Citrus Sinensis ID: 044302

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830

MSILQISFDGLQDSEKKIFLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDDCNTLGMHDLLQELGQLIVTRQSLEEPGKRSRLWRQEEVRHVLTKNAGSEVVEGMIIDDHFFPENEMHLSAKAFSLMTNLRLLKIGNVQLPKGLEYLSNKLRLLVWHQYPLKSLPSNLQLDKIVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENLIKTPNFIEVPNLEVLDLEGCTRLREIHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLKTLVLSGCLKLRKFPHVGGSMECLQELFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSSLPVTISSLKCLRTLKLSGCSKLKKFPQIVGMEGLSELYLDGTSITEVPSSIELLPGIELLNLNDCKNLVRLPRSINGLKALKTLSLSGCCKLENVPDTLGQVESLEELDISGTATRRPPCSIFHMKNLKTLSFSGCNGPPSTASSLMLPSLSGLCSLTKLDLSDCGLGEGAILSDIGNLHSLKALYLSENNFVTLPASISGLFNLEYLKLEDCKRLQSLPQLPPNVHNVRLNGCASLVTLLGVLRLRKSSWTTIYCIDSLKLLGKNDLATSMLREHLEAVSAPDSKLSIVVPGSEIPKWFMYQNEGSSITVTRPSYLHNVNKVVGYAVCCVFHVPKHSTGIRRTTWKGHSFLTHLLFCSMDCSSLFYGIDFRDKFGHRGSDHLWLLFLSRAECDEYKWHFESNHFKLKFANHSAVSNTGLKVKRCGFHPVYKQEVEEFDETTKQWTHFTSYNLNEFHHDFVGSNMEVATTSKRSLAENAGAAEASGSGCCDDD

ccEEEEEccccccccccEEEEEEEccccccHHHHHHHHHHccccccccHHHHccccEEEEcccccEEccHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccccEEEEEEEccccccccEEEcHHHHcccccccEEEEccEEcccccccccccccEEEEccccccccccccccccEEEEEccccccHHccccccccccccEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEEcccccccccccccccccccccccccEEcccccccccccccccccccccccEEEcccccEEEccccccccccccEEEccccccccccccccccccEEEEccccccEEEccccccccccccEEEccccHHcccccHHHHHHHHHHHHHcccccccEEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEEEcccccccccccccccccccccEEEEcccccccccccccccccccccccEEEEEEcccccHHHHcccccccEEEEEEEEEEcccccccEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccEEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHcEEEEEcccccEEHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccEEEEEEEEccccccccccccHHHHHHHHccEEEEEEccccccccccccHHcEEEEEcccccccccccccHHHEEEEEcccccHHHcccccccHHccEEEEccccccccccccccccccccEEEcccccccEEccccHHHHHHcEEEEccccccHccccccccccccEEEEccccccHHHccHHccccHcccEEEccccccHcccccHccccccEEEEccccccHccccccccccHcccEEEccccccccccccccccccccEEEccccccEcccccHHHHHcccEEEcccccccccccccHcccccccEEEccccHHHHHccHHcccccHccEEEccccccEcccccHHHHHcccEEEccccccccccccccccccHcccccccEEEccccccccccccccHcccccccEEEccccccccccHHHHHHHHccEEccccccHHcccccccccccEEEcccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccEEEEccccccHHHcccccccEEEEEccccccccccccEEEEEEEEEcccccccccccccEEEEEcccccEEccccccEEcccccccccccccccEEEEEEcccccccHHHccccccEEEEEEEEccccccccEEEEEcEEEEEEEccccccccccccccccccccccccccccccccccHcccccEEEccccccccccccEEcccc

MSILQisfdglqdsEKKIFLDVACFFKQKNRDYVTKILEgygffpviGIEVLIERSlltvddcntLGMHDLLQELGQLIVTRqsleepgkrsrlwRQEEVRHVLTknagsevvegmiiddhffpenemhLSAKAFSLMTNLRLLKIgnvqlpkglEYLSNKLRLLVWhqyplkslpsnlqldkIVEFEMCYSRIEELWkgikplntLKVMKLshsenliktpnfievpnlevldlegcTRLREIHSSLVRHNKLILLNlkgctslttlpgeiFMKSLKTLVLSGClklrkfphvggsmeclqelfldetdikemplsIEHLSGLILLTLKYcknlsslpvtiSSLKCLrtlklsgcsklkkfpqivgmeglselyldgtsitevpssiellpgiellnlndcknlvrlprsinglKALKTLslsgccklenvpdtlgqvesleeldisgtatrrppcsifhmknlktlsfsgcngppstasslmlpslsglcsltkldlsdcglgegailsdIGNLHSLKALYlsennfvtlpasisglfnleylkledckrlqslpqlppnvhnvrlnGCASLVTLLGVLRLrksswttiycidslkllgkndLATSMLREHLeavsapdsklsivvpgseipkwfmyqnegssitvtrpsylhnvnKVVGYAVCCVfhvpkhstgirrttwkgHSFLTHLLFCSmdcsslfygidfrdkfghrgsDHLWLLFLSRAEcdeykwhfesnhfklkfanhsavsntglkvkrcgfhpvYKQEVEEFDETTKQWTHFTSYNLNEFHHDFVGSNMEVATTSKRSLaenagaaeasgsgccddd

msilqisfdglqdsEKKIFLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDDCNTLGMHDLLQELGQLIVTRqsleepgkrsrlwrqeevrhvltknagsevveGMIIDDHFFPENEMHLSAKAFSLMTNLRLLKIGNVQLPKGLEYLSNKLRLLVWHQYPLkslpsnlqldKIVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENliktpnfievpnLEVLDLEGCTRLREIHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLKTLVLSGCLKLRKFPHVGGSMECLQELFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSSLPVTISSLKCLRTlklsgcsklkkfpqivGMEGLSELYLDGTSITEVPSSIELLPGIELLNLNDCKNLVRLPRSINGLKALKTLSLSGCCKLenvpdtlgqveSLEELDISGTATRRPPCSIFHMKNLKTLSFSGCNGPPSTASSLMLPSLSGLCSLTKLDLSDCGLGEGAILSDIGNLHSLKALYLSENNFVTLPASISGLFNLEYLKLEDCKRLQSLPQLPPNVHNVRLNGCASLVTLLGVLRLRKSSWTTIYCIDSLKLLGKNDLATSMLREHLeavsapdsklsIVVPGSEIPKWFMYQNEGSSITVTRPSYLHNVNKVVGYAVCCVFHVPkhstgirrttwKGHSFLTHLLFCSMDCSSLFYGIDFRDKFGHRGSDHLWLLFLSRAECDEYKWHFESNHFKLKFANHSAVSNTGLKVKRCGFHPVYKQEVEEFDETTKQWTHFTSYNLNEFHHDFVGSNMEVATTSKRSLaenagaaeasgsgccddd

*******FDGLQDSEKKIFLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDDCNTLGMHDLLQELGQLIVTRQ**********LWRQEEVRHVLTKNAGSEVVEGMIIDDHFFPENEMHLSAKAFSLMTNLRLLKIGNVQLPKGLEYLSNKLRLLVWHQYPLKSLPSNLQLDKIVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENLIKTPNFIEVPNLEVLDLEGCTRLREIHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLKTLVLSGCLKLRKFPHVGGSMECLQELFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSSLPVTISSLKCLRTLKLSGCSKLKKFPQIVGMEGLSELYLDGTSITEVPSSIELLPGIELLNLNDCKNLVRLPRSINGLKALKTLSLSGCCKLENVPDTLGQVESLEELDISGTATRRPPCSIFHMKNLKTLSFSGC*********LMLPSLSGLCSLTKLDLSDCGLGEGAILSDIGNLHSLKALYLSENNFVTLPASISGLFNLEYLKLEDCKRLQSLPQLPPNVHNVRLNGCASLVTLLGVLRLRKSSWTTIYCIDSLKLLGKNDLATSMLREHLEAVSAPDSKLSIVVPGSEIPKWFMYQNEGSSITVTRPSYLHNVNKVVGYAVCCVFHVPKHSTGIRRTTWKGHSFLTHLLFCSMDCSSLFYGIDFRDKFGHRGSDHLWLLFLSRAECDEYKWHFESNHFKLKFANHSAVSNTGLKVKRCGFHPVYKQEVEEFDETTKQWTHFTSYNLNEFHHDFVGS******************************

MSILQISFDGLQDSEKKIFLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDDCNTLGMHDLLQELGQLIVTRQSLEEPGKRSRLWRQEEVRHVLTKNAGSEVVEGMIIDDHFFPENEMHLSAKAFSLMTNLRLLKIGNVQLPKGLEYLSNKLRLLVWHQYPLKSLPSNLQLDKIVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENLIKTPNFIEVPNLEVLDLEGCTRLREIHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLKTLVLSGCLKLRKFPHVGGSMECLQELFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSSLPVTISSLKCLRTLKLSGCSKLKKFPQIVGMEGLSELYLDGTSITEVPSSIELLPGIELLNLNDCKNLVRLPRSINGLKALKTLSLSGCCKLENVPDTLGQVESLEELDISGTATRRPPCSIFHMKNLKTLSFSGCNGPPSTASSLMLPSLSGLCSLTKLDLSDCGLGEGAILSDIGNLHSLKALYLSENNFVTLPASISGLFNLEYLKLEDCKRLQSLPQLPPNVHNVRLNGCASLVTLLGVLRLRKSSWTTIYCIDSLKLLGKNDLATSMLREHLEAVSAPDSKLSIVVPGSEIPKWFMYQNEGSSITVTRPSYLHNVNKVVGYAVCCVFHVPKHSTGIRRTTWKGHSFLTHLLFCSMDCSSLFYGIDFRDKFGHRGSDHLWLLFLSRAECDEYKWHFESNHFKLKFANHSAVSNTGLKVKRCGFHPVYKQE***********************************************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		830	2.2.26 [Sep-21-2011]
Q40392		1144	TMV resistance protein N	N/A	no	0.701	0.508	0.313	4e-78
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.477	0.208	0.397	2e-70
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.650	0.415	0.319	1e-59
Q9FH83		1288	Probable WRKY transcripti	no	no	0.512	0.329	0.365	1e-59
Q9FL92		1372	Probable WRKY transcripti	no	no	0.571	0.345	0.332	8e-58
O82500		1095	Putative disease resistan	no	no	0.468	0.355	0.315	2e-50
Q9FKN7		1613	Protein DA1-related 4 OS=	no	no	0.472	0.243	0.331	3e-46
Q9RBS2		1024	Protein PopC OS=Ralstonia	yes	no	0.461	0.374	0.305	9e-24
P0CB16		1201	Putative disease resistan	no	no	0.431	0.298	0.296	2e-20
Q9V780		849	Protein lap1 OS=Drosophil	yes	no	0.334	0.327	0.300	9e-14

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function desciption

 Score =  293 bits (750), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 211/672 (31%), Positives = 330/672 (49%), Gaps = 90/672 (13%)

Query: 4    LQISFDGLQDSEKKIFLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDDC 63
            L+IS+DGL+  ++++FLD+ACF + + +DY+ +ILE        G+ +LI++SL+ + + 
Sbjct: 423  LKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILIDKSLVFISEY 482

Query: 64   NTLGMHDLLQELGQLIVTRQSLEEPGKRSRLWRQEEVRHVLTKNAGSEVVEGMIIDDHFF 123
            N + MHDL+Q++G+ IV  Q  ++PG+RSRLW  +EV  V++ N G+  +E + +  +  
Sbjct: 483  NQVQMHDLIQDMGKYIVNFQ--KDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVSSY-- 538

Query: 124  PENEMHLSAKAFSLMTNLRLLKIGNVQLPKGLEYLSNKLRLLVWHQYPLKSLPSNLQLDK 183
              + +  S +A   M  LR+  +G       ++YL N LR  V   YP +S PS  +L  
Sbjct: 539  -SSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKM 597

Query: 184  IVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENLIKTPNFIEVPNLEVLDLEGCTRLRE 243
            +V  ++ ++ +  LW   K L                       P+L  +DL    RL  
Sbjct: 598  LVHLQLRHNSLRHLWTETKHL-----------------------PSLRRIDLSWSKRL-- 632

Query: 244  IHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLKTLVLSGCLKLRKFPHVGGSMECLQE 303
                                  T  P    M +L+ + L  C  L +  H   S+ C   
Sbjct: 633  ----------------------TRTPDFTGMPNLEYVNLYQCSNLEEVHH---SLGCC-- 665

Query: 304  LFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSSLPVTISSLKCLRTLKLSGCSKLKKFP 363
                              S +I L L  CK+L   P    +++ L  L L  C  L+K P
Sbjct: 666  ------------------SKVIGLYLNDCKSLKRFPCV--NVESLEYLGLRSCDSLEKLP 705

Query: 364  QIVG-MEGLSELYLDGTSITEVPSSI-ELLPGIELLNLNDCKNLVRLPRSINGLKALKTL 421
            +I G M+   ++++ G+ I E+PSSI +    +  L L + KNLV LP SI  LK+L +L
Sbjct: 706  EIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSL 765

Query: 422  SLSGCCKLENVPDTLGQVESLEELDISGTATRRPPCSIFHMKNLKTLSFSGCNGPPSTAS 481
            S+SGC KLE++P+ +G +++L   D S T   RPP SI  +  L  L F G         
Sbjct: 766  SVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFK---DGVH 822

Query: 482  SLMLPSLSGLCSLTKLDLSDCGLGEGAILSDIGNLHSLKALYLSENNFVTLPASISGLFN 541
                P   GL SL  L+LS C L +G +  +IG+L SLK L LS NNF  LP+SI+ L  
Sbjct: 823  FEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGA 882

Query: 542  LEYLKLEDCKRLQSLPQLPPNVHNVRLNGCASLVTLLGVLRLRKSSWTTIYCIDSLKLLG 601
            L+ L L+DC+RL  LP+LPP ++ + ++ C   +  +  L  ++     +   D+     
Sbjct: 883  LQSLDLKDCQRLTQLPELPPELNELHVD-CHMALKFIHYLVTKRKKLHRVKLDDAHNDTM 941

Query: 602  KNDLATSMLRE---HLEAVSAPDSKLSIVVPGS----EIPKWFMYQNEGSSITVTRPSYL 654
             N  A +M +        +SA DS    V  G     +IP WF +Q   SS++V  P   
Sbjct: 942  YNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSVNLPENW 1001

Query: 655  HNVNKVVGYAVC 666
            +  +K +G+AVC
Sbjct: 1002 YIPDKFLGFAVC 1013

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FH83\|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3	Back alignment and function description

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function description

>sp\|Q9FKN7\|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2	Back alignment and function description

>sp\|Q9RBS2\|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2	Back alignment and function description

>sp\|P0CB16\|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2	Back alignment and function description

>sp\|Q9V780\|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		830
359486075		1291	PREDICTED: TMV resistance protein N-like	0.895	0.575	0.414	1e-153
147770134		1414	hypothetical protein VITISV_040107 [Viti	0.895	0.525	0.410	1e-150
451798988		1219	TMV resistance protein N-like protein 6	0.797	0.543	0.440	1e-148
359486073		1296	PREDICTED: TMV resistance protein N-like	0.896	0.574	0.414	1e-148
451798990		1335	TMV resistance protein N-like protein 7	0.910	0.566	0.407	1e-148
359486071		1261	PREDICTED: TMV resistance protein N-like	0.919	0.605	0.405	1e-141
147789504		1297	hypothetical protein VITISV_006193 [Viti	0.925	0.592	0.383	1e-138
224127726		1203	tir-nbs-lrr resistance protein [Populus	0.873	0.602	0.381	1e-137
359493267		1417	PREDICTED: TMV resistance protein N-like	0.936	0.548	0.386	1e-136
359487015		1610	PREDICTED: TMV resistance protein N-like	0.927	0.478	0.379	1e-134

>gi\|359486075\|ref\|XP_002273047.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  549 bits (1414), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 342/825 (41%), Positives = 481/825 (58%), Gaps = 82/825 (9%)

Query: 3    ILQISFDGLQDSEKKIFLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDD 62
            +L+ISFDGL D++K IF D+ACFFK +++DYV K+L+   FFP IGI  LI++SL+T+  
Sbjct: 425  VLRISFDGLDDNQKDIFFDIACFFKGQDKDYVIKLLKSCDFFPEIGIRNLIDKSLVTIS- 483

Query: 63   CNTLGMHDLLQELGQLIVTRQSLEEPGKRSRLWRQEEVRHVLTKNAGSEVVEGMIIDDHF 122
             N L MHDL+QE+G  IV ++S+++PGKRSRLW  ++V  +LT N G+E VEGM+++   
Sbjct: 484  YNKLCMHDLIQEMGWEIVRQESMKDPGKRSRLWVNDDVIDMLTTNTGTEAVEGMVLN--L 541

Query: 123  FPENEMHLSAKAFSLMTNLRLLKIGNVQ------------------------LPKGLEYL 158
                E+H S   F+ M  LR+L+  + Q                        L    ++L
Sbjct: 542  STLKELHFSVNVFTKMNKLRVLRFYDAQIWGSSWIWRRNDRYKSPYTECKFHLSGDFKFL 601

Query: 159  SNKLRLLVWHQYPLKSLPSNLQLDKIVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENL 218
            SN LR L W  YPLKSLPSN   +K++E +MC+S++E+LW+G K    LK ++LSHS++L
Sbjct: 602  SNHLRSLYWDGYPLKSLPSNFHPEKLLELKMCFSQLEQLWEGNKSFQKLKFIELSHSQHL 661

Query: 219  IKTPNFIEVPNLEVLDLEGCTRLREIHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLK 278
            IK P+F   P L  + LEGCT L ++H S+    KLI LNL+GC +L +    I ++SL+
Sbjct: 662  IKAPDFSGAPKLRRIILEGCTSLVKVHPSIGALKKLIFLNLEGCKNLKSFLSSIHLESLQ 721

Query: 279  TLVLSGCLKLRKFPHVGGSMECLQELFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSSL 338
             L LSGC KL+K P V G+M+ L EL L  T IK +PLSIE+L+GL L  L+ CK+L SL
Sbjct: 722  ILTLSGCSKLKKLPEVQGAMDNLSELSLKGTAIKGLPLSIEYLNGLALFNLEECKSLESL 781

Query: 339  PVTISSLKCLRTLKLSGCSKLKKFPQIV-GMEGLSELYLDGTSITEVPSSIELLPGIELL 397
            P  I  LK L+TL LS C +LKK P+I   ME L EL+LD T + E+PSSIE L G+ LL
Sbjct: 782  PGCIFKLKSLKTLILSNCLRLKKLPEIQENMESLKELFLDDTGLRELPSSIEHLNGLVLL 841

Query: 398  NLNDCKNLVRLPRSINGLKALKTLSLSGCCKLENVPDTLGQVESLEELDISGTATRRPPC 457
             L +CK L  LP SI  L +L+TL+LSGC +L+ +PD +G ++ L +L  +G+  +  P 
Sbjct: 842  KLKNCKRLASLPESICKLTSLQTLTLSGCSELKKLPDDMGSLQCLLKLKANGSGIQEVPS 901

Query: 458  SIFHMKNLKTLSFSGCNGPPSTASSLM------------LPSLSGLCSLTKLDLSDCGLG 505
            SI  +  L+ LS +GC G  S + +L             L SL+ L SL KL+LSD  L 
Sbjct: 902  SITLLTRLQVLSLAGCKGGGSKSRNLALSLRASPTDGLRLSSLTVLHSLKKLNLSDRNLL 961

Query: 506  EGAILSDIGNLHSLKALYLSENNFVTLPASISGLFNLEYLKLEDCKRLQSLPQLPPNVHN 565
            EGA+ SD+ +L  L+ L LS NNF+T+P S+S L +L  L +E CK LQSLP+LP ++  
Sbjct: 962  EGALPSDLSSLSWLECLDLSRNNFITVPTSLSRLPHLRRLIVEHCKNLQSLPELPSSIKE 1021

Query: 566  VRLNGCASLVTL---LGVLRLRKSSWTTIYCIDSLKLLG--KNDLATSMLRE-----HLE 615
            +  N C SL T         LRK         +  +L+G  ++D   ++L+E      ++
Sbjct: 1022 LLANDCTSLETFSYPSSAYPLRKFGDFNFEFSNCFRLVGNEQSDTVEAILQEIRLVASIQ 1081

Query: 616  AVSAP--------DSKLSIVVPGSEIPKWFMYQNEGSSITVTRPSYLHNVNKVVGYAVCC 667
               AP        +S+   VVPGS IP+WF +Q+EG SITV  P   +N N  +G A C 
Sbjct: 1082 KSMAPSEHSARYGESRYDAVVPGSRIPEWFTHQSEGDSITVELPPGCYNTNS-IGLAACA 1140

Query: 668  VFHVPKHSTG-IRRTTWKGHSFLTHLLFCSMDCSSLFYGIDFRDKFGHRGSDHLWLLFLS 726
            VFH PK S G I R+            + S++ S  F  +D         +DH+W  +  
Sbjct: 1141 VFH-PKFSMGKIGRSA-----------YFSVNESGGF-SLDNTTSMHFSKADHIWFGYRL 1187

Query: 727  RAECDEYKWHFESNHFKLKFANHSAVSNTGLKVKRCGFHPVYKQE 771
             +  D        +H K+ FA        G  VK+CG   VY+Q+
Sbjct: 1188 ISGVD------LRDHLKVAFATSKV---PGEVVKKCGVRLVYEQD 1223

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|147770134\|emb\|CAN76615.1\| hypothetical protein VITISV_040107 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|451798988\|gb\|AGF69192.1\| TMV resistance protein N-like protein 6 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|359486073\|ref\|XP_002272820.2\| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera]	Back alignment and taxonomy information

>gi\|451798990\|gb\|AGF69193.1\| TMV resistance protein N-like protein 7 [Vitis labrusca]	Back alignment and taxonomy information

>gi\|359486071\|ref\|XP_002272667.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147789504\|emb\|CAN71924.1\| hypothetical protein VITISV_006193 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224127726\|ref\|XP_002329162.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870943\|gb\|EEF08074.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359493267\|ref\|XP_002271591.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487015\|ref\|XP_003633506.1\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		830
TAIR\|locus:2175991		1294	AT5G17680 [Arabidopsis thalian	0.528	0.339	0.355	5.8e-70
UNIPROTKB\|Q40392		1144	N "TMV resistance protein N" [	0.559	0.405	0.341	1.6e-69
TAIR\|locus:2053405		1215	AT2G14080 [Arabidopsis thalian	0.674	0.460	0.350	6.8e-69
TAIR\|locus:2118116		1895	WRKY19 [Arabidopsis thaliana (	0.477	0.208	0.397	1.2e-68
TAIR\|locus:2147992		1189	AT5G11250 [Arabidopsis thalian	0.668	0.466	0.349	1.7e-68
TAIR\|locus:2115870		1234	AT4G08450 [Arabidopsis thalian	0.583	0.392	0.345	1.5e-64
TAIR\|locus:2163426		1187	TAO1 "target of AVRB operation	0.621	0.434	0.325	6.5e-62
TAIR\|locus:2153363		1261	AT5G45200 [Arabidopsis thalian	0.526	0.346	0.343	5.8e-61
TAIR\|locus:2170333		1197	CSA1 "constitutive shade-avoid	0.580	0.402	0.333	1e-60
TAIR\|locus:2129236		1301	SNC1 "SUPPRESSOR OF NPR1-1, CO	0.655	0.418	0.326	2.2e-60

TAIR\|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 718 (257.8 bits), Expect = 5.8e-70, P = 5.8e-70
 Identities = 163/459 (35%), Positives = 268/459 (58%)

Query:     1 MSILQISFDGLQDSEKKIFLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTV 60
             M +L++S+DGL + EK IFL ++CF+  K  DYV K+L+  G+   IGI +L E+SL+ V
Sbjct:   416 MEVLRVSYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILTEKSLI-V 474

Query:    61 DDCNTLGMHDLLQELGQLIVTRQSLEEPGKRSRLWRQEEVRHVLTKNAGSEVVEGMIIDD 120
             +    + +HDLL+++G+ +V +Q++  P +R  LW  E++ H+L++N+G+++VEG+ ++ 
Sbjct:   475 ESNGCVKIHDLLEQMGRELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLVEGISLN- 533

Query:   121 HFFPENEMHLSAKAFSLMTNLRLLKI------GN--VQLPKGLEYLSNKLRLLVWHQYPL 172
                  +E+  S +AF  ++NL+LL        G   V LP GL YL  KLR L W  YPL
Sbjct:   534 -LSEISEVFASDRAFEGLSNLKLLNFYDLSFDGETRVHLPNGLSYLPRKLRYLRWDGYPL 592

Query:   173 KSLPSNLQLDKIVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENLIKTPNFIEVPNLEV 232
             K++PS    + +VE  M  S +E+LW GI+PL  LK M LS  + L++ P+  +  NLE 
Sbjct:   593 KTMPSRFFPEFLVELCMSNSNLEKLWDGIQPLRNLKKMDLSRCKYLVEVPDLSKATNLEE 652

Query:   233 LDLEGCTRLREIHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLKTLVLSGCLKLRKFP 292
             L+L  C  L E+  S+     L    L  C  L  +P  I +KSL+T+ +SGC  L+ FP
Sbjct:   653 LNLSYCQSLVEVTPSIKNLKGLSCFYLTNCIQLKDIPIGIILKSLETVGMSGCSSLKHFP 712

Query:   293 HVGGSMECLQELFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSSLPVTISSLKCLRTLK 352
              +  +    + L+L  T I+E+P SI  LS L+ L +  C+ L +LP  +  L  L++L 
Sbjct:   713 EISWNT---RRLYLSSTKIEELPSSISRLSCLVKLDMSDCQRLRTLPSYLGHLVSLKSLN 769

Query:   353 LSGCSKLKKFPQIV-GMEGLSELYLDGT-SITEVPSSIELLPGIELLNLNDCKNLVRLPR 410
             L GC +L+  P  +  +  L  L + G  ++ E P    +   IE+L +++  ++  +P 
Sbjct:   770 LDGCRRLENLPDTLQNLTSLETLEVSGCLNVNEFP---RVSTSIEVLRISET-SIEEIPA 825

Query:   411 SINGLKALKTLSLSGCCKLENVPDTLGQVESLEELDISG 449
              I  L  L++L +S   +L ++P ++ ++ SLE+L +SG
Sbjct:   826 RICNLSQLRSLDISENKRLASLPVSISELRSLEKLKLSG 864

GO:0005622 "intracellular" evidence=IEA

GO:0006952 "defense response" evidence=IEA;ISS

GO:0007165 "signal transduction" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

UNIPROTKB\|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)]	Back alignment and assigned GO terms

TAIR\|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		830
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-76
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-15
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	3e-09
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-08
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	8e-08
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	4e-06
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	6e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.001
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.003
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.004

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  269 bits (688), Expect = 3e-76
 Identities = 187/554 (33%), Positives = 288/554 (51%), Gaps = 49/554 (8%)

Query: 4   LQISFDGLQD-SEKKIFLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDD 62
           L++S+DGL +  +K IF  +AC F  +  + +  +L        IG++ L+++SL+ V +
Sbjct: 426 LRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVRE 485

Query: 63  CNTLGMHDLLQELGQLIVTRQSLEEPGKRSRLWRQEEVRHVLTKNAGSEVVEGMIIDDHF 122
            + + MH LLQE+G+ IV  QS  EPG+R  L   +++  VL  N G++ V G+ +D   
Sbjct: 486 -DIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLD--I 541

Query: 123 FPENEMHLSAKAFSLMTNLRLLKIGNVQ----------LPKGLEYLSNKLRLLVWHQYPL 172
              +E+H+   AF  M NL  LK    +          LP+G +YL  KLRLL W +YPL
Sbjct: 542 DEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPL 601

Query: 173 KSLPSNLQLDKIVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENLIKTPNFIEVPNLEV 232
           + +PSN + + +V+ +M  S++E+LW G+  L  L+ + L  S+NL + P+     NLE 
Sbjct: 602 RCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLET 661

Query: 233 LDLEGCTRLREIHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLKTLVLSGCLKLRKFP 292
           L L  C+ L E+ SS+   NKL  L++  C +L  LP  I +KSL  L LSGC +L+ FP
Sbjct: 662 LKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFP 721

Query: 293 HVGGSMECLQELFLDETDIKEMP--LSIEHLSGLILLTLKYCKNLSSLPVTISSLKCLRT 350
            +  +   +  L LDET I+E P  L +E+L  LIL  +K  K    L   +  L  L T
Sbjct: 722 DISTN---ISWLDLDETAIEEFPSNLRLENLDELILCEMKSEK----LWERVQPLTPLMT 774

Query: 351 LKLSGCSKLKKFPQIVGMEGLSELYL-DGTSITEVPSSIELLPGIELLNLNDCKNLVRLP 409
           + LS                L+ L+L D  S+ E+PSSI+ L  +E L + +C NL  LP
Sbjct: 775 M-LS--------------PSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLP 819

Query: 410 RSINGLKALKTLSLSGCCKLENVPDTLGQVESLEELDISGTATRRPPCSIFHMKNLKTLS 469
             IN L++L++L LSGC +L   PD      ++ +L++S T     P  I    NL  L 
Sbjct: 820 TGIN-LESLESLDLSGCSRLRTFPDI---STNISDLNLSRTGIEEVPWWIEKFSNLSFLD 875

Query: 470 FSGCNGPPSTASSLMLPSLSGLCSLTKLDLSDCGLGEGAILSDIGNLHSLKALYLSENNF 529
            +GCN     +      ++S L  L  +D SDCG    A  +   +  ++    +     
Sbjct: 876 MNGCNNLQRVS-----LNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLP 930

Query: 530 VTLPASISGLFNLE 543
            T+  +    FNL+
Sbjct: 931 STVCINFINCFNLD 944

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		830
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.97
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.97
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.97
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.96
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.95
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.95
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.94
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.93
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.92
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.91
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.78
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.74
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.72
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.68
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.68
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.67
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.54
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.51
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.51
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.4
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.19
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.01
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.99
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.89
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.86
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.84
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.84
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.81
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.77
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.72
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.71
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.7
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.66
KOG4341		483	consensus F-box protein containing LRR [General fu	98.46
PRK15386		426	type III secretion protein GogB; Provisional	98.45
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.4
PRK15386		426	type III secretion protein GogB; Provisional	98.36
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.31
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.29
PLN03150		623	hypothetical protein; Provisional	98.27
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.22
PLN03150		623	hypothetical protein; Provisional	98.14
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.11
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.11
KOG4341		483	consensus F-box protein containing LRR [General fu	98.1
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.05
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.99
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.92
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.83
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.69
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.51
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.47
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.3
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.27
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.2
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.1
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.1
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.91
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.83
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.67
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	96.57
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.47
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.52
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.51
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.19
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.08
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.52
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.2
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	93.79
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.37
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.14
KOG4308		478	consensus LRR-containing protein [Function unknown	88.98
PF07725		20	LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le	87.63
KOG0473		326	consensus Leucine-rich repeat protein [Function un	86.73
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	86.46
smart00370		26	LRR Leucine-rich repeats, outliers.	86.46
KOG4308		478	consensus LRR-containing protein [Function unknown	85.67
KOG0473		326	consensus Leucine-rich repeat protein [Function un	85.55
KOG3864		221	consensus Uncharacterized conserved protein [Funct	82.59

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=1.5e-68  Score=659.45  Aligned_cols=649  Identities=30%  Similarity=0.481  Sum_probs=463.4

Q ss_pred             Ccceecccccch-hhhhhhhhhcccCCCCChHHHHHHhhhcCCCccchhhhhccCcceEEeCCCceehhHHHHHHHHHHH
Q 044302            2 SILQISFDGLQD-SEKKIFLDVACFFKQKNRDYVTKILEGYGFFPVIGIEVLIERSLLTVDDCNTLGMHDLLQELGQLIV   80 (830)
Q Consensus         2 ~iL~lSYd~L~~-~~K~cFl~~a~fp~~~~~~~l~~~w~a~g~~~~~~~~~L~~~~li~~~~~~~v~mHDll~d~a~~i~   80 (830)
                      ++|++|||+|++ .+|.||+||||||++++++.+..++.++|+-++.+++.|++||||++. .++++||||+||||++|+
T Consensus       424 ~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~-~~~~~MHdLl~~~~r~i~  502 (1153)
T PLN03210        424 KTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVR-EDIVEMHSLLQEMGKEIV  502 (1153)
T ss_pred             HHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEc-CCeEEhhhHHHHHHHHHH
Confidence            589999999986 599999999999999999988888888888899999999999999998 689999999999999999


Q ss_pred             hhhccCCCCCceecccchhhHHHhhcCcCcccEEEEEeeccCCCccccccChHhhhCCCCCceEEEcCc----------c
Q 044302           81 TRQSLEEPGKRSRLWRQEEVRHVLTKNAGSEVVEGMIIDDHFFPENEMHLSAKAFSLMTNLRLLKIGNV----------Q  150 (830)
Q Consensus        81 ~~e~~~~~~~~~~l~~~~~i~~vl~~~~~~~~v~~i~l~~~~~~~~~~~~~~~~f~~l~~Lr~L~l~~~----------~  150 (830)
                      ++++ .+|++++++|+++|+++|+..++|++++++|+++.. +.. +..+...+|.+|++|+.|.+..+          +
T Consensus       503 ~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~-~~~-~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~  579 (1153)
T PLN03210        503 RAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDID-EID-ELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWH  579 (1153)
T ss_pred             Hhhc-CCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccC-ccc-eeeecHHHHhcCccccEEEEecccccccccceee
Confidence            9998 799999999999999999999999999999999998 775 78899999999999999999654          3


Q ss_pred             cCCCccccccCcceEEEecCCCCCCCCCCCCCCceEEEccCCChhhcccCCCCCCcccEEEccCCCCCCCCCCCCCCCce
Q 044302          151 LPKGLEYLSNKLRLLVWHQYPLKSLPSNLQLDKIVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENLIKTPNFIEVPNL  230 (830)
Q Consensus       151 l~~~~~~l~~~Lr~L~l~~~~l~~lp~~~~l~~L~~L~L~~n~i~~l~~~~~~l~~L~~L~L~~~~~~~~~~~~~~l~~L  230 (830)
                      +++++..+|.+||+|+|.+|+++.+|..+.+.+|++|+|++|.++.+|.++..+++|+.|+|+++..+..+|+++.+++|
T Consensus       580 lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~L  659 (1153)
T PLN03210        580 LPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNL  659 (1153)
T ss_pred             cCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcc
Confidence            67788899999999999999999999999999999999999999999999999999999999999888889999999999


Q ss_pred             eEEeeeCCcccccccccccCCCCccEEecCCCCCCccCCcccccCcccEEeccCcccccccCCCCCccccceEeeccccc
Q 044302          231 EVLDLEGCTRLREIHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLKTLVLSGCLKLRKFPHVGGSMECLQELFLDETD  310 (830)
Q Consensus       231 ~~L~L~~~~~l~~~~~~l~~l~~L~~L~L~~c~~l~~lp~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~L~~~~  310 (830)
                      ++|++++|..+..+|.+++++++|+.|++++|+.++.+|..+.+++|+.|++++|.....+|..   ..+|+.|++++|.
T Consensus       660 e~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~  736 (1153)
T PLN03210        660 ETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETA  736 (1153)
T ss_pred             cEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCc
Confidence            9999999999999999999999999999999999999999888999999999999888777754   4578889999999


Q ss_pred             ccccccchhcccCCcEEeccCCCCCCCCccccccCccCcEEeecCCCCCCcCCcccCCCCCcEEEecCCc-ccccCcccC
Q 044302          311 IKEMPLSIEHLSGLILLTLKYCKNLSSLPVTISSLKCLRTLKLSGCSKLKKFPQIVGMEGLSELYLDGTS-ITEVPSSIE  389 (830)
Q Consensus       311 i~~l~~~l~~l~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~~~l~~L~~L~L~~~~-i~~l~~~~~  389 (830)
                      +..+|..+ .+++|+.|.+.++.... ++..+..++.+               ....+++|+.|+|++|. +..+|.+++
T Consensus       737 i~~lP~~~-~l~~L~~L~l~~~~~~~-l~~~~~~l~~~---------------~~~~~~sL~~L~Ls~n~~l~~lP~si~  799 (1153)
T PLN03210        737 IEEFPSNL-RLENLDELILCEMKSEK-LWERVQPLTPL---------------MTMLSPSLTRLFLSDIPSLVELPSSIQ  799 (1153)
T ss_pred             cccccccc-cccccccccccccchhh-ccccccccchh---------------hhhccccchheeCCCCCCccccChhhh
Confidence            88888654 45666666665543211 00000000000               01113445555555543 335555566


Q ss_pred             CCCCccEEecCCccCcccccccccCCCCCCEEeccCCCCCCccCcccCCCCCccEEecCCCcccCCCcccccCCCCcEEE
Q 044302          390 LLPGIELLNLNDCKNLVRLPRSINGLKALKTLSLSGCCKLENVPDTLGQVESLEELDISGTATRRPPCSIFHMKNLKTLS  469 (830)
Q Consensus       390 ~l~~L~~L~L~~~~~l~~l~~~~~~l~~L~~L~L~~~~~l~~~~~~l~~l~~L~~L~L~~n~i~~l~~~l~~l~~L~~L~  469 (830)
                      ++++|+.|+|++|..++.+|..+ .+++|+.|++++|..+..+|..   .++|++|+|++|.+..+|.+           
T Consensus       800 ~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~---~~nL~~L~Ls~n~i~~iP~s-----------  864 (1153)
T PLN03210        800 NLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDI---STNISDLNLSRTGIEEVPWW-----------  864 (1153)
T ss_pred             CCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCcccccccc---ccccCEeECCCCCCccChHH-----------
Confidence            66666666666666555555544 4556666666666555544432   23444444444444444444           


Q ss_pred             cCCCCCCCCCCccccCCCCCCCCccCeecCCCCCCCCCccccccCCCCCCCEEeCCCC-CCcccCcccCCCCccCEeecc
Q 044302          470 FSGCNGPPSTASSLMLPSLSGLCSLTKLDLSDCGLGEGAILSDIGNLHSLKALYLSEN-NFVTLPASISGLFNLEYLKLE  548 (830)
Q Consensus       470 L~~~~~~~~~~~~~~l~~l~~l~~L~~L~Ls~~~l~~~~~~~~l~~l~~L~~L~L~~n-~l~~lp~~l~~L~~L~~L~L~  548 (830)
                                                                 +..+++|+.|+|++| ++..+|..+..+++|+.|+++
T Consensus       865 -------------------------------------------i~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~  901 (1153)
T PLN03210        865 -------------------------------------------IEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFS  901 (1153)
T ss_pred             -------------------------------------------HhcCCCCCEEECCCCCCcCccCcccccccCCCeeecC
Confidence                                                       444444444444442 344555555566677777777


Q ss_pred             ccccccccC--CCCCCcceeeccCCcccccccccccccCcccceeeecchhhhcCcchhhhHHHHHHhhhccCCCCcceE
Q 044302          549 DCKRLQSLP--QLPPNVHNVRLNGCASLVTLLGVLRLRKSSWTTIYCIDSLKLLGKNDLATSMLREHLEAVSAPDSKLSI  626 (830)
Q Consensus       549 ~c~~l~~lp--~lp~sL~~L~i~~C~~L~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  626 (830)
                      +|+.|+.++  ..|.++..  +.++. ...++     ......+.+|.+..+..        .    ++..   .....+
T Consensus       902 ~C~~L~~~~l~~~~~~~~~--~~~n~-~~~~p-----~~~~l~f~nC~~L~~~a--------~----l~~~---~~~~~~  958 (1153)
T PLN03210        902 DCGALTEASWNGSPSEVAM--ATDNI-HSKLP-----STVCINFINCFNLDQEA--------L----LQQQ---SIFKQL  958 (1153)
T ss_pred             CCcccccccCCCCchhhhh--hcccc-cccCC-----chhccccccccCCCchh--------h----hccc---ccceEE
Confidence            777665443  22222211  11110 00111     11234567776643100        0    1111   112357


Q ss_pred             eeCCCCCCCcccccCCCceEE-EEcCCCCCCCccEEEEEEEEEEeeCCCCCccccccccCccceeeEEeeCCcccceeec
Q 044302          627 VVPGSEIPKWFMYQNEGSSIT-VTRPSYLHNVNKVVGYAVCCVFHVPKHSTGIRRTTWKGHSFLTHLLFCSMDCSSLFYG  705 (830)
Q Consensus       627 ~~pg~~iP~wf~~~~~g~s~~-~~~~~~~~~~~~~~g~~~c~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  705 (830)
                      ++||.++|+||.||+.|++++ |.+|+.|+ ...+.||++|+|+++....+..     ....+.|.|.+.+.......  
T Consensus       959 ~l~g~evp~~f~hr~~g~sl~~i~l~~~~~-~~~~~~f~~c~v~~~~~~~~~~-----~~~~~~~~c~~~~~~~~~~~-- 1030 (1153)
T PLN03210        959 ILSGEEVPSYFTHRTTGASLTNIPLLHISP-CQPFFRFRACAVVDSESFFIIS-----VSFDIQVCCRFIDRLGNHFD-- 1030 (1153)
T ss_pred             ECCCccCchhccCCcccceeeeeccCCccc-CCCccceEEEEEEecCccccCC-----CceeEEEEEEEECCCCCccc--
Confidence            899999999999999999998 99999888 6789999999999766542111     11245566776542111110  


Q ss_pred             cccccCCCCCCCCeEEEEEEeccccc----------cc--ccccccceEEEEEeccccCCCCceEEEEeceeEeeccccc
Q 044302          706 IDFRDKFGHRGSDHLWLLFLSRAECD----------EY--KWHFESNHFKLKFANHSAVSNTGLKVKRCGFHPVYKQEVE  773 (830)
Q Consensus       706 ~~~~~~~~~~~sdh~~~~~~~~~~~~----------~~--~~~~~~~~~~~~f~~~~~~~~~~~~vk~cGv~lvy~~~~~  773 (830)
                           .   ...+|+|+.|....++.          +.  ......+|+.+.|+..  .....++||+|||+++|+.+..
T Consensus      1031 -----~---~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~--~~~~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1031 -----S---PYQPHVFSVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLT--NKNSQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred             -----c---CCCceeEeeeccccceEEecccccccccccchhccCCceeeEEEEEe--cCCCCeEEEeeeEEEeccCCCc
Confidence                 0   12455555554422110          00  0112345666766321  1223479999999999966544

syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		830
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		6e-13
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		1e-12
3riz_A		772	Crystal Structure Of The Plant Steroid Receptor Bri		2e-04
3rgx_A		768	Structural Insight Into Brassinosteroid Perception		3e-04

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Iteration: 1

Score = 73.2 bits (178), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 64/221 (28%), Positives = 100/221 (45%), Gaps = 24/221 (10%) Query: 266 TTLPGEIFMKSLKTLVLSGCLKLRKFPHVGGSMECLQELFLDETDIKEMPLSIEHLSGLI 325 T PG + ++ L+++ L +FP + LQ +D + E+P + + +GL Sbjct: 78 ATQPGRVALE-LRSVPLP------QFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLE 130 Query: 326 LLTLKYCKNLSSLPVTISSLKCLRTLKLSGCSKLKKFPQIV----------GMEGLSELY 375 LTL L +LP +I+SL LR L + C +L + P+ + G+ L L Sbjct: 131 TLTLAR-NPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLR 189 Query: 376 LDGTSITEVPSSIELLPGIELLNLNDCKNLVRLPRSINGLKALKTLSLSGCCKLENVPDT 435 L+ T I +P+SI L ++ L + + L L +I+ L L+ L L GC L N P Sbjct: 190 LEWTGIRSLPASIANLQNLKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPI 248 Query: 436 LGQVESLEEL---DISGTATRRPPCSIFHMKNLKTLSFSGC 473 G L+ L D S T P I + L+ L GC Sbjct: 249 FGGRAPLKRLILKDCSNLLTL--PLDIHRLTQLEKLDLRGC 287

PyMOL of 4fcg

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772

Back alignment and structure

>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		830
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-54
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-52
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-44
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-43
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-41
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-17
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-40
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-33
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-31
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-23
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-18
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-39
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-32
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-31
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	5e-24
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-34
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-27
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-20
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	7e-18
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-14
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-30
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-27
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-16
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-30
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-29
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-27
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-13
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-30
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-28
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-12
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-29
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-28
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-28
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-19
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-29
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-23
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-21
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	8e-29
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-24
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-22
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-16
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-28
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-23
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-17
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-28
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-27
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-21
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-13
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-27
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-26
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-23
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-12
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-27
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	8e-27
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	7e-22
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-26
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-21
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-19
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-18
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	5e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-24
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-18
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-15
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-11
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-24
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	9e-18
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-14
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-23
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-22
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-22
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-20
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-17
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-15
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-12
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-23
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-22
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	5e-21
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-21
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-14
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-22
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	7e-13
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	4e-22
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	4e-16
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	7e-20
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-19
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	9e-18
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	9e-20
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-12
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-12
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-19
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-15
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	8e-19
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-16
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-12
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-18
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-15
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-18
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-15
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	6e-09
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-08
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	7e-18
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-16
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-15
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-11
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-18
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-15
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-11
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-17
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-15
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-12
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-17
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	8e-14
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-08
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	5e-17
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-16
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-16
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-15
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-10
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-15
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-15
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-15
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-09
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-15
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-10
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	6e-10
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	7e-08
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	5e-15
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-13
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-11
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-13
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	1e-10
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-13
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-12
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	9e-11
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	5e-13
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	6e-13
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	4e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	7e-13
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	9e-11
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-12
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	5e-12
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	8e-09
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	3e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-08
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	7e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	7e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-08
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	7e-11
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	4e-10
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	5e-09
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-08
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-08
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	4e-04
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-09
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	3e-09
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	3e-07
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-05
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	3e-09
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	6e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	3e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	1e-08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	4e-07
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	4e-07
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	1e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	2e-07
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-06
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	5e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	3e-06
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	4e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	8e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	8e-06
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	6e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	6e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	2e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	1e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	2e-05
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	1e-04
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	6e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	7e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	8e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score =  189 bits (481), Expect = 6e-54
 Identities = 71/303 (23%), Positives = 113/303 (37%), Gaps = 28/303 (9%)

Query: 274 MKSLKTLVLSGCLKLRKFPHVGGSMECLQELFLDETDIKEMPLSIEHLSGLILLTLKYCK 333
               + L   G   LR +      +   Q  +  + +         + +   + T    +
Sbjct: 11  SSGRENLYFQGSTALRPYHD---VLSQWQRHYNADRNRWHSAWRQANSNNPQIETRT-GR 66

Query: 334 NLSSLPVTISSLK--CLRTLKLSGCSKLKKFPQIVG-MEGLSELYLDGTSITEVPSSIEL 390
            L +    +          L+L     L +FP     +  L  + +D   + E+P +++ 
Sbjct: 67  ALKATADLLEDATQPGRVALELRSV-PLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQ 125

Query: 391 LPGIELLNLNDCKNLVRLPRSINGLKALKTLSLSGCCKLENVPDTLGQVE---------S 441
             G+E L L     L  LP SI  L  L+ LS+  C +L  +P+ L   +         +
Sbjct: 126 FAGLETLTLARNP-LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVN 184

Query: 442 LEELDISGTATRRPPCSIFHMKNLKTLSFSGCNGPPSTASSLMLP-SLSGLCSLTKLDLS 500
           L+ L +  T  R  P SI +++NLK+L                L  ++  L  L +LDL 
Sbjct: 185 LQSLRLEWTGIRSLPASIANLQNLKSLKIRNS-------PLSALGPAIHHLPKLEELDLR 237

Query: 501 DCGLGEGAILSDIGNLHSLKALYLSE-NNFVTLPASISGLFNLEYLKLEDCKRLQSLPQL 559
            C           G    LK L L + +N +TLP  I  L  LE L L  C  L  LP L
Sbjct: 238 GCTALRN-YPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSL 296

Query: 560 PPN 562
              
Sbjct: 297 IAQ 299

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		830
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
1o6v_A		466	Internalin A; bacterial infection, extracellular r	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.98
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.98
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.97
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.97
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.97
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.96
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.96
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.96
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.96
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.96
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.95
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.95
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.95
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.94
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.94
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.93
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.93
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.93
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.92
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.91
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.9
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.9
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.9
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.9
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.89
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.89
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.89
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.88
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.88
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.88
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.88
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.87
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.87
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.87
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.87
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.86
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.86
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.86
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.86
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.86
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.85
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.85
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.85
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.84
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.83
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.82
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.8
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.78
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.78
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.77
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.77
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.76
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.76
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.76
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.75
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.75
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.75
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.74
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.74
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.73
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.73
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.72
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.72
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.72
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.71
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.71
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.71
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.7
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.66
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.66
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.66
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.65
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.62
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.6
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.59
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.58
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.58
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.57
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.56
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.56
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.56
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.56
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.54
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.53
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.52
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.51
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.51
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.47
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.47
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.46
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.46
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.44
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.38
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.33
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.33
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.31
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.3
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.3
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.29
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.28
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.28
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.27
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.24
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.22
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.22
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.21
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.19
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.18
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.15
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	99.14
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.14
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.02
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.99
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.97
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.96
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.96
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.96
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.8
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.66
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	98.63
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.63
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	98.61
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.6
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.58
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.55
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.54
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.5
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.4
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	98.39
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	98.37
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.75
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.75
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.65
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.58
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.22
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.94
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.06
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.93
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.15
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	93.47

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=9e-41  Score=401.82  Aligned_cols=441  Identities=20%  Similarity=0.213  Sum_probs=244.9

Q ss_pred             hCCCCCceEEEcCcccCCC---ccccccCcceEEEecCCCC-CCCCCC-CCCCceEEEccCCChhhcccCCCCCCcccEE
Q 044302          136 SLMTNLRLLKIGNVQLPKG---LEYLSNKLRLLVWHQYPLK-SLPSNL-QLDKIVEFEMCYSRIEELWKGIKPLNTLKVM  210 (830)
Q Consensus       136 ~~l~~Lr~L~l~~~~l~~~---~~~l~~~Lr~L~l~~~~l~-~lp~~~-~l~~L~~L~L~~n~i~~l~~~~~~l~~L~~L  210 (830)
                      ..+++|++|++++|.+.+.   +..+ ++|++|++++|.+. .+|..+ .+++|++|++++|.+....... .+++|++|
T Consensus       197 ~~l~~L~~L~Ls~n~l~~~~~~l~~l-~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L  274 (768)
T 3rgz_A          197 SRCVNLEFLDVSSNNFSTGIPFLGDC-SALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL-PLKSLQYL  274 (768)
T ss_dssp             TTCTTCCEEECCSSCCCSCCCBCTTC-CSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC-CCTTCCEE
T ss_pred             ccCCcCCEEECcCCcCCCCCcccccC-CCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc-ccCCCCEE
Confidence            4555666666665555432   2222 25566666655554 234333 5555555555555554321111 45555555


Q ss_pred             EccCCCCCCCCC-CCCC-CCceeEEeeeCCcccccccccccCCCCccEEecCCCCCCccCCcc-cc-cCcccEEeccCcc
Q 044302          211 KLSHSENLIKTP-NFIE-VPNLEVLDLEGCTRLREIHSSLVRHNKLILLNLKGCTSLTTLPGE-IF-MKSLKTLVLSGCL  286 (830)
Q Consensus       211 ~L~~~~~~~~~~-~~~~-l~~L~~L~L~~~~~l~~~~~~l~~l~~L~~L~L~~c~~l~~lp~~-~~-l~~L~~L~L~~~~  286 (830)
                      ++++|.....+| .+.. +++|++|++++|.....+|..++++++|++|++++|.....+|.. +. +++|++|++++|.
T Consensus       275 ~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~  354 (768)
T 3rgz_A          275 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE  354 (768)
T ss_dssp             ECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSE
T ss_pred             ECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCc
Confidence            555554332322 2333 255555555555444455555555555555555553333344443 22 5555555555555


Q ss_pred             cccccCCCCCccc-cceEeeccccccc-ccccchhc--ccCCcEEeccCCCCCCCCccccccCccCcEEeecCCCCCCcC
Q 044302          287 KLRKFPHVGGSME-CLQELFLDETDIK-EMPLSIEH--LSGLILLTLKYCKNLSSLPVTISSLKCLRTLKLSGCSKLKKF  362 (830)
Q Consensus       287 ~~~~~~~~~~~l~-~L~~L~L~~~~i~-~l~~~l~~--l~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~  362 (830)
                      +...+|..+..++ +|+.|++++|.+. .+|..+..  +++|+.|++++|.....+|..+..+++|++|++++|.....+
T Consensus       355 l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~  434 (768)
T 3rgz_A          355 FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTI  434 (768)
T ss_dssp             EEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCC
T ss_pred             cCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcc
Confidence            5445555554444 5555555555544 33333333  445555555555544445555555555555555555444443


Q ss_pred             Cc-ccCCCCCcEEEecCCccc-ccCcccCCCCCccEEecCCccCcccccccccCCCCCCEEeccCCCCCCccCcccCCCC
Q 044302          363 PQ-IVGMEGLSELYLDGTSIT-EVPSSIELLPGIELLNLNDCKNLVRLPRSINGLKALKTLSLSGCCKLENVPDTLGQVE  440 (830)
Q Consensus       363 ~~-~~~l~~L~~L~L~~~~i~-~l~~~~~~l~~L~~L~L~~~~~l~~l~~~~~~l~~L~~L~L~~~~~l~~~~~~l~~l~  440 (830)
                      |. +..+++|+.|++++|.+. .+|..+..+++|+.|++++|.....+|..+..+++|++|++++|.....+|..++.++
T Consensus       435 p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~  514 (768)
T 3rgz_A          435 PSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLE  514 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT
T ss_pred             cHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCC
Confidence            33 334555555555555554 4444455555555555555555545555555555555555555555545555555555


Q ss_pred             CccEEecCCCccc-CCCcccccCCCCcEEEcCCCCCCCCCC---------------------------------------
Q 044302          441 SLEELDISGTATR-RPPCSIFHMKNLKTLSFSGCNGPPSTA---------------------------------------  480 (830)
Q Consensus       441 ~L~~L~L~~n~i~-~l~~~l~~l~~L~~L~L~~~~~~~~~~---------------------------------------  480 (830)
                      +|++|++++|.+. .+|..+..+++|++|++++|+.....+                                       
T Consensus       515 ~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  594 (768)
T 3rgz_A          515 NLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLL  594 (768)
T ss_dssp             TCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEE
T ss_pred             CCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccccccc
Confidence            5555555555544 444455555555555555544321100                                       


Q ss_pred             --------------------------ccccCCCCCCCCccCeecCCCCCCCCCccccccCCCCCCCEEeCCCCCCc-ccC
Q 044302          481 --------------------------SSLMLPSLSGLCSLTKLDLSDCGLGEGAILSDIGNLHSLKALYLSENNFV-TLP  533 (830)
Q Consensus       481 --------------------------~~~~l~~l~~l~~L~~L~Ls~~~l~~~~~~~~l~~l~~L~~L~L~~n~l~-~lp  533 (830)
                                                .+...+.+..+++|+.|++++|+++ +.+|..++.+++|+.|+|++|.++ .+|
T Consensus       595 ~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~-g~ip~~l~~l~~L~~L~Ls~N~l~g~ip  673 (768)
T 3rgz_A          595 EFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLS-GYIPKEIGSMPYLFILNLGHNDISGSIP  673 (768)
T ss_dssp             ECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCB-SCCCGGGGGCTTCCEEECCSSCCCSCCC
T ss_pred             ccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCccc-ccCCHHHhccccCCEEeCcCCccCCCCC
Confidence                                      1111223667788999999999987 778888999999999999999998 788


Q ss_pred             cccCCCCccCEeeccccccccccCCC---CCCcceeeccCCcccccccc
Q 044302          534 ASISGLFNLEYLKLEDCKRLQSLPQL---PPNVHNVRLNGCASLVTLLG  579 (830)
Q Consensus       534 ~~l~~L~~L~~L~L~~c~~l~~lp~l---p~sL~~L~i~~C~~L~~~~~  579 (830)
                      ..+..+++|+.|+|++|+....+|..   .++|+.|+++++.--..+|.
T Consensus       674 ~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          674 DEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCS
T ss_pred             hHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCC
Confidence            88999999999999998776677752   25788889888865444443

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		830
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-12
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-04
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-11
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	5e-11
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	1e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	3e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	4e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	6e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.003
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	2e-07
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	3e-07
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	1e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	3e-07
d1m9la_		198	c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree	3e-05
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	3e-05
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	8e-05
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	0.001
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.003
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	3e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	0.001
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	3e-04
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.002

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 67.3 bits (163), Expect = 2e-12
 Identities = 56/370 (15%), Positives = 118/370 (31%), Gaps = 29/370 (7%)

Query: 180 QLDKIVEFEMCYSRIEELWKGIKPLNTLKVMKLSHSENLIKTPNFIEVPNLEVLDLEGCT 239
            LD++   +     I+ +  G++ LN L  +  S++  L        +  L  + +    
Sbjct: 42  DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNN-QLTDITPLKNLTKLVDILMNNNQ 99

Query: 240 RLREIHSSLVRHNKLILLNLKGCTSLTTLPGEIFMKSLKTLVLSGCLKLRKFPHVGGSME 299
                  + + +   + L     T +  L     +  L+    +                
Sbjct: 100 IADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQL 159

Query: 300 CLQELFLDETDIKEMPLSIEHLSGLILLTLKYCKNLSSLPVTISSLKCLRTLKLSGCSKL 359
                  D   +  +                   N  S    ++ L  L +L  +   ++
Sbjct: 160 SFGNQVTDLKPLANLTTLERL---------DISSNKVSDISVLAKLTNLESLIATNN-QI 209

Query: 360 KKFPQIVGMEGLSELYLDGTSITEVPSSIELLPGIELLNLNDCKNLVRLPRSINGLKALK 419
                +  +  L EL L+G  + ++ +   L     L +L+   N +     ++GL  L 
Sbjct: 210 SDITPLGILTNLDELSLNGNQLKDIGTLASL---TNLTDLDLANNQISNLAPLSGLTKLT 266

Query: 420 TLSLSGCCKLENVPDTLGQVESLEELDISGTATRRPPCSIFHMKNLKTLSFSGCNGPPST 479
            L L    ++ N+    G   +                 I ++KNL  L+    N     
Sbjct: 267 ELKLG-ANQISNISPLAGL--TALTNLELNENQLEDISPISNLKNLTYLTLYFNN----- 318

Query: 480 ASSLMLPSLSGLCSLTKLDLSDCGLGEGAILSDIGNLHSLKALYLSENNFVTLPASISGL 539
                +  +S L  L +L  ++  + +   +S + NL ++  L    N    L   ++ L
Sbjct: 319 --ISDISPVSSLTKLQRLFFANNKVSD---VSSLANLTNINWLSAGHNQISDLTP-LANL 372

Query: 540 FNLEYLKLED 549
             +  L L D
Sbjct: 373 TRITQLGLND 382

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		830
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.92
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.9
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.86
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.86
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.86
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.83
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.83
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.77
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.77
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.75
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.75
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.74
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.62
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.58
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.57
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.56
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.53
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.52
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.51
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.48
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.46
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.41
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.4
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.37
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.33
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.31
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.25
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.21
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.21
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.19
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.1
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.03
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.01
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.87
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.85
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.84
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.44
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.37
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.64
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.46
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.63
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.1

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.92  E-value=7.8e-24  Score=230.75  Aligned_cols=193  Identities=20%  Similarity=0.274  Sum_probs=142.7

Q ss_pred             cccccCccCcEEeecCCCCCCcCCcccCCCCCcEEEecCCcccccCcccCCCCCccEEecCCccCcccccccccCCCCCC
Q 044302          340 VTISSLKCLRTLKLSGCSKLKKFPQIVGMEGLSELYLDGTSITEVPSSIELLPGIELLNLNDCKNLVRLPRSINGLKALK  419 (830)
Q Consensus       340 ~~l~~l~~L~~L~L~~~~~~~~~~~~~~l~~L~~L~L~~~~i~~l~~~~~~l~~L~~L~L~~~~~l~~l~~~~~~l~~L~  419 (830)
                      .....+++++.+.+++|.... ++.....++|+.|++++|.++.++ .+..+++|+.|++.+|......  .+..+++|+
T Consensus       191 ~~~~~l~~~~~l~l~~n~i~~-~~~~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~~~--~~~~~~~L~  266 (384)
T d2omza2         191 SVLAKLTNLESLIATNNQISD-ITPLGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLA--PLSGLTKLT  266 (384)
T ss_dssp             GGGGGCTTCSEEECCSSCCCC-CGGGGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCCCG--GGTTCTTCS
T ss_pred             cccccccccceeeccCCccCC-CCcccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCCCC--cccccccCC
Confidence            345566677777777765433 333455677788888888777765 4667788888888887655433  266778888


Q ss_pred             EEeccCCCCCCccCcccCCCCCccEEecCCCcccCCCcccccCCCCcEEEcCCCCCCCCCCccccCCCCCCCCccCeecC
Q 044302          420 TLSLSGCCKLENVPDTLGQVESLEELDISGTATRRPPCSIFHMKNLKTLSFSGCNGPPSTASSLMLPSLSGLCSLTKLDL  499 (830)
Q Consensus       420 ~L~L~~~~~l~~~~~~l~~l~~L~~L~L~~n~i~~l~~~l~~l~~L~~L~L~~~~~~~~~~~~~~l~~l~~l~~L~~L~L  499 (830)
                      +|+++++......  .+..++.++.+++..|.+..++ .+..+++++.|++++|++..       ++.+..+++|++|++
T Consensus       267 ~L~l~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~~-~~~~~~~l~~L~ls~n~l~~-------l~~l~~l~~L~~L~L  336 (384)
T d2omza2         267 ELKLGANQISNIS--PLAGLTALTNLELNENQLEDIS-PISNLKNLTYLTLYFNNISD-------ISPVSSLTKLQRLFF  336 (384)
T ss_dssp             EEECCSSCCCCCG--GGTTCTTCSEEECCSSCCSCCG-GGGGCTTCSEEECCSSCCSC-------CGGGGGCTTCCEEEC
T ss_pred             EeeccCcccCCCC--cccccccccccccccccccccc-ccchhcccCeEECCCCCCCC-------CcccccCCCCCEEEC
Confidence            8888877655432  3667788888888888887654 46778888999998887542       334778889999999


Q ss_pred             CCCCCCCCccccccCCCCCCCEEeCCCCCCcccCcccCCCCccCEeecccc
Q 044302          500 SDCGLGEGAILSDIGNLHSLKALYLSENNFVTLPASISGLFNLEYLKLEDC  550 (830)
Q Consensus       500 s~~~l~~~~~~~~l~~l~~L~~L~L~~n~l~~lp~~l~~L~~L~~L~L~~c  550 (830)
                      ++|++++  ++ .+.++++|++|++++|+++.+++ +.++++|++|+|++|
T Consensus       337 ~~n~l~~--l~-~l~~l~~L~~L~l~~N~l~~l~~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         337 ANNKVSD--VS-SLANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CSSCCCC--CG-GGGGCTTCCEEECCSSCCCBCGG-GTTCTTCSEEECCCE
T ss_pred             CCCCCCC--Ch-hHcCCCCCCEEECCCCcCCCChh-hccCCCCCEeeCCCC
Confidence            9998873  33 58889999999999999998875 888999999999886

PyMOL of d2omza2

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure