.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18414696|ref|NP_567508.1| protein arginine N-methyltransferase 7 [Arabidopsis thaliana] gi|152013356|sp|Q944R7.2|ANM16_ARATH RecName: Full=Protein arginine N-methyltransferase 1.6; Short=AtPRMT16; Short=AtPRMT7 gi|332658372|gb|AEE83772.1| protein arginine N-methyltransferase 7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|300669612|sp|A2Y8B9.3|ANM7_ORYSI RecName: Full=Protein arginine N-methyltransferase 7 Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query694
TAIR|locus:2130824724 PRMT7 "protein arginine methyl 0.976 0.936 0.631 7.9e-236
UNIPROTKB|Q9NVM4692 PRMT7 "Protein arginine N-meth 0.874 0.877 0.310 1.1e-71
UNIPROTKB|F1PA95693 PRMT7 "Uncharacterized protein 0.949 0.950 0.297 1.3e-70
MGI|MGI:2384879692 Prmt7 "protein arginine N-meth 0.932 0.934 0.300 1.6e-70
RGD|1304869693 Prmt7 "protein arginine methyl 0.948 0.949 0.292 2.1e-70
UNIPROTKB|Q99MI9692 Prmt7 "Protein arginine N-meth 0.871 0.874 0.309 1.3e-68
UNIPROTKB|F1MQX7695 PRMT7 "Protein arginine N-meth 0.874 0.873 0.301 1.3e-68
UNIPROTKB|A6QQV6695 PRMT7 "Protein arginine N-meth 0.874 0.873 0.299 1.3e-68
UNIPROTKB|Q5ZIB9689 PRMT7 "Protein arginine N-meth 0.865 0.872 0.310 9.2e-68
UNIPROTKB|F1ND11689 PRMT7 "Protein arginine N-meth 0.863 0.869 0.318 2.4e-67
TAIR|locus:2130824 PRMT7 "protein arginine methyltransferase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2274 (805.5 bits), Expect = 7.9e-236, P = 7.9e-236
 Identities = 444/703 (63%), Positives = 528/703 (75%)

Query:     2 STQRMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAID 61
             S+QR+FQL+ DPLTGNSEW+VIE+N D P +S + LLATTSYLDMLNDS RN AYRLAI+
Sbjct:    37 SSQRVFQLRQDPLTGNSEWIVIEDN-DQPGTSTDGLLATTSYLDMLNDSRRNIAYRLAIE 95

Query:    62 KMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLH 121
             K +T+ CHVLDIGAGTGLLSMMA RAM   DS      KGMVTACESYLPMVKLM+KV+H
Sbjct:    96 KTITEPCHVLDIGAGTGLLSMMAVRAM-RGDS------KGMVTACESYLPMVKLMRKVMH 148

Query:   122 VNGMGRNIKVINKRSDELEVGV-DIDSRADILVSEILDSELLGEGLIPTLQHAHDRLLVE 180
              NGM +NI +INKRSDEL+VG  DI SRAD+LVSEILDSELLGEGLIP+LQHAHD LLV+
Sbjct:   149 KNGMTKNINLINKRSDELKVGSEDIASRADVLVSEILDSELLGEGLIPSLQHAHDMLLVD 208

Query:   181 NPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQYAMHC 240
             NP TVP R TTY QLVESTFL  L DL NNEAK  D + LVP G++S+  +KSQQY+MH 
Sbjct:   209 NPKTVPYRATTYCQLVESTFLCNLQDLRNNEAKTSDGVRLVPPGLESLFGIKSQQYSMHV 268

Query:   241 DAITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKSTDDGRVHAVVSWWVLQLDREGTI 300
             DAI KEIKLLSEP KIFEFDFWKRP+S+GE ++ I++   G VHA++SWWVLQLD EGTI
Sbjct:   269 DAIEKEIKLLSEPVKIFEFDFWKRPESNGELDVHIEAKTTGSVHAIISWWVLQLDSEGTI 328

Query:   301 FYSTAPRWISTGN------WCDHWKQCVWFIPGKGMSICKGEELLFHALHTETSVSYELK 354
             FYSTAPRWI + +      WCDHWKQCVWF PG G+SI KGE++  HA HT T++ Y LK
Sbjct:   329 FYSTAPRWIDSNSEIGVRDWCDHWKQCVWFTPGTGVSISKGEKVHLHASHTCTNILYNLK 388

Query:   355 SQIPITDERQH-NLNAKDFQLALPPERIAIYGDGEWRLSMVMAMRNALQGRVQPLCVVAD 413
                 +T ER H  L+  D  L LPPER+AIYGD  +R S+  A R ALQG+  P C+V D
Sbjct:   389 KTQSLTHERTHFPLSTGDLHLTLPPERVAIYGDSIYRQSLFEATRKALQGKSYPQCLVID 448

Query:   414 DSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEILQKGKKCLTMD 473
             DS+ L +    +S  + VLSL PGL +  A+Y   +AD N FS DR E  + GK  L   
Sbjct:   449 DSLLLPLMALHISNRSRVLSLSPGLQENAARYFEAIADSNGFSKDRFEYFRDGKTNLAK- 507

Query:   474 DTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIF 533
                  K+DLLIGEPYY G +  LPWQNLRFWK+R+ LD VLS++ ++MP+KG+L+ CA++
Sbjct:   508 -AYPGKIDLLIGEPYYSGLENGLPWQNLRFWKDRTLLDSVLSEDAVVMPYKGVLRGCAMY 566

Query:   534 CPDIWNSRRSLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTV 593
              PD+W SR  L  +EGFDH +VNT+LG CGDLP+ KD PCLPFF WQCGE K LS  FTV
Sbjct:   567 LPDLWKSRCCLGSVEGFDHTLVNTTLGGCGDLPSGKDSPCLPFFIWQCGETKILSKEFTV 626

Query:   594 MEFDFSKPIS-PCQGKVQVEFTEPGLCHGFALWIDWVLDSENSIVISTGPDKRYWKQGVK 652
             MEFDFSKPI+ PC G+VQ+EF +PG+CHG ALW+DWV+D ENS VISTGPD +YWKQGVK
Sbjct:   627 MEFDFSKPITGPCSGEVQIEFIKPGVCHGIALWMDWVMDEENSTVISTGPDDKYWKQGVK 686

Query:   653 LMAKPVAVGFEESGRTDLCSSTLVEASFD-PSNGELNVQHTFS 694
             L+ KPV V  E  G +   SS  ++AS D  SN EL V HT S
Sbjct:   687 LLGKPVTVRME--GPS---SSIGIQASLDLSSNSELIVTHTIS 724
GO:0006479 "protein methylation" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
UNIPROTKB|Q9NVM4 PRMT7 "Protein arginine N-methyltransferase 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PA95 PRMT7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2384879 Prmt7 "protein arginine N-methyltransferase 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304869 Prmt7 "protein arginine methyltransferase 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q99MI9 Prmt7 "Protein arginine N-methyltransferase 7" [Cricetulus longicaudatus (taxid:10030)] Back     alignment and assigned GO terms
UNIPROTKB|F1MQX7 PRMT7 "Protein arginine N-methyltransferase 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQV6 PRMT7 "Protein arginine N-methyltransferase 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIB9 PRMT7 "Protein arginine N-methyltransferase 7" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND11 PRMT7 "Protein arginine N-methyltransferase 7" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q944R7ANM16_ARATH2, ., 1, ., 1, ., -0.62730.97690.9364yesno
A2Y8B9ANM7_ORYSI2, ., 1, ., 1, ., -0.58820.96250.9277N/Ano
A2AV36ANM7_DANRE2, ., 1, ., 1, ., 1, 2, 60.30500.92070.9355yesno
Q5VS72ANM7_ORYSJ2, ., 1, ., 1, ., -0.58680.96250.9277yesno
Q9NVM4ANM7_HUMAN2, ., 1, ., 1, ., 1, 2, 60.30610.86590.8684yesno
Q5ZIB9ANM7_CHICK2, ., 1, ., 1, ., 1, 2, 60.30360.93080.9375yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.766
4th Layer2.1.1.1250.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query694
COG4076252 COG4076, COG4076, Predicted RNA methylase [General 4e-10
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 0.001
>gnl|CDD|226562 COG4076, COG4076, Predicted RNA methylase [General function prediction only] Back     alignment and domain information 
 Score = 60.7 bits (147), Expect = 4e-10
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 21/164 (12%)

Query: 37  LLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTS 96
           LL  + +LD+L D  R   +  AI ++   +    D+GAG+G+LS++AA A         
Sbjct: 5   LLVDSYHLDLLRDVERLAVFTSAIAEVAEDT--FADLGAGSGILSVVAAHAAER------ 56

Query: 97  LNTKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEI 156
                 V A E      +L ++ LHV G   N +V+   + + +        AD+++ E+
Sbjct: 57  ------VIAIEKDPKRARLAEENLHVPGD-VNWEVVVGDARDYDF-----ENADVVICEM 104

Query: 157 LDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTF 200
           LD+ L+ E  +P +    +  L  +P  +P  V      V    
Sbjct: 105 LDTALIEEKQVPVINAVLE-FLRYDPTIIPQEVRIGANPVRRPP 147

Length = 252
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 694
KOG1501636 consensus Arginine N-methyltransferase [General fu 100.0
KOG1499346 consensus Protein arginine N-methyltransferase PRM 100.0
KOG1500517 consensus Protein arginine N-methyltransferase CAR 100.0
KOG1499346 consensus Protein arginine N-methyltransferase PRM 100.0
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 100.0
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 100.0
KOG1500517 consensus Protein arginine N-methyltransferase CAR 100.0
KOG0822649 consensus Protein kinase inhibitor [Cell cycle con 99.97
KOG1501 636 consensus Arginine N-methyltransferase [General fu 99.96
PTZ003571072 methyltransferase; Provisional 99.94
COG4076252 Predicted RNA methylase [General function predicti 99.69
COG4076252 Predicted RNA methylase [General function predicti 99.68
KOG0822649 consensus Protein kinase inhibitor [Cell cycle con 99.56
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.5
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.49
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.45
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.41
PLN02336475 phosphoethanolamine N-methyltransferase 99.41
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.39
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.35
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.35
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.35
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.35
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.33
COG4123248 Predicted O-methyltransferase [General function pr 99.3
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.28
PTZ003571072 methyltransferase; Provisional 99.28
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.27
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.26
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.26
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.23
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.23
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.23
PLN02233261 ubiquinone biosynthesis methyltransferase 99.22
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.22
PRK11207197 tellurite resistance protein TehB; Provisional 99.22
PLN02244340 tocopherol O-methyltransferase 99.21
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.21
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.19
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.18
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.18
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.18
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.17
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.14
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.14
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.13
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.13
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.12
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.12
COG2890280 HemK Methylase of polypeptide chain release factor 99.12
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.11
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.11
PRK12335287 tellurite resistance protein TehB; Provisional 99.11
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.1
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.09
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.09
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.09
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.09
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.08
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.06
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.05
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.05
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.05
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.05
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.04
PRK14967223 putative methyltransferase; Provisional 99.03
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.03
PRK04266226 fibrillarin; Provisional 99.02
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.01
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.01
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.0
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.0
PRK04457262 spermidine synthase; Provisional 99.0
TIGR00452314 methyltransferase, putative. Known examples to dat 99.0
PRK07402196 precorrin-6B methylase; Provisional 99.0
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.99
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.97
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.97
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.97
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.96
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.95
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.95
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.95
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.94
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.93
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.92
KOG2904328 consensus Predicted methyltransferase [General fun 98.92
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.92
PRK06922677 hypothetical protein; Provisional 98.91
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.91
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.91
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.91
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.91
PLN02336475 phosphoethanolamine N-methyltransferase 98.9
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.9
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.89
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.88
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.87
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.87
PRK14968188 putative methyltransferase; Provisional 98.87
PHA03412241 putative methyltransferase; Provisional 98.86
PLN03075296 nicotianamine synthase; Provisional 98.85
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.85
PRK05785226 hypothetical protein; Provisional 98.84
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.84
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.84
PLN02476278 O-methyltransferase 98.84
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.84
PHA03411279 putative methyltransferase; Provisional 98.83
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.83
PRK08317241 hypothetical protein; Provisional 98.83
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.81
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.8
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.79
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.79
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.79
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.79
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.79
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.78
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.78
KOG1271227 consensus Methyltransferases [General function pre 98.78
PLN02490340 MPBQ/MSBQ methyltransferase 98.78
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.78
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.78
COG4122219 Predicted O-methyltransferase [General function pr 98.78
TIGR03438301 probable methyltransferase. This model represents 98.78
PLN02672 1082 methionine S-methyltransferase 98.77
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.76
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.76
PTZ00146293 fibrillarin; Provisional 98.76
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.75
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.74
PRK14902444 16S rRNA methyltransferase B; Provisional 98.74
PRK00811283 spermidine synthase; Provisional 98.73
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.72
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.7
PRK14901434 16S rRNA methyltransferase B; Provisional 98.7
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.7
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.68
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.68
PRK14903431 16S rRNA methyltransferase B; Provisional 98.68
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.67
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.67
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.67
PRK14904445 16S rRNA methyltransferase B; Provisional 98.67
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.66
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.66
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.66
PRK10901427 16S rRNA methyltransferase B; Provisional 98.65
PRK01581374 speE spermidine synthase; Validated 98.64
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.64
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.63
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.63
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.63
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.62
KOG4300252 consensus Predicted methyltransferase [General fun 98.62
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.61
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.61
COG2520341 Predicted methyltransferase [General function pred 98.61
PLN02589247 caffeoyl-CoA O-methyltransferase 98.59
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.59
COG4123248 Predicted O-methyltransferase [General function pr 98.58
PLN02366308 spermidine synthase 98.57
COG4106257 Tam Trans-aconitate methyltransferase [General fun 98.56
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.56
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.55
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.54
PRK03612521 spermidine synthase; Provisional 98.53
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.53
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.53
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.53
TIGR00438188 rrmJ cell division protein FtsJ. 98.52
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.52
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.51
PRK06202232 hypothetical protein; Provisional 98.51
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.51
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.5
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.49
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.47
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.43
COG2521287 Predicted archaeal methyltransferase [General func 98.42
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.42
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.41
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.39
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.35
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.35
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.34
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.32
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.31
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.3
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.3
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.3
PLN02823336 spermine synthase 98.3
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.29
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.29
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.29
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.26
PRK11207197 tellurite resistance protein TehB; Provisional 98.24
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.23
KOG3010261 consensus Methyltransferase [General function pred 98.23
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.22
COG3897218 Predicted methyltransferase [General function pred 98.21
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 98.2
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.2
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.2
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.19
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.19
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.18
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.18
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.18
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.17
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.16
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.16
KOG2899288 consensus Predicted methyltransferase [General fun 98.15
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.14
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.14
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.12
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.12
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.12
TIGR00452314 methyltransferase, putative. Known examples to dat 98.11
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.11
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.1
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.09
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.09
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.09
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.09
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.08
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.07
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.07
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.07
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.05
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.04
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 98.02
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.02
PRK12335287 tellurite resistance protein TehB; Provisional 98.01
PRK07402196 precorrin-6B methylase; Provisional 98.0
COG1041347 Predicted DNA modification methylase [DNA replicat 98.0
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 97.99
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.99
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 97.99
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.98
PRK14967223 putative methyltransferase; Provisional 97.97
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 97.96
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.96
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 97.96
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.95
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 97.94
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.94
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 97.93
PLN02244340 tocopherol O-methyltransferase 97.92
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 97.91
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 97.89
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.89
PLN02233261 ubiquinone biosynthesis methyltransferase 97.88
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.87
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.86
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 97.85
PRK04148134 hypothetical protein; Provisional 97.84
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 97.84
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.84
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.84
PRK04266226 fibrillarin; Provisional 97.83
PRK04457262 spermidine synthase; Provisional 97.82
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.82
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.81
KOG2361264 consensus Predicted methyltransferase [General fun 97.81
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.78
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.77
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 97.76
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.76
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 97.76
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 97.73
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.73
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.72
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 97.71
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.71
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.7
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.7
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 97.7
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.7
PHA03412241 putative methyltransferase; Provisional 97.7
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.69
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 97.69
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 97.69
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.69
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 97.68
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.67
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.67
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 97.66
PRK10742250 putative methyltransferase; Provisional 97.66
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 97.65
PHA03411279 putative methyltransferase; Provisional 97.63
smart00650169 rADc Ribosomal RNA adenine dimethylases. 97.63
KOG2904328 consensus Predicted methyltransferase [General fun 97.63
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 97.6
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 97.6
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 97.6
PRK14902444 16S rRNA methyltransferase B; Provisional 97.6
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 97.59
PRK14968188 putative methyltransferase; Provisional 97.59
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 97.58
PRK00536262 speE spermidine synthase; Provisional 97.58
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.58
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 97.58
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.57
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 97.56
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.55
PLN02476278 O-methyltransferase 97.55
KOG3201201 consensus Uncharacterized conserved protein [Funct 97.55
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 97.53
PLN02232160 ubiquinone biosynthesis methyltransferase 97.52
PF13679141 Methyltransf_32: Methyltransferase domain 97.51
COG2384226 Predicted SAM-dependent methyltransferase [General 97.51
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.5
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.5
COG2521287 Predicted archaeal methyltransferase [General func 97.49
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.48
PTZ00338294 dimethyladenosine transferase-like protein; Provis 97.47
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 97.47
COG2890280 HemK Methylase of polypeptide chain release factor 97.46
PRK00811283 spermidine synthase; Provisional 97.46
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.46
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 97.45
PTZ00146293 fibrillarin; Provisional 97.44
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 97.43
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 97.4
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.4
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.4
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 97.39
PRK08317241 hypothetical protein; Provisional 97.39
TIGR00740239 methyltransferase, putative. A simple BLAST search 97.36
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 97.35
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 97.34
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 97.33
COG3897218 Predicted methyltransferase [General function pred 97.32
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.3
PRK14901434 16S rRNA methyltransferase B; Provisional 97.29
PRK10901427 16S rRNA methyltransferase B; Provisional 97.28
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 97.27
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.26
KOG1271227 consensus Methyltransferases [General function pre 97.26
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.25
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 97.23
KOG1227351 consensus Putative methyltransferase [General func 97.23
PRK01581374 speE spermidine synthase; Validated 97.22
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.21
PLN02672 1082 methionine S-methyltransferase 97.21
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.19
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.19
PLN02490340 MPBQ/MSBQ methyltransferase 97.18
PLN03075296 nicotianamine synthase; Provisional 97.18
PRK14904445 16S rRNA methyltransferase B; Provisional 97.17
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.16
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.16
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.16
COG4262508 Predicted spermidine synthase with an N-terminal m 97.13
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.13
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.13
PRK06922677 hypothetical protein; Provisional 97.12
TIGR00438188 rrmJ cell division protein FtsJ. 97.11
PHA01634156 hypothetical protein 97.09
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.09
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 97.08
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.08
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 97.08
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.07
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 97.07
PLN02366308 spermidine synthase 97.04
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.03
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.01
PRK03612521 spermidine synthase; Provisional 97.01
PRK10258251 biotin biosynthesis protein BioC; Provisional 96.99
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 96.97
COG2520341 Predicted methyltransferase [General function pred 96.94
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 96.94
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 96.92
KOG2730263 consensus Methylase [General function prediction o 96.92
PRK14903431 16S rRNA methyltransferase B; Provisional 96.89
KOG1709271 consensus Guanidinoacetate methyltransferase and r 96.86
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 96.86
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 96.82
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 96.81
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 96.81
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 96.8
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 96.8
PLN02823336 spermine synthase 96.77
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 96.77
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.77
COG2265432 TrmA SAM-dependent methyltransferases related to t 96.77
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 96.75
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 96.74
KOG4058199 consensus Uncharacterized conserved protein [Funct 96.73
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 96.71
PLN02589247 caffeoyl-CoA O-methyltransferase 96.66
COG4122219 Predicted O-methyltransferase [General function pr 96.65
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 96.64
KOG2940325 consensus Predicted methyltransferase [General fun 96.64
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 96.6
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 96.59
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 96.56
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 96.51
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 96.51
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 96.49
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 96.47
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 96.46
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 96.42
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 96.42
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 96.4
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 96.36
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 96.35
PHA01634156 hypothetical protein 96.32
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 96.3
KOG4300252 consensus Predicted methyltransferase [General fun 96.29
PRK10742250 putative methyltransferase; Provisional 96.21
KOG1663237 consensus O-methyltransferase [Secondary metabolit 96.21
PRK06202232 hypothetical protein; Provisional 96.19
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 96.16
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 96.15
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 96.15
PLN02585315 magnesium protoporphyrin IX methyltransferase 96.13
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 96.07
COG1867380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 96.01
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 95.99
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 95.87
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 95.83
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 95.81
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 95.67
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 95.67
PRK05785226 hypothetical protein; Provisional 95.64
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 95.63
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 95.61
PF13679141 Methyltransf_32: Methyltransferase domain 95.56
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 95.46
KOG3045325 consensus Predicted RNA methylase involved in rRNA 95.43
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 95.26
KOG2920282 consensus Predicted methyltransferase [General fun 95.21
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 95.2
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 95.12
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 95.06
COG1041347 Predicted DNA modification methylase [DNA replicat 95.05
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 95.01
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 95.01
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 94.98
PRK13256226 thiopurine S-methyltransferase; Reviewed 94.93
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 94.73
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 94.66
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 94.62
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 94.57
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 94.55
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 94.4
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 94.26
KOG3987288 consensus Uncharacterized conserved protein DREV/C 94.07
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 94.04
KOG1253525 consensus tRNA methyltransferase [Translation, rib 94.0
KOG3420185 consensus Predicted RNA methylase [Translation, ri 93.92
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 93.92
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 93.9
COG3129292 Predicted SAM-dependent methyltransferase [General 93.89
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 93.86
TIGR03438301 probable methyltransferase. This model represents 93.85
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 93.7
COG4106257 Tam Trans-aconitate methyltransferase [General fun 93.67
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 93.65
KOG3115249 consensus Methyltransferase-like protein [General 93.62
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 93.59
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 93.46
KOG2078495 consensus tRNA modification enzyme [RNA processing 93.34
PRK11524284 putative methyltransferase; Provisional 93.31
PRK13699227 putative methylase; Provisional 93.24
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 92.86
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 92.85
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 92.85
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 92.79
COG2384226 Predicted SAM-dependent methyltransferase [General 92.77
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 92.74
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 92.62
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 92.58
KOG3010261 consensus Methyltransferase [General function pred 92.39
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 92.05
KOG2671421 consensus Putative RNA methylase [Replication, rec 91.92
PRK04148134 hypothetical protein; Provisional 91.5
COG0286489 HsdM Type I restriction-modification system methyl 91.31
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 91.31
KOG2899288 consensus Predicted methyltransferase [General fun 91.15
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 91.13
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 90.98
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 90.95
KOG2352482 consensus Predicted spermine/spermidine synthase [ 90.83
COG1568354 Predicted methyltransferases [General function pre 90.69
KOG1227351 consensus Putative methyltransferase [General func 90.67
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 90.55
KOG1709271 consensus Guanidinoacetate methyltransferase and r 90.29
PRK09880343 L-idonate 5-dehydrogenase; Provisional 90.07
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 89.98
PF00145335 DNA_methylase: C-5 cytosine-specific DNA methylase 89.86
PRK00536262 speE spermidine synthase; Provisional 89.5
COG4798238 Predicted methyltransferase [General function pred 89.27
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 88.7
KOG1562337 consensus Spermidine synthase [Amino acid transpor 88.52
KOG3201201 consensus Uncharacterized conserved protein [Funct 88.52
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=8.7e-80  Score=630.38  Aligned_cols=600  Identities=35%  Similarity=0.520  Sum_probs=491.9

Q ss_pred             ccccccccCCCCCccceeEeccCCCCCCCccccccccchHHHhhCCHHHHHHHHHHHHhhccCC--------CEEEEEcC
Q 044245            4 QRMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAIDKMVTKS--------CHVLDIGA   75 (694)
Q Consensus         4 ~~~~~~~~~~~~g~~~w~~~~~~~~~p~~~~~~~l~~~~~~~ml~D~~r~~~y~~ai~~~~~~~--------~~VLDiG~   75 (694)
                      ++||++|.||.||+.||..++++||     +++.++++.|.+|++|..||.+|+.+|++.+.+.        ..|||||+
T Consensus         1 ~~vF~~r~np~TG~~EWiv~ee~yd-----~~qelArSsy~DMl~D~dRNiky~~gi~~tIte~kh~~~~gkv~vLdigt   75 (636)
T KOG1501|consen    1 QRVFQLRQNPLTGNSEWIVIEENYD-----TDQELARSSYLDMLNDSDRNIKYRLGIEKTITEPKHVLDIGKVFVLDIGT   75 (636)
T ss_pred             CchhhhhcCCCCCceeEEEeecccc-----hHHHHHHhhHHHHhhcccccHHHHHHHHHHhcccceeccCceEEEEEccC
Confidence            5899999999999999999999999     7999999999999999999999999999877642        46899999


Q ss_pred             CCCHHHHHHHHHcCCCCCCccCCCccEEEEEcCCHHHHHHHHHHHHHcCCCCcEEEEeccccccccccCCCCCccEEEEc
Q 044245           76 GTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSE  155 (694)
Q Consensus        76 GtG~lsl~aa~~g~~~~~~~~~~~~~~V~avE~s~~~~~~A~~~~~~ngl~~~I~vi~~~~~~l~~~~~l~~~~DlIvse  155 (694)
                      |||+|||||+++|+           .+|||||.-.+|.++|+++...||++++|++|+++++++..+..  .+.|+++.|
T Consensus        76 GTGLLSmMAvraga-----------D~vtA~EvfkPM~d~arkI~~kng~SdkI~vInkrStev~vg~~--~RadI~v~e  142 (636)
T KOG1501|consen   76 GTGLLSMMAVRAGA-----------DSVTACEVFKPMVDLARKIMHKNGMSDKINVINKRSTEVKVGGS--SRADIAVRE  142 (636)
T ss_pred             CccHHHHHHHHhcC-----------CeEEeehhhchHHHHHHHHHhcCCCccceeeeccccceeeecCc--chhhhhhHh
Confidence            99999999999997           68999999999999999999999999999999999999986431  579999999


Q ss_pred             cccccccCCChHHHHHHHHHhccCCCCeEEcCceEEEEEEecchhhhhhcccCcccccccCCeeeccCCccceeeecccc
Q 044245          156 ILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHLVPAGMDSILHVKSQQ  235 (694)
Q Consensus       156 ~~~~~l~~e~~l~~l~~~~~~~L~p~G~iiP~~~~~~~~~ve~~~l~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~  235 (694)
                      .++..+++|+.++.+.+|.++++.+|.+.+|.++|+|+++|||..||.++++.+.+.+...|+.+.|.+.++..+++..+
T Consensus       143 ~fdtEligeGalps~qhAh~~L~~~nc~~VP~ratvY~qlVES~~l~~~ndl~~~~~~ts~gv~~~p~~lesc~G~~sv~  222 (636)
T KOG1501|consen  143 DFDTELIGEGALPSLQHAHDMLLVDNCKTVPYRATVYCQLVESTFLCNLNDLRNNEAKTSDGVRLVPPGLESCFGIKSVQ  222 (636)
T ss_pred             hhhhhhhccccchhHHHHHHHhcccCCeeccccceEEEEEehhhhhhhhhccccccccccCCcccCCCccccCCCchhHH
Confidence            99999999999999999999999999999999999999999999999999988877788899999988887776666555


Q ss_pred             eeeeeccccccceecCCCeEEEEEEcCCCCCCC--ceeeEEEEEccCCceeEEEEEEEEeecCCCcEEecCCCCCCC---
Q 044245          236 YAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSH--GEAELQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWIS---  310 (694)
Q Consensus       236 ~~~~~~~~~~~~~~Ls~p~~~~~fdf~~~~~~~--~~~~~~~~~~~~G~~~g~~~Wf~~~l~~~~~i~lST~P~~~~---  310 (694)
                      ....++..+.+++.||++-.+|.+||.......  ..........++|++....+||++.||..+.+.+..+|.|.+   
T Consensus       223 d~ql~~~~~~ef~~Ls~~~~~F~~df~~~~~s~s~~~~~r~~va~~Sg~~~~~l~wwdi~mD~~g~~f~~m~p~w~~~~~  302 (636)
T KOG1501|consen  223 DSQLVDAIEKEFKLLSSEGTIFYSDFPRWIDSNSEIEELRPPVAVHSGPLRSNLLWWDISMDQFGFSFLVMQPLWTGVTI  302 (636)
T ss_pred             HHHHhhcchhhheeecCcceeEEeecchhhhcchhhhhhcCcccccccchhheeeeeeeeeccCcceEEEecceecCCCh
Confidence            555566777889999999999999998533222  122334566789999999999999999999999999998852   


Q ss_pred             -CCCccCccceeeeecCC-Ccee-ecCCCEEEEEEEecceEEEEEEeeecCCCcc---ccccccCcCcccccChh--HHh
Q 044245          311 -TGNWCDHWKQCVWFIPG-KGMS-ICKGEELLFHALHTETSVSYELKSQIPITDE---RQHNLNAKDFQLALPPE--RIA  382 (694)
Q Consensus       311 -~~~w~~hW~Q~v~~l~~-~pi~-V~~Gd~l~~~~~~d~~~~~~~~~~~~~~~~~---~~~~~~~~~~h~~~~r~--~i~  382 (694)
                       +..|+.||.|+++++++ +..+ ++....+.+-..|+..++|+...-..+-.+.   ...+.|.|+.|+.+-+.  ++.
T Consensus       303 ~~~~~~~~weq~c~y~~~~~~~~i~~~ss~~~v~~~H~~l~i~~~~h~~~~~~n~r~~~~~~~~~~~~h~a~~~~~s~~g  382 (636)
T KOG1501|consen  303 GNSVFGLLWEQACPYPKEKKGNRIHNVSSLMTVFSYHLWLYIYRTDHYHCHLGNKRFMLPDTLKPLLIHMAFQKIVSNIG  382 (636)
T ss_pred             HHHHHHHHHHHhcCCChhhhcCceeeccceEEEeeeeeeeEEeeeeeeccccccccccCcccccchhhhhhhhccchhHh
Confidence             34588999999998863 1233 4444677777889999999887644332222   23466889999988877  788


Q ss_pred             hcCChhHHHHHHHHHHHHhcCCCCCcEEEecCCchHHHHHHHcCCCceEEEcCCCcChhHHHHHHHHhccCCcccccEEE
Q 044245          383 IYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDRVEI  462 (694)
Q Consensus       383 ml~D~~r~~~y~~Ai~~~~~~~~~~~vldig~GgiLsl~aA~~g~a~~V~ave~~~~~~~~~~~~~i~~~N~l~~~~i~v  462 (694)
                      .++++.|+..|..++.+...                                             .+.++|-+. .+++.
T Consensus       383 e~~~q~~~~r~~~~l~e~~r---------------------------------------------~if~~~~~~-~Klsn  416 (636)
T KOG1501|consen  383 EMGRQIWPKRIQARLSERER---------------------------------------------VIFNQRLIQ-LKLSN  416 (636)
T ss_pred             hhhhhhhhHHHHHHHHHHHH---------------------------------------------HHHHHHHHH-Hhhcc
Confidence            99999998888877663221                                             111111111 23333


Q ss_pred             eecccccccccccCCccccEEEccccccCCccccCcchhhHHHHHhhcccccCCCceEEcceEEEEEEEccChhhhhhcC
Q 044245          463 LQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDIWNSRR  542 (694)
Q Consensus       463 i~~~~~~~~~~~l~~~~vDvivsE~~~~~~e~~l~w~~l~f~~~r~~~~~~L~p~g~i~P~~a~l~~~~v~~~~l~~~~~  542 (694)
                      ++...+-++.+    ...|++++||||..  +|+||.+|+|||.+.+++..+.|+.++.|+.+.|.|.|+++++||+++.
T Consensus       417 ~e~vp~i~t~~----ds~~ivl~epf~~t--am~PW~~L~F~Y~~~~l~~~~G~~~~V~P~~~~L~Ai~~kF~DL~~I~S  490 (636)
T KOG1501|consen  417 NESVPAIMTSP----DSPDIVLAEPFVKT--AMNPWNHLRFLYDVEVLKMMHGDELRVEPHMGVLKAIPEKFEDLQNIAS  490 (636)
T ss_pred             cccchhhhcCC----CCCceeecchhhhh--ccCchhheeeeeeHHHHHHhcCCceeeccccchhhhhhHHHHHHHhhcc
Confidence            33322223332    24589999999996  8999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccccccchhhhhhcCCCCCCCCCCCCCccccccccccccCCceeEEEEeCCCCCCCcceeEEEEecCCeeeeEE
Q 044245          543 SLSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPISPCQGKVQVEFTEPGLCHGF  622 (694)
Q Consensus       543 ~~~~v~G~d~s~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~ls~~~~l~~~d~~~~~~~~~~~~~~~~~~~g~~~g~  622 (694)
                      ++++|.|||++-|+++.....++.+-. .+..|+|+|+|   ..+++|.+|++|||..+....  +..+.+.+.|.-||+
T Consensus       491 ~~G~~~GFDl~~~Dei~~kA~~~~da~-~~E~~LWEY~~---~~~~d~~eIL~F~~~~~V~~Q--k~~V~i~~~~sS~A~  564 (636)
T KOG1501|consen  491 DVGTVNGFDLSFFDEISTKARTATDAI-VDEQSLWEYAG---IVKGDAVEILRFPIDGRVSSQ--KCVVNIDNMSSSNAI  564 (636)
T ss_pred             cccccccceeeehhHHHHhhchhhhhh-hccchhhhccC---eecCCceeEEEeccCCccccc--eeEEEccCCCccccc
Confidence            999999999999999865443322211 23358999987   689999999999999976432  456889999999999


Q ss_pred             EEEEEEEecCCCcEEEecCCC----------CCceeeeEEecCcceeccccCCCCCCcceeEEEEEEEeCCCeeEEEEee
Q 044245          623 ALWIDWVLDSENSIVISTGPD----------KRYWKQGVKLMAKPVAVGFEESGRTDLCSSTLVEASFDPSNGELNVQHT  692 (694)
Q Consensus       623 ~~Wfd~~~~~~~~~~lst~P~----------~~hW~Q~v~~l~~p~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  692 (694)
                      +.||+|.|.+   +.||||..          .+|.||+|||+   +..-.|+       +++++.+.||+++|+|+|+..
T Consensus       565 ~mWME~~~~~---~nLSTGLL~~~~~G~~~WN~~~KQ~VYF~---~t~L~~~-------ksl~~~~~F~~~TGDI~~qF~  631 (636)
T KOG1501|consen  565 PMWMEWEFGG---INLSTGLLSISSAGVPEWNKGYKQGVYFP---ITALRND-------KSLCLHALFDKSTGDINFQFG  631 (636)
T ss_pred             eeeEEeeeCc---eeecccceeecCCCCcccCccccceeEEE---hHHhCCC-------ceEEEEEEEcCCCCceEEEec
Confidence            9999999985   45888875          24669999987   4444555       389999999999999998753

>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query694
1or8_A340 Structure Of The Predominant Protein Arginine Methy 1e-13
1ori_A343 Structure Of The Predominant Protein Arginine Methy 2e-13
1orh_A353 Structure Of The Predominant Protein Arginine Methy 5e-13
3q7e_A349 Crystal Structure Of Rat Protein Arginine Methyltra 7e-13
1g6q_1328 Crystal Structure Of Yeast Arginine Methyltransfera 3e-11
2fyt_A340 Human Hmt1 Hnrnp Methyltransferase-Like 3 (S. Cerev 5e-08
1f3l_A321 Crystal Structure Of The Conserved Core Of Protein 5e-07
4hc4_A376 Human Hmt1 Hnrnp Methyltransferase-Like Protein 6 ( 1e-06
3b3j_A480 The 2.55 A Crystal Structure Of The Apo Catalytic D 4e-04
2y1w_A348 Crystal Structure Of Coactivator Associated Arginin 5e-04
3b3f_A341 The 2.2 A Crystal Structure Of The Catalytic Domain 6e-04
>pdb|1OR8|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 340 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 140/303 (46%), Gaps = 43/303 (14%)
Query: 45  DMLNDSYRNRAYRLAI--DKMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGM 102
           +ML D  R   YR ++  ++ + K   VLD+G+GTG+L M AA+A            K +
Sbjct: 34  EMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAR---------KVI 84
Query: 103 VTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSELL 162
              C S   +     K++  N +   + +I  + +E+E+ V+   + DI++SE +   L 
Sbjct: 85  GIECSS---ISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE---KVDIIISEWMGYCLF 138
Query: 163 GEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFL--WKLH---DLYNNEAKALDD 217
            E ++ T+ HA D+ L  + L  P R T Y   +E      +K+H   ++Y  +   + D
Sbjct: 139 YESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKD 198
Query: 218 IHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAELQIKS 277
           + +    +D    V  +Q   +   + KE+ + +   +   F             LQ+K 
Sbjct: 199 VAIKEPLVDV---VDPKQLVTNA-CLIKEVDIYTVKVEDLTFT--------SPFCLQVKR 246
Query: 278 TDDGRVHAVVSWWVLQLDR-EGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGE 336
            D   VHA+V+++ ++  R      +ST+P    T     HWKQ V+++    +++  GE
Sbjct: 247 ND--YVHALVAYFNIEFTRCHKRTGFSTSPESPYT-----HWKQTVFYMEDY-LTVKTGE 298
Query: 337 ELL 339
           E+ 
Sbjct: 299 EIF 301
>pdb|1ORI|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 343 Back     alignment and structure
>pdb|1ORH|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 353 Back     alignment and structure
>pdb|3Q7E|A Chain A, Crystal Structure Of Rat Protein Arginine Methyltransferase 1 (Prmt1) M48l Mutant Length = 349 Back     alignment and structure
>pdb|1G6Q|1 Chain 1, Crystal Structure Of Yeast Arginine Methyltransferase, Hmt1 Length = 328 Back     alignment and structure
>pdb|2FYT|A Chain A, Human Hmt1 Hnrnp Methyltransferase-Like 3 (S. Cerevisiae) Protein Length = 340 Back     alignment and structure
>pdb|1F3L|A Chain A, Crystal Structure Of The Conserved Core Of Protein Arginine Methyltransferase Prmt3 Length = 321 Back     alignment and structure
>pdb|4HC4|A Chain A, Human Hmt1 Hnrnp Methyltransferase-Like Protein 6 (S. Cerevisiae) Length = 376 Back     alignment and structure
>pdb|3B3J|A Chain A, The 2.55 A Crystal Structure Of The Apo Catalytic Domain Of Coactivator-Associated Arginine Methyl Transferase I(Carm1:28-507, Residues 28-146 And 479-507 Not Ordered) Length = 480 Back     alignment and structure
>pdb|2Y1W|A Chain A, Crystal Structure Of Coactivator Associated Arginine Methyltransferase 1 (Carm1) In Complex With Sinefungin And Indole Inhibitor Length = 348 Back     alignment and structure
>pdb|3B3F|A Chain A, The 2.2 A Crystal Structure Of The Catalytic Domain Of Coactivator- Associated Arginine Methyl Transferase I(Carm1,142-478), In Complex With S-Adenosyl Homocysteine Length = 341 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query694
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 3e-60
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 2e-09
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 1e-57
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 1e-10
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 1e-57
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 2e-09
2fyt_A340 Protein arginine N-methyltransferase 3; structural 2e-56
2fyt_A340 Protein arginine N-methyltransferase 3; structural 3e-08
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 5e-54
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 1e-11
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 2e-52
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 3e-11
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 6e-39
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 4e-05
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 2e-04
3lpm_A259 Putative methyltransferase; structural genomics, p 5e-04
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Length = 349 Back     alignment and structure
 Score =  205 bits (522), Expect = 3e-60
 Identities = 68/304 (22%), Positives = 129/304 (42%), Gaps = 37/304 (12%)

Query: 43  YLDMLNDSYRNRAYRLAI--DKMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTK 100
           + ++L D  R   YR ++  ++ + K   VLD+G+GTG+L M AA+A             
Sbjct: 41  HEELLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARK--------- 91

Query: 101 GMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSE 160
             V   E    +     K++  N +   + +I  + +E+E+ V+   + DI++SE +   
Sbjct: 92  --VIGIEC-SSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE---KVDIIISEWMGYC 145

Query: 161 LLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHL 220
           L  E ++ T+ HA D+ L  + L  P R T Y   +E          +       D   +
Sbjct: 146 LFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCI 205

Query: 221 VPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFW--KRPDSHGEAELQIKST 278
               +   L           D +  + +L++    I E D +  K  D    +   ++  
Sbjct: 206 KDVAIKEPL----------VDVVDPK-QLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVK 254

Query: 279 DDGRVHAVVSWWVLQLDR-EGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEE 337
            +  VHA+V+++ ++  R      +ST+P          HWKQ V+++    +++  GEE
Sbjct: 255 RNDYVHALVAYFNIEFTRCHKRTGFSTSPES-----PYTHWKQTVFYME-DYLTVKTGEE 308

Query: 338 LLFH 341
           +   
Sbjct: 309 IFGT 312
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Length = 349 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Length = 328 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Length = 328 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Length = 376 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Length = 376 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Length = 340 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Length = 340 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Length = 348 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Length = 348 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Length = 480 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Length = 480 Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Length = 745 Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Length = 745 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query694
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 100.0
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 100.0
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 100.0
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 100.0
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 100.0
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 100.0
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 100.0
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 100.0
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 100.0
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 100.0
2fyt_A340 Protein arginine N-methyltransferase 3; structural 100.0
2fyt_A340 Protein arginine N-methyltransferase 3; structural 100.0
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 100.0
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 100.0
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 100.0
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 100.0
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 99.97
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 99.97
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.46
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.43
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.37
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.36
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.35
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.34
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.34
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.32
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.31
3k6r_A278 Putative transferase PH0793; structural genomics, 99.3
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.3
3f4k_A257 Putative methyltransferase; structural genomics, P 99.29
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.29
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.28
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.27
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.27
3lpm_A259 Putative methyltransferase; structural genomics, p 99.26
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.26
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.26
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.26
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.25
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.25
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.25
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.24
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.23
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.23
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.22
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.22
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.22
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.22
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.22
3ocj_A305 Putative exported protein; structural genomics, PS 99.22
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.22
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.21
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.21
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.21
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.21
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.19
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.19
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.19
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.19
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.19
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.18
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.17
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.17
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.17
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.17
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.17
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.16
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.16
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.16
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.16
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.16
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.16
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.16
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.16
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.15
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.15
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.15
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.15
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.15
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.14
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.14
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.14
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.14
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.14
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.14
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.13
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.13
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.13
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.12
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.12
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.12
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.11
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.11
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.11
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.11
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.11
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.11
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.11
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.1
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.1
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.1
3lcc_A235 Putative methyl chloride transferase; halide methy 99.1
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.1
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.09
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.08
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.08
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.08
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.08
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.08
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.08
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.07
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.07
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.07
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.07
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.07
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.06
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.06
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.06
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.06
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.06
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.06
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.06
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.06
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.05
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.05
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.04
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.04
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.04
2h00_A254 Methyltransferase 10 domain containing protein; st 99.04
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.04
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.04
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.03
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.03
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.03
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.03
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.03
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.03
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.02
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.02
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.02
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.02
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.02
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.02
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.02
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.01
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.01
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.01
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.0
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.0
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.0
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.0
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.99
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.99
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.99
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.99
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.99
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.98
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.98
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.98
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.97
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.97
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.97
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.97
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.97
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.96
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.96
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.95
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.95
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.95
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.95
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.95
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.95
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.94
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.94
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.94
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.94
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.94
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.93
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.93
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.93
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.93
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.93
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.93
2pt6_A321 Spermidine synthase; transferase, structural genom 98.93
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.92
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.92
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.92
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.92
2o07_A304 Spermidine synthase; structural genomics, structur 98.91
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.91
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.9
2b25_A336 Hypothetical protein; structural genomics, methyl 98.9
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.89
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.89
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.89
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.89
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.88
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.88
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.87
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.87
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.87
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.87
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.86
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.86
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.85
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.85
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.85
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.84
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.84
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.84
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.83
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.83
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.82
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.81
2i7c_A283 Spermidine synthase; transferase, structural genom 98.81
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.81
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.81
3k6r_A278 Putative transferase PH0793; structural genomics, 98.81
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.8
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.79
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.79
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.79
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.79
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.79
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.79
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.78
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.78
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.77
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.77
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.76
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.76
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.75
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.75
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.75
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.74
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.74
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.73
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.72
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.72
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.71
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.68
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.67
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.67
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.65
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.63
2frn_A278 Hypothetical protein PH0793; structural genomics, 98.62
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.62
3cc8_A230 Putative methyltransferase; structural genomics, j 98.61
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.61
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.61
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.61
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.61
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.6
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.6
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.6
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.59
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 98.59
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.59
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.59
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.58
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.58
2esr_A177 Methyltransferase; structural genomics, hypothetic 98.58
3lpm_A259 Putative methyltransferase; structural genomics, p 98.55
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.55
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.55
2fpo_A202 Methylase YHHF; structural genomics, putative meth 98.55
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.53
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.53
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.52
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.51
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.5
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.5
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.5
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.49
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.49
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 98.49
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.48
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.47
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.47
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.47
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.47
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.46
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.45
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.45
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.45
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.42
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.41
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.4
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.4
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.38
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.38
3f4k_A257 Putative methyltransferase; structural genomics, P 98.36
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.36
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.36
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.34
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.34
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 98.33
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.33
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.33
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.33
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.33
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.32
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.31
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.3
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.3
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.3
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.29
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.28
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.28
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.28
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.26
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.26
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.25
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.25
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.25
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.23
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.23
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.23
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.21
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.21
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.21
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.2
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.18
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.18
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.18
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.17
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.17
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.16
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.15
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.15
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 98.15
3ocj_A305 Putative exported protein; structural genomics, PS 98.13
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.13
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.13
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.12
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.12
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.11
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.11
3lkd_A542 Type I restriction-modification system methyltrans 98.11
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.1
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.1
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.09
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.09
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.08
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.08
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.08
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.08
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.06
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.06
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.06
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.06
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.05
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.03
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.03
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.03
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.03
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.02
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.01
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.01
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.01
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.0
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.0
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.99
2b25_A336 Hypothetical protein; structural genomics, methyl 97.99
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.99
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 97.99
1xxl_A239 YCGJ protein; structural genomics, protein structu 97.99
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.99
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 97.99
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 97.98
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 97.98
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 97.97
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.97
2avd_A229 Catechol-O-methyltransferase; structural genomics, 97.97
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 97.96
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.96
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.96
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.95
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.95
1yb2_A275 Hypothetical protein TA0852; structural genomics, 97.95
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 97.95
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 97.94
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.93
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 97.93
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.92
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.92
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 97.91
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 97.91
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 97.91
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 97.9
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 97.9
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.9
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.9
3lcc_A235 Putative methyl chloride transferase; halide methy 97.9
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 97.88
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 97.88
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 97.88
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 97.88
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 97.88
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 97.87
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.87
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.87
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 97.86
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 97.85
3khk_A544 Type I restriction-modification system methylation 97.85
3dtn_A234 Putative methyltransferase MM_2633; structural gen 97.84
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 97.84
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 97.84
2p7i_A250 Hypothetical protein; putative methyltransferase, 97.84
2kw5_A202 SLR1183 protein; structural genomics, northeast st 97.83
3s1s_A878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 97.82
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.82
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 97.82
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.81
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.8
2h00_A254 Methyltransferase 10 domain containing protein; st 97.8
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 97.8
2i62_A265 Nicotinamide N-methyltransferase; structural genom 97.8
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 97.8
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.78
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 97.77
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 97.77
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 97.77
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 97.76
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 97.76
3gu3_A284 Methyltransferase; alpha-beta protein, structural 97.76
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 97.76
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 97.75
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.75
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 97.75
1xj5_A334 Spermidine synthase 1; structural genomics, protei 97.75
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.75
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 97.74
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 97.74
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 97.73
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 97.73
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.72
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.72
2o07_A304 Spermidine synthase; structural genomics, structur 97.71
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 97.71
3gjy_A317 Spermidine synthase; APC62791, structural genomics 97.7
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 97.69
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 97.69
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 97.67
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 97.67
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 97.67
3hnr_A220 Probable methyltransferase BT9727_4108; structural 97.67
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 97.66
2pt6_A321 Spermidine synthase; transferase, structural genom 97.65
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 97.65
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 97.65
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 97.65
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.64
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 97.63
4hg2_A257 Methyltransferase type 11; structural genomics, PS 97.62
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.62
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 97.62
2zig_A297 TTHA0409, putative modification methylase; methylt 97.61
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.6
2i7c_A283 Spermidine synthase; transferase, structural genom 97.59
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 97.58
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 97.58
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 97.57
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.57
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 97.56
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 97.55
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 97.54
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 97.54
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.53
3m33_A226 Uncharacterized protein; structural genomics, PSI- 97.52
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 97.51
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 97.51
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 97.51
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.51
3i9f_A170 Putative type 11 methyltransferase; structural gen 97.5
3fut_A271 Dimethyladenosine transferase; methyltransferase, 97.5
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 97.5
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 97.5
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.49
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 97.48
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 97.48
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 97.47
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.47
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 97.47
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 97.46
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 97.45
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 97.44
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 97.44
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 97.43
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.43
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.42
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 97.41
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.41
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 97.4
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.38
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 97.35
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.35
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.34
1ne2_A200 Hypothetical protein TA1320; structural genomics, 97.32
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 97.31
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7.3e-53  Score=452.95  Aligned_cols=265  Identities=18%  Similarity=0.202  Sum_probs=220.6

Q ss_pred             HhhcCChhHHHHHHHHHHHHhcCCCCCcEEEecCC-chHHHHHHHcCCCceEEEcCCCcChhHHHHHHHHhccCCccccc
Q 044245          381 IAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDS-VFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDR  459 (694)
Q Consensus       381 i~ml~D~~r~~~y~~Ai~~~~~~~~~~~vldig~G-giLsl~aA~~g~a~~V~ave~~~~~~~~~~~~~i~~~N~l~~~~  459 (694)
                      ..||||.+||++|++||.+|...++|++||||||| |||||||||+| |++|||||.  ++++ ..|+++++.||++ ++
T Consensus        59 ~~ML~D~~Rt~aY~~Ai~~~~~~~~~k~VLDvG~GtGiLs~~Aa~aG-A~~V~ave~--s~~~-~~a~~~~~~n~~~-~~  133 (376)
T 4hc4_A           59 EEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAG-ARRVYAVEA--SAIW-QQAREVVRFNGLE-DR  133 (376)
T ss_dssp             HHHHHCHHHHHHHHHHHHTTHHHHTTCEEEEETCTTSHHHHHHHHTT-CSEEEEEEC--STTH-HHHHHHHHHTTCT-TT
T ss_pred             HHHhCCHHHHHHHHHHHHhCHHhcCCCEEEEeCCCccHHHHHHHHhC-CCEEEEEeC--hHHH-HHHHHHHHHcCCC-ce
Confidence            57999999999999999999988999999999999 99999999997 999999999  6765 5789999999998 99


Q ss_pred             EEEeecccccccccccCCccccEEEccc--cccCCccccCcchhhHHHHHhhcccccCCCceEEcceEEEEEEEccChhh
Q 044245          460 VEILQKGKKCLTMDDTQQKKVDLLIGEP--YYFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDI  537 (694)
Q Consensus       460 i~vi~~~~~~~~~~~l~~~~vDvivsE~--~~~~~e~~l~w~~l~f~~~r~~~~~~L~p~g~i~P~~a~l~~~~v~~~~l  537 (694)
                      |++|++++++++.    ++++|+|||||  +++.+|+||+ +.+   ++|++   ||+|||+|+|+++++|++||+++.+
T Consensus       134 i~~i~~~~~~~~l----pe~~DvivsE~~~~~l~~e~~l~-~~l---~a~~r---~Lkp~G~~iP~~atly~apie~~~l  202 (376)
T 4hc4_A          134 VHVLPGPVETVEL----PEQVDAIVSEWMGYGLLHESMLS-SVL---HARTK---WLKEGGLLLPASAELFIVPISDQML  202 (376)
T ss_dssp             EEEEESCTTTCCC----SSCEEEEECCCCBTTBTTTCSHH-HHH---HHHHH---HEEEEEEEESCEEEEEEEEECCHHH
T ss_pred             EEEEeeeeeeecC----CccccEEEeecccccccccchhh-hHH---HHHHh---hCCCCceECCccceEEEEEeccchh
Confidence            9999999988864    58999999997  4667788988 555   66665   7999999999999999999999877


Q ss_pred             hhhcCCCCcc---cccccccchhhhhhcCCCCCCCCCCCCCccccccccccccCCceeEEEEeCCCCC-C-----Cccee
Q 044245          538 WNSRRSLSKI---EGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPI-S-----PCQGK  608 (694)
Q Consensus       538 ~~~~~~~~~v---~G~d~s~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~ls~~~~l~~~d~~~~~-~-----~~~~~  608 (694)
                      +.....|.++   |||||++++...........+      |+... ..+.++||+|+.+++|||++.. +     .+..+
T Consensus       203 ~~~i~~w~~v~~~yGfd~s~~~~~~~~~~~~~~e------~~v~~-~~~~~~Ls~p~~i~~~D~~~~~~~~~~~~~~~~~  275 (376)
T 4hc4_A          203 EWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSE------IVVQG-LSGEDVLARPQRFAQLELSRAGLEQELEAGVGGR  275 (376)
T ss_dssp             HHHHHGGGGHHHHHSCCCGGGHHHHHHHHHSSCE------EEEEC-CCGGGBCSCCEEEEEEETTCTTHHHHHHHCEEEE
T ss_pred             hhhhcchhccccccCcCchhhhhhhhhhhcccCc------eEEEe-ecccccccCCEEEEEEECCCCCccccccccceeE
Confidence            5433446665   999999998864322100000      11111 1235789999999999999875 1     34566


Q ss_pred             EEEEecCCeeeeEEEEEEEEEecCC---CcEEEecCCC--CCceeeeEEecCcceeccccCCCCC
Q 044245          609 VQVEFTEPGLCHGFALWIDWVLDSE---NSIVISTGPD--KRYWKQGVKLMAKPVAVGFEESGRT  668 (694)
Q Consensus       609 ~~~~~~~~g~~~g~~~Wfd~~~~~~---~~~~lst~P~--~~hW~Q~v~~l~~p~~v~~g~~~~~  668 (694)
                      ++++++++|++|||++|||+.|+++   ..+.|||+|.  .|||+|++|+|++|+.|++|+.+.|
T Consensus       276 f~~~~~~~g~vhg~~~WFd~~f~~~~~~~~v~lST~P~~~~THW~Q~v~~L~~Pi~V~~G~~I~g  340 (376)
T 4hc4_A          276 FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSG  340 (376)
T ss_dssp             EEEECCSSEEEEEEEEEEEEEECCCC--CCEEEECCTTSCCCTTCEEEEEEEEEEEECTTCEEEE
T ss_pred             EEEEecCCcEEEEEEEEEEEEecCCCCCCceEEeCCCCcCCCceeeEEEEeCCceEeCCCCEEEE
Confidence            7888999999999999999999754   3489999997  5799999999999999999998776
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 694
d1oria_316 c.66.1.6 (A:) Protein arginine N-methyltransferase 2e-39
d1oria_316 c.66.1.6 (A:) Protein arginine N-methyltransferase 2e-14
d1g6q1_328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 7e-36
d1g6q1_328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 4e-11
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 4e-31
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 6e-08
d2frna1260 c.66.1.47 (A:19-278) Hypothetical protein PH0793 { 5e-04
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Arginine methyltransferase
domain: Protein arginine N-methyltransferase 1, PRMT1
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  145 bits (366), Expect = 2e-39
 Identities = 69/304 (22%), Positives = 125/304 (41%), Gaps = 37/304 (12%)

Query: 43  YLDMLNDSYRNRAYRLAIDKM--VTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTK 100
           + +ML D  R   YR ++     + K   VLD+G+GTG+L M AA+A             
Sbjct: 8   HEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARK--------- 58

Query: 101 GMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDELEVGVDIDSRADILVSEILDSE 160
             V   E    +     K++  N +   + +I  + +E+E       + DI++SE +   
Sbjct: 59  --VIGIECS-SISDYAVKIVKANKLDHVVTIIKGKVEEVE---LPVEKVDIIISEWMGYC 112

Query: 161 LLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEAKALDDIHL 220
           L  E ++ T+ HA D+ L  + L  P R T Y   +E          +       D    
Sbjct: 113 LFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFD---- 168

Query: 221 VPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFW--KRPDSHGEAELQIKST 278
               M  I  V  ++  +         +L++    I E D +  K  D    +   ++  
Sbjct: 169 ----MSCIKDVAIKEPLVDV---VDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVK 221

Query: 279 DDGRVHAVVSWWVLQLDR-EGTIFYSTAPRWISTGNWCDHWKQCVWFIPGKGMSICKGEE 337
            +  VHA+V+++ ++  R      +ST+P      +   HWKQ V+++    +++  GEE
Sbjct: 222 RNDYVHALVAYFNIEFTRCHKRTGFSTSP-----ESPYTHWKQTVFYME-DYLTVKTGEE 275

Query: 338 LLFH 341
           +   
Sbjct: 276 IFGT 279
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query694
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 100.0
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 100.0
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 100.0
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 100.0
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 100.0
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 100.0
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.47
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.45
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.45
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.45
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.44
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.43
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.43
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.42
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.41
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.4
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.4
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.37
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.36
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.36
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.35
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.33
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.31
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.3
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.24
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.24
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.23
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.22
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.21
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.2
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.19
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.19
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.19
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.19
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.18
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.16
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.16
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.15
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.13
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.12
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.11
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.1
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.1
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.08
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.08
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.06
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.06
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.04
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.04
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.04
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.04
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.01
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.01
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.99
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.98
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.97
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.97
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.96
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.95
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.95
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.95
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.94
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.94
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.93
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.91
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 98.89
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.85
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.81
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.78
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.78
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.74
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.73
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.73
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.69
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.68
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.67
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.65
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.55
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.55
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.52
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.51
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.46
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.46
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.45
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.44
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.41
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.41
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.39
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.39
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.36
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.34
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 98.34
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.31
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.3
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.3
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.29
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.27
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.25
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.23
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 98.22
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.22
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.21
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.2
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.2
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.19
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.19
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.17
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.15
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.14
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.14
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.13
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.13
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.11
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.11
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.09
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.07
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.05
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.03
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.03
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.03
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.02
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.01
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.01
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.01
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.99
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.99
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.99
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 97.98
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 97.98
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 97.93
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.92
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.92
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.91
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 97.91
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.89
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.88
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.8
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 97.76
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.76
d2h00a1250 Methyltransferase 10 domain containing protein MET 97.71
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.7
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.7
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.69
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.68
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.6
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.58
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.53
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 97.45
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.44
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 97.41
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.39
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.37
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 97.36
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 97.35
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.32
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.28
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.24
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 97.24
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.22
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.21
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.19
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.12
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 97.12
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.08
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.06
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.06
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 97.03
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 96.94
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 96.8
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 96.62
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 96.61
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 96.57
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 96.49
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 96.28
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.14
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 95.98
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.9
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.82
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 95.79
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 95.75
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 95.75
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 95.72
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 95.68
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.67
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.64
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 95.42
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 95.38
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.3
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.27
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.19
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 95.19
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 95.17
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 95.06
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.04
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 95.03
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.02
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.91
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 94.74
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.74
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 94.68
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 94.36
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.25
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 94.24
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 94.17
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 94.07
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.75
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.33
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.04
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 92.98
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 92.85
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.44
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.2
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.8
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.61
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.46
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 91.36
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.34
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 91.27
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.13
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 91.12
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 90.94
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 90.91
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 90.59
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 90.38
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.88
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 89.63
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 89.54
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 88.86
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 88.77
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 88.74
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 88.66
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 88.66
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 88.44
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 88.12
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 87.83
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 87.75
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 87.51
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 87.15
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 86.44
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 86.42
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 85.37
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 85.26
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 84.82
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 84.74
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 84.7
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 84.31
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 84.2
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 83.74
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 83.16
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 83.1
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 82.98
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 82.45
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 81.54
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 81.34
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 81.02
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 80.37
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 80.2
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Arginine methyltransferase
domain: Protein arginine N-methyltransferase 1, PRMT1
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=2.7e-46  Score=394.50  Aligned_cols=260  Identities=17%  Similarity=0.178  Sum_probs=217.4

Q ss_pred             HhhcCChhHHHHHHHHHHHHhcCCCCCcEEEecCC-chHHHHHHHcCCCceEEEcCCCcChhHHHHHHHHhccCCccccc
Q 044245          381 IAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDS-VFLTICVARLSKTAHVLSLLPGLGDKGAQYLRTVADPNCFSIDR  459 (694)
Q Consensus       381 i~ml~D~~r~~~y~~Ai~~~~~~~~~~~vldig~G-giLsl~aA~~g~a~~V~ave~~~~~~~~~~~~~i~~~N~l~~~~  459 (694)
                      ..||||..|+++|++||.++...++|++||||||| |+||++|||+| |++|+++|.  ++++ ..++++++.||+. ++
T Consensus         9 ~~Ml~D~~R~~~y~~ai~~~~~~~~~~~VLDiGcG~G~ls~~aa~~G-a~~V~avd~--s~~~-~~a~~~~~~n~~~-~~   83 (316)
T d1oria_           9 EEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAG-ARKVIGIEC--SSIS-DYAVKIVKANKLD-HV   83 (316)
T ss_dssp             HHHHHCHHHHHHHHHHHHTCHHHHTTCEEEEETCTTSHHHHHHHHTT-CSEEEEEEC--STTH-HHHHHHHHHTTCT-TT
T ss_pred             HHHhCCHHHHHHHHHHHHhccccCCcCEEEEEecCCcHHHHHHHHhC-CCEEEEEcC--cHHH-hhhhhHHHHhCCc-cc
Confidence            47999999999999999998877899999999999 99999999996 999999999  6665 4567889999998 99


Q ss_pred             EEEeecccccccccccCCccccEEEcccc--ccCCccccCcchhhHHHHHhhcccccCCCceEEcceEEEEEEEccChhh
Q 044245          460 VEILQKGKKCLTMDDTQQKKVDLLIGEPY--YFGNDGMLPWQNLRFWKERSKLDPVLSKEVIIMPFKGILKACAIFCPDI  537 (694)
Q Consensus       460 i~vi~~~~~~~~~~~l~~~~vDvivsE~~--~~~~e~~l~w~~l~f~~~r~~~~~~L~p~g~i~P~~a~l~~~~v~~~~l  537 (694)
                      |+++++.+++++.   +.+++|+|++|++  ++..|++++ ..+   .++   +++|+|||+|+|+++++|++||++..+
T Consensus        84 v~~~~~~~~~~~~---~~~~~D~ivs~~~~~~l~~e~~~~-~~l---~~~---~r~Lkp~G~iiP~~~~~~~~~v~~~~~  153 (316)
T d1oria_          84 VTIIKGKVEEVEL---PVEKVDIIISEWMGYCLFYESMLN-TVL---HAR---DKWLAPDGLIFPDRATLYVTAIEDRQY  153 (316)
T ss_dssp             EEEEESCTTTCCC---SSSCEEEEEECCCBBTBTBTCCHH-HHH---HHH---HHHEEEEEEEESCEEEEEEEEECCHHH
T ss_pred             cceEeccHHHccc---ccceeEEEeeeeeeeeeccHHHHH-HHH---HHH---HhcCCCCeEEEeeeEEEEEEEecCHHH
Confidence            9999999888764   3578999999974  334455555 333   444   447999999999999999999999999


Q ss_pred             hhhcCC-CCcccccccccchhhhhhcCCCCCCCCCCCCCccccccccccccCCceeEEEEeCCCCC-C--CcceeEEEEe
Q 044245          538 WNSRRS-LSKIEGFDHAVVNTSLGACGDLPAPKDGPCLPFFTWQCGEIKKLSNVFTVMEFDFSKPI-S--PCQGKVQVEF  613 (694)
Q Consensus       538 ~~~~~~-~~~v~G~d~s~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~ls~~~~l~~~d~~~~~-~--~~~~~~~~~~  613 (694)
                      |..+.. |++++||||++++......            |+..+. .+.+++|+|+.++++||.+.. +  .....+++++
T Consensus       154 ~~~~~~~~~~~~g~d~~~~~~~~~~~------------~~v~~~-~~~~~ls~p~~~~~~d~~~~~~~~l~~~~~~~~~~  220 (316)
T d1oria_         154 KDYKIHWWENVYGFDMSCIKDVAIKE------------PLVDVV-DPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQV  220 (316)
T ss_dssp             HHHHTTTTTCBTTBCCHHHHHHHHTS------------CEEECC-CGGGEEEEEEEEEEEETTTCCGGGGSEEEEEEEEB
T ss_pred             Hhhhcccccccccccchhhhhhhccc------------cEEEEe-cCceEeeCCEEeEEEcCCCCcccCccEEEEEEEee
Confidence            999876 6899999999999865321            111111 135789999999999999865 3  3456788899


Q ss_pred             cCCeeeeEEEEEEEEEecCC-CcEEEecCCC--CCceeeeEEecCcceeccccCCCCC
Q 044245          614 TEPGLCHGFALWIDWVLDSE-NSIVISTGPD--KRYWKQGVKLMAKPVAVGFEESGRT  668 (694)
Q Consensus       614 ~~~g~~~g~~~Wfd~~~~~~-~~~~lst~P~--~~hW~Q~v~~l~~p~~v~~g~~~~~  668 (694)
                      +++|+||||++|||+.|++. +.+.+||+|.  .+||+|++|+|++|+.|++||.+.|
T Consensus       221 ~~~g~~hg~~~wFd~~l~~~~~~v~lST~P~~~~thW~Q~v~~l~~p~~v~~g~~i~~  278 (316)
T d1oria_         221 KRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFG  278 (316)
T ss_dssp             CSSEEEEEEEEEEEEECTTSSSCCEEECSTTSCCCTTCEEEEEEEEEEEECTTCEEEE
T ss_pred             cCCceEEEEEEEEEEEeeCCCCCeEEECCCCcCCCceecEEEEcCCceEcCCCCEEEE
Confidence            99999999999999999864 3578999997  4799999999999999999997765
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure