Citrus Sinensis ID: 044321


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-
MESDNNEVYKVSNSLRAGITSVWRSNSVSAGAFSMSSREEQDDEEALIWAAVLEKLPTYNRLKKGILTTSRGEANEVDVNNLGQQERQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLKNRCDISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFKFMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLEDELRIPFDKRKSHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQNENAPRFIN
cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccEEEEEcEEEEEEEEEcccccccHHHHHHHHHHHHHHHccccccccccccccccccEEEEccEEEEEEccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHcccEEEEEccEEEEEccHHHHHHHHHHccccccccccccHHHHHcccHHHHHHHccccccccccccHHHHHHHHHccHHHHHHHHHHcccccccccHHHccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHEEcc
cccccHHHHHHHccccccccHHccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHcccccccEEEEHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccccccEEEEccccccEcccEEEEEcccccccHHHHHHHHHccccccccccEEEEcccEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHccccccccccccccEEEEEEHHHcccccEEEEccccccHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHccccccccccccHHHHHHccHHHHHHHHccccccEEEEEHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHc
MESDNNEVYKVSNSLRAGITSVwrsnsvsagafsmssreeqdDEEALIWAAVLEklptynrlkkgilttsrgeanevdvnnlgQQERQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNVeaeayvgsralptFFNFCANIVEGFLNSLNILPSRKKHLTILKdvsgiirpgrmtlllgppgsvkTTLLLALAGKLdsslknrcdisqhdvhigeMTVRETLAFSARCQGVGSRYEMLAELTRREkaagikpdpdiDVFMKAAATEGQEVSVITDYILKILGldvcadtmvgDEILrgisggqrkrvttgemlvgpaqalfmdeisnsTTFQIVNSLRQFIHILEGTILIsllqpapetydlfddiilisnghivyqgPREYVLEFFKFmgfecpkrkgVADFLQEVTSQKEQQQYWAreeepyrfvtvkgftdtfksfylgkkledelripfdkrkshRAALTTKIYGVSEKQLLESCmsrellpmkrNSFVYIFKLsqnenaprfin
MESDNNEVYKVSnslragitsvwrsnSVSAGAFsmssreeqDDEEALIWAAVleklptynrLKKGILttsrgeanevdvnnlgqqerQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLKNRCDISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRRekaagikpdpDIDVFMKAAategqevsVITDYILKILGLDVCADTMVGDEIlrgisggqrkrvttGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFKFMGFECPKRKGVADFLQEVTSQKEqqqywareeepyrfvTVKGFTDTFKSFylgkkledelripfdkrkshraalttkiygvsekQLLESCMSRELLPMKRNSFVYIFklsqnenaprfin
MESDNNEVYKVSNSLRAGITSVWRSNSVSAGAFSMSSREEQDDEEALIWAAVLEKLPTYNRLKKGILTTSRGEANEVDVNNLGQQERQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILKDVSGIIRPGRMTLLLGPPGSVKTTlllalagkldsslkNRCDISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFKFMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLEDELRIPFDKRKSHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQNENAPRFIN
*****************GITSVW**********************ALIWAAVLEKLPTYNRLKKGILTTSR*****VDVN*L****RQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLKNRCDISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFKFMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLEDELRIPFDKRKSHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKL***********
************************************************WAAVLEK******************************************AEVYNEEFLLKLKN**********TIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLN******KHLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLKNRCDISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFKFMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLE************************SEKQLLESCMSRELLPMKRNSFVYIFKLSQNENAPRFIN
*********KVSNSLRAGITSVWRSNSVSA**************EALIWAAVLEKLPTYNRLKKGILTTSRGEANEVDVNNLGQQERQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLKNRCDISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFKFMGFECPKRKGVADFLQEV**********AREEEPYRFVTVKGFTDTFKSFYLGKKLEDELRIPFDKRKSHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQNENAPRFIN
*****************************************DDEEALIWAAVLEKLPTYNRLKKGILTTSRGEANEVDVNNLGQQERQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLKNRCDISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFKFMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLEDELRIPFDKRKSHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQNENAPRFIN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESDNNEVYKVSNSLRAGITSVWRSNSVSAGAFSMSSREEQDDEEALIWAAVLEKLPTYNRLKKGILTTSRGEANEVDVNNLGQQERQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLKNRCDISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFKFMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLEDELRIPFDKRKSHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQNENAPRFIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query521 2.2.26 [Sep-21-2011]
Q76CU2 1434 Pleiotropic drug resistan N/A no 0.952 0.345 0.690 0.0
Q949G3 1436 Pleiotropic drug resistan N/A no 0.952 0.345 0.680 0.0
O24367 1441 Pleiotropic drug resistan N/A no 0.953 0.344 0.672 0.0
Q9M9E1 1423 ABC transporter G family yes no 0.969 0.354 0.632 0.0
Q8GU88 1444 Putative pleiotropic drug yes no 0.934 0.337 0.654 0.0
Q8GU89 1450 Pleiotropic drug resistan no no 0.957 0.344 0.636 0.0
Q7PC80 1468 Probable pleiotropic drug no no 0.967 0.343 0.621 0.0
Q8GU92 1464 Probable pleiotropic drug no no 0.944 0.336 0.627 1e-180
Q0JLC5 1457 Pleiotropic drug resistan no no 0.955 0.341 0.630 1e-180
A2WSH0 1457 Pleiotropic drug resistan N/A no 0.955 0.341 0.628 1e-179
>sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/523 (69%), Positives = 431/523 (82%), Gaps = 27/523 (5%)

Query: 13  NSLRAGITSVWRSNSVSAGAFSMSSREEQDDEEALIWAAVLEKLPTYNRLKKGILTTSRG 72
            SLRA   S+WR+N V    FS SSR+E DDEEAL WAA LEKLPT++RL+KG+L  S+G
Sbjct: 20  GSLRANSNSIWRNNGVEI--FSRSSRDE-DDEEALKWAA-LEKLPTFDRLRKGLLFGSQG 75

Query: 73  EANEVDVNNLGQQERQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNV 132
            A EVD+N+LG QER+ L+E+LVKVA+  NE+FLLKLKNRI RVGI LPTIEVR+EHLN+
Sbjct: 76  AAAEVDINDLGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRYEHLNI 135

Query: 133 EAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILKDVSGIIRPGRMTLLLGP 192
           +A+AYVGSR+LPTF NF  N VE  LNSL+IL SRK+ LTILKD+SGII+P RMTLLLGP
Sbjct: 136 DADAYVGSRSLPTFMNFMTNFVETLLNSLHILSSRKRQLTILKDISGIIKPCRMTLLLGP 195

Query: 193 PGSVKTTLLLALAGKLDSSLK-------------------NRCDISQHDVHIGEMTVRET 233
           P S KTTLLLALAGKLD +LK                       ISQHD+HIGEMTVRET
Sbjct: 196 PSSGKTTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRET 255

Query: 234 LAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKIL 293
           L FSARCQGVGSR+EMLAEL+RREKAA IKPD DID++MKAAATEGQE +V+TDY+LKIL
Sbjct: 256 LEFSARCQGVGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDYVLKIL 315

Query: 294 GLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEIS----NSTTFQIVNSL 349
           GLD+CADTMVGD+++RGISGGQ+KRVTTGEMLVGP++ALFMDEIS    +STT+ IVNSL
Sbjct: 316 GLDICADTMVGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYSIVNSL 375

Query: 350 RQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFKFMGFECPKR 409
           RQ + IL+GT +ISLLQPAPETY+LFDDIIL+S+G+IVYQGPR+ VLEFF+ MGF+CP+R
Sbjct: 376 RQSVQILKGTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGFKCPQR 435

Query: 410 KGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLEDELRIPFDKRK 469
           KGVADFLQEVTS+K+QQQYW++  EPYRF+T K F + ++SF++G+KL DEL  PFDK K
Sbjct: 436 KGVADFLQEVTSKKDQQQYWSKRNEPYRFITSKEFAEAYQSFHVGRKLGDELATPFDKTK 495

Query: 470 SHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQ 512
            H AALT + YG+ +K+LL+ C  RELL MKRNSFVY+FK SQ
Sbjct: 496 CHPAALTNEKYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQ 538




May be a general defense protein.
Nicotiana tabacum (taxid: 4097)
>sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 Back     alignment and function description
>sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 Back     alignment and function description
>sp|Q8GU88|PDR7_ORYSJ Putative pleiotropic drug resistance protein 7 OS=Oryza sativa subsp. japonica GN=PDR7 PE=3 SV=1 Back     alignment and function description
>sp|Q8GU89|PDR4_ORYSJ Pleiotropic drug resistance protein 4 OS=Oryza sativa subsp. japonica GN=PDR4 PE=2 SV=1 Back     alignment and function description
>sp|Q7PC80|PDR1_ORYSJ Probable pleiotropic drug resistance protein 1 OS=Oryza sativa subsp. japonica GN=PDR1 PE=3 SV=1 Back     alignment and function description
>sp|Q8GU92|PDR2_ORYSJ Probable pleiotropic drug resistance protein 2 OS=Oryza sativa subsp. japonica GN=PDR2 PE=3 SV=1 Back     alignment and function description
>sp|Q0JLC5|PDR3_ORYSJ Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. japonica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|A2WSH0|PDR3_ORYSI Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. indica GN=PDR3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query521
356555825 1427 PREDICTED: pleiotropic drug resistance p 0.969 0.353 0.697 0.0
356550580 1426 PREDICTED: pleiotropic drug resistance p 0.967 0.353 0.703 0.0
356555801 1426 PREDICTED: pleiotropic drug resistance p 0.967 0.353 0.703 0.0
356555803 1417 PREDICTED: pleiotropic drug resistance p 0.967 0.355 0.703 0.0
255543331 1429 ATP-binding cassette transporter, putati 0.971 0.354 0.701 0.0
224054164 1424 pleiotropic drug resistance, ABC transpo 0.975 0.356 0.704 0.0
356519409 1426 PREDICTED: pleiotropic drug resistance p 0.971 0.354 0.694 0.0
357455075 1427 Pleiotropic drug resistance protein [Med 0.969 0.353 0.682 0.0
255575322 1423 ATP-binding cassette transporter, putati 0.969 0.354 0.680 0.0
357455071 1492 Pleiotropic drug resistance protein [Med 0.969 0.338 0.676 0.0
>gi|356555825|ref|XP_003546230.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/532 (69%), Positives = 442/532 (83%), Gaps = 27/532 (5%)

Query: 4   DNNEVYKVSNSLRAGITSVWRSNSVSAGAFSMSSREEQDDEEALIWAAVLEKLPTYNRLK 63
           + +++Y+ SNSLR+  ++VWR++ V A  FS SSREE DDEEAL WAA LEKLPTYNRL+
Sbjct: 2   EGSDIYRASNSLRSRSSTVWRNSGVEA--FSRSSREE-DDEEALKWAA-LEKLPTYNRLR 57

Query: 64  KGILTTSRGEANEVDVNNLGQQERQRLVEKLVKVAEVYNEEFLLKLKNRIARVGISLPTI 123
           KG+LT S G ANE+DV++LG QERQ+L+E+LVKVAE  NE FLLKLK RI RVG+ +PTI
Sbjct: 58  KGLLTASHGVANEIDVSDLGIQERQKLLERLVKVAEEDNERFLLKLKERIDRVGLDIPTI 117

Query: 124 EVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILKDVSGIIRP 183
           EVR+EHLN+EAEA+VGSRALP+F N   N+VEGF N L++  S+KKH+TILKDVSGII+P
Sbjct: 118 EVRYEHLNIEAEAFVGSRALPSFINSVTNVVEGFFNLLHVSTSKKKHVTILKDVSGIIKP 177

Query: 184 GRMTLLLGPPGSVKTTLLLALAGKLDSSLK-------------------NRCDISQHDVH 224
            RMTLLLGPP S KTTLLLAL+GKLD +LK                       ISQHD+H
Sbjct: 178 RRMTLLLGPPSSGKTTLLLALSGKLDKTLKVSGRVTYNGHELNEFVPQRTAAYISQHDLH 237

Query: 225 IGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSV 284
           IGEMTVRETLAFSARCQGVGSRY+ML+EL+RREKAA IKPDPD+DV+MKA ATEGQE ++
Sbjct: 238 IGEMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATEGQESNI 297

Query: 285 ITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEIS----NS 340
           +TDY LKILGLD+CADTMVGDE+LRGISGGQRKRVTTGEMLVGPA ALFMDEIS    +S
Sbjct: 298 VTDYTLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSS 357

Query: 341 TTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLEFFK 400
           TTFQIV+SLR ++HIL GT +ISLLQPAPETYDLFDDIILIS+G +VY GPREYVL+FF+
Sbjct: 358 TTFQIVSSLRHYVHILNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFFE 417

Query: 401 FMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLEDE 460
            MGF CP+RKGVADFLQEVTS+K+Q QYW R ++PYRFVTV  F + F+SF++G KL +E
Sbjct: 418 SMGFRCPERKGVADFLQEVTSKKDQAQYWVRRDQPYRFVTVTQFAEAFQSFHIGGKLGEE 477

Query: 461 LRIPFDKRKSHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQ 512
           L +PFD+ KSH AALTTK YG+++K+LL++  SRE L MKRNSFVY+FKLSQ
Sbjct: 478 LTVPFDRTKSHPAALTTKKYGINKKELLKANFSREYLLMKRNSFVYLFKLSQ 529




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356550580|ref|XP_003543663.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356555801|ref|XP_003546218.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356555803|ref|XP_003546219.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|255543331|ref|XP_002512728.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223547739|gb|EEF49231.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224054164|ref|XP_002298123.1| pleiotropic drug resistance, ABC transporter family protein [Populus trichocarpa] gi|222845381|gb|EEE82928.1| pleiotropic drug resistance, ABC transporter family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356519409|ref|XP_003528365.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357455075|ref|XP_003597818.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355486866|gb|AES68069.1| Pleiotropic drug resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255575322|ref|XP_002528564.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223532008|gb|EEF33819.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357455071|ref|XP_003597816.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355486864|gb|AES68067.1| Pleiotropic drug resistance protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query521
TAIR|locus:2196593 1423 ABCG40 "ATP-binding cassette G 0.566 0.207 0.702 2.3e-170
TAIR|locus:2044893 1453 ABCG34 "ATP-binding cassette G 0.566 0.203 0.655 2.5e-149
TAIR|locus:2019693 1454 ABCG39 "ATP-binding cassette G 0.566 0.202 0.645 2.1e-145
TAIR|locus:2025931 1469 PEN3 "PENETRATION 3" [Arabidop 0.566 0.200 0.615 3.7e-145
TAIR|locus:2037703 1442 ABCG35 "ATP-binding cassette G 0.566 0.204 0.628 1.5e-144
TAIR|locus:2039523 1420 ABCG32 "ATP-binding cassette G 0.687 0.252 0.514 4e-133
TAIR|locus:2049867 1413 ABCG33 "ATP-binding cassette G 0.566 0.208 0.575 7.8e-124
TAIR|locus:2045683 1426 ABCG31 "ATP-binding cassette G 0.566 0.206 0.55 2.1e-118
TAIR|locus:2094952 1416 ABCG29 "ATP-binding cassette G 0.815 0.300 0.479 6e-97
TAIR|locus:2084081 1450 ABCG37 "ATP-binding cassette G 0.566 0.203 0.598 2.6e-93
TAIR|locus:2196593 ABCG40 "ATP-binding cassette G40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1117 (398.3 bits), Expect = 2.3e-170, Sum P(2) = 2.3e-170
 Identities = 210/299 (70%), Positives = 257/299 (85%)

Query:   218 ISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAAT 277
             I Q+DVHIGEMTVRET A++AR QGVGSRY+ML EL RREK A IKPDPDID+FMKA +T
Sbjct:   233 IGQNDVHIGEMTVRETFAYAARFQGVGSRYDMLTELARREKEANIKPDPDIDIFMKAMST 292

Query:   278 EGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEI 337
              G++ +V+TDYILKILGL+VCADTMVGD++LRGISGGQ+KRVTTGEMLVGP++ALFMDEI
Sbjct:   293 AGEKTNVMTDYILKILGLEVCADTMVGDDMLRGISGGQKKRVTTGEMLVGPSRALFMDEI 352

Query:   338 S----NSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPRE 393
             S    +STT+QIVNSLR ++HI  GT LISLLQPAPET++LFDDIILI+ G I+Y+GPR+
Sbjct:   353 STGLDSSTTYQIVNSLRNYVHIFNGTALISLLQPAPETFNLFDDIILIAEGEIIYEGPRD 412

Query:   394 YVLEFFKFMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYL 453
             +V+EFF+ MGF+CP RKGVADFLQEVTS+K+Q QYWAR +EPYRF+ V+ F + F+SF++
Sbjct:   413 HVVEFFETMGFKCPPRKGVADFLQEVTSKKDQMQYWARRDEPYRFIRVREFAEAFQSFHV 472

Query:   454 GKKLEDELRIPFDKRKSHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQ 512
             G+++ DEL +PFDK KSH AALTTK YGV  K+L+++  SRE L MKRNSFVY FK  Q
Sbjct:   473 GRRIGDELALPFDKTKSHPAALTTKKYGVGIKELVKTSFSREYLLMKRNSFVYYFKFGQ 531


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0015692 "lead ion transport" evidence=IMP
GO:0006855 "drug transmembrane transport" evidence=ISS
GO:0009723 "response to ethylene stimulus" evidence=RCA;TAS
GO:0009751 "response to salicylic acid stimulus" evidence=TAS
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA;TAS
GO:0010193 "response to ozone" evidence=IEP
GO:0046865 "terpenoid transport" evidence=IDA
GO:0080168 "abscisic acid transport" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:2044893 ABCG34 "ATP-binding cassette G34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019693 ABCG39 "ATP-binding cassette G39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025931 PEN3 "PENETRATION 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037703 ABCG35 "ATP-binding cassette G35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039523 ABCG32 "ATP-binding cassette G32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049867 ABCG33 "ATP-binding cassette G33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045683 ABCG31 "ATP-binding cassette G31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094952 ABCG29 "ATP-binding cassette G29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084081 ABCG37 "ATP-binding cassette G37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 0.0
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 1e-103
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 6e-49
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 5e-35
cd03234226 cd03234, ABCG_White, White pigment protein homolog 1e-29
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 2e-27
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 9e-25
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 1e-22
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-20
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 5e-17
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 2e-15
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 2e-14
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 4e-12
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 5e-12
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-11
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-11
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 7e-11
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 9e-11
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-10
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 2e-10
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 4e-10
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 6e-10
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 2e-09
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 2e-09
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 4e-09
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 5e-09
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 8e-09
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 1e-08
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 2e-08
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-08
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 4e-08
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 1e-07
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 1e-07
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 2e-07
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-07
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 3e-07
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 6e-07
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 7e-07
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 1e-06
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 1e-06
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 1e-06
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 2e-06
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 2e-06
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-06
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 3e-06
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 4e-06
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 4e-06
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 5e-06
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 5e-06
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 5e-06
COG0488530 COG0488, Uup, ATPase components of ABC transporter 6e-06
COG4988559 COG4988, CydD, ABC-type transport system involved 6e-06
COG1123539 COG1123, COG1123, ATPase components of various ABC 6e-06
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 6e-06
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 8e-06
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 1e-05
COG4525259 COG4525, TauB, ABC-type taurine transport system, 1e-05
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 1e-05
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 1e-05
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 2e-05
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-05
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 2e-05
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 3e-05
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 4e-05
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 5e-05
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 5e-05
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 6e-05
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 7e-05
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 7e-05
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 7e-05
COG4987573 COG4987, CydC, ABC-type transport system involved 9e-05
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 9e-05
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 9e-05
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 1e-04
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 1e-04
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 1e-04
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-04
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 2e-04
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 2e-04
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 2e-04
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 2e-04
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 2e-04
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 3e-04
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 3e-04
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 3e-04
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 3e-04
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 4e-04
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 4e-04
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 4e-04
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 5e-04
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 6e-04
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 6e-04
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 7e-04
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 8e-04
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 0.001
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 0.001
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 0.001
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 0.001
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 0.001
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 0.001
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 0.002
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 0.002
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 0.002
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 0.002
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 0.002
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 0.002
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 0.003
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 0.003
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 0.003
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 0.003
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 0.003
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 0.003
COG4133209 COG4133, CcmA, ABC-type transport system involved 0.003
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 0.004
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
 Score =  691 bits (1786), Expect = 0.0
 Identities = 307/540 (56%), Positives = 391/540 (72%), Gaps = 39/540 (7%)

Query: 11  VSNSLRAGIT-SVWRSNSVSAGAFSMSSREEQ------DDEEALIWAAVLEKLPTYNRLK 63
              S+R  I+ SV RS+      FS  S+  +      +DEEAL WAA +EKLPTY+RL+
Sbjct: 4   RGGSMRRSISRSVSRSSRNMEDVFSGGSQSRRRTSSVDEDEEALKWAA-IEKLPTYSRLR 62

Query: 64  KGILTT--------SRGEANEVDVNNLGQQERQRLVEKLVKVAEVYNEEFLLKLKNRIAR 115
             I+ +        ++    EVDV  L   +RQ+ ++ + KVAE  NE+FL K +NRI R
Sbjct: 63  TSIMKSFVENDVYGNQLLHKEVDVTKLDGNDRQKFIDMVFKVAEEDNEKFLKKFRNRIDR 122

Query: 116 VGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILK 175
           VGI LPT+EVRFEHL VEA+ Y+GSRALPT  N   NI E  L  L I  ++K  LTILK
Sbjct: 123 VGIKLPTVEVRFEHLTVEADCYIGSRALPTLPNAARNIAESALGMLGINLAKKTKLTILK 182

Query: 176 DVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLKNRCD------------------ 217
           D SGII+P RMTLLLGPP S KTTLLLALAGKLD SLK   +                  
Sbjct: 183 DASGIIKPSRMTLLLGPPSSGKTTLLLALAGKLDPSLKVSGEITYNGYRLNEFVPRKTSA 242

Query: 218 -ISQHDVHIGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAA 276
            ISQ+DVH+G MTV+ETL FSARCQGVG+RY++L+EL RREK AGI P+ ++D+FMKA A
Sbjct: 243 YISQNDVHVGVMTVKETLDFSARCQGVGTRYDLLSELARREKDAGIFPEAEVDLFMKATA 302

Query: 277 TEGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDE 336
            EG + S+ITDY LKILGLD+C DT+VGDE++RGISGGQ+KRVTTGEM+VGP + LFMDE
Sbjct: 303 MEGVKSSLITDYTLKILGLDICKDTIVGDEMIRGISGGQKKRVTTGEMIVGPTKTLFMDE 362

Query: 337 IS----NSTTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPR 392
           IS    +STT+QIV  L+Q +H+ E T+L+SLLQPAPET+DLFDDIIL+S G IVYQGPR
Sbjct: 363 ISTGLDSSTTYQIVKCLQQIVHLTEATVLMSLLQPAPETFDLFDDIILLSEGQIVYQGPR 422

Query: 393 EYVLEFFKFMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFY 452
           +++LEFF+  GF+CP+RKG ADFLQEVTS+K+Q+QYWA   +PYR+++V  F + FKSF+
Sbjct: 423 DHILEFFESCGFKCPERKGTADFLQEVTSKKDQEQYWADRNKPYRYISVSEFAERFKSFH 482

Query: 453 LGKKLEDELRIPFDKRKSHRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQ 512
           +G +LE+EL +PFDK +SH+AAL    Y V + +LL++C  +E L MKRN+FVY+FK  Q
Sbjct: 483 VGMQLENELSVPFDKSQSHKAALVFSKYSVPKMELLKACWDKEWLLMKRNAFVYVFKTVQ 542


Length = 1470

>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 521
PLN03140 1470 ABC transporter G family member; Provisional 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 100.0
PLN03211 659 ABC transporter G-25; Provisional 100.0
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1123 539 ATPase components of various ABC-type transport sy 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK10261 623 glutathione transporter ATP-binding protein; Provi 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 100.0
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK10938 490 putative molybdenum transport ATP-binding protein 100.0
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
PRK15064 530 ABC transporter ATP-binding protein; Provisional 100.0
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
COG4148352 ModC ABC-type molybdate transport system, ATPase c 100.0
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.98
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.98
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.98
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.98
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.98
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.98
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.98
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.98
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.98
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.98
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.98
PTZ002431560 ABC transporter; Provisional 99.98
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.98
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.97
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.97
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.97
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.97
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.97
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.97
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.97
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.97
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.97
COG4172534 ABC-type uncharacterized transport system, duplica 99.97
PLN03232 1495 ABC transporter C family member; Provisional 99.97
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.97
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.97
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.97
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.97
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.97
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.97
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.97
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.97
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.97
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.97
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.97
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.97
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.97
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.97
COG4586325 ABC-type uncharacterized transport system, ATPase 99.97
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.97
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.97
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.97
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.97
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.97
PLN03130 1622 ABC transporter C family member; Provisional 99.97
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.97
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.97
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.97
PRK11147635 ABC transporter ATPase component; Reviewed 99.97
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.97
cd03246173 ABCC_Protease_Secretion This family represents the 99.97
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.97
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.97
PRK13409590 putative ATPase RIL; Provisional 99.97
PRK11147 635 ABC transporter ATPase component; Reviewed 99.97
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.97
COG0488 530 Uup ATPase components of ABC transporters with dup 99.97
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.97
PLN03073718 ABC transporter F family; Provisional 99.97
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.97
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.97
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.97
PRK10938490 putative molybdenum transport ATP-binding protein 99.97
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.97
COG4172 534 ABC-type uncharacterized transport system, duplica 99.97
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.96
COG4619223 ABC-type uncharacterized transport system, ATPase 99.96
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.96
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.96
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.96
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.96
PLN03073 718 ABC transporter F family; Provisional 99.96
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.96
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.96
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.95
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.95
PTZ00243 1560 ABC transporter; Provisional 99.95
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.95
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.95
PRK13409 590 putative ATPase RIL; Provisional 99.95
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.95
COG4133209 CcmA ABC-type transport system involved in cytochr 99.95
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.95
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.95
KOG00541381 consensus Multidrug resistance-associated protein/ 99.94
COG4136213 ABC-type uncharacterized transport system, ATPase 99.94
COG0488530 Uup ATPase components of ABC transporters with dup 99.94
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.93
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.93
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.93
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.91
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.9
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.89
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.88
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.87
COG4178604 ABC-type uncharacterized transport system, permeas 99.87
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.87
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.87
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.86
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.86
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.86
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.86
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.85
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.85
KOG0062 582 consensus ATPase component of ABC transporters wit 99.85
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.84
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.82
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.81
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.81
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.81
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.79
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 99.79
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.78
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.77
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.77
KOG0062582 consensus ATPase component of ABC transporters wit 99.74
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.74
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.74
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.72
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 99.71
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.7
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.7
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.69
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.67
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.64
PRK006351809 excinuclease ABC subunit A; Provisional 99.64
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.61
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.61
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.59
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.58
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.57
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.54
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 99.54
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 99.52
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.5
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.49
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.31
PRK00064361 recF recombination protein F; Reviewed 99.28
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 99.2
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 99.19
KOG0063 592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.18
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 99.18
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 99.15
PRK13695174 putative NTPase; Provisional 99.1
cd01128249 rho_factor Transcription termination factor rho is 99.05
PRK14079349 recF recombination protein F; Provisional 99.04
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.02
cd01124187 KaiC KaiC is a circadian clock protein primarily f 99.01
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 99.0
PRK00409 782 recombination and DNA strand exchange inhibitor pr 98.99
PHA02562562 46 endonuclease subunit; Provisional 98.94
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 98.93
PRK07721438 fliI flagellum-specific ATP synthase; Validated 98.91
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.89
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.87
TIGR00634563 recN DNA repair protein RecN. All proteins in this 98.85
PRK06793432 fliI flagellum-specific ATP synthase; Validated 98.84
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.84
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 98.81
PRK10869553 recombination and repair protein; Provisional 98.81
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.78
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.72
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 98.66
PRK13830818 conjugal transfer protein TrbE; Provisional 98.66
PRK03918880 chromosome segregation protein; Provisional 98.63
PRK01156895 chromosome segregation protein; Provisional 98.59
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 98.57
PRK06067234 flagellar accessory protein FlaH; Validated 98.53
smart00382148 AAA ATPases associated with a variety of cellular 98.5
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.49
PRK102461047 exonuclease subunit SbcC; Provisional 98.49
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 98.49
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.48
COG3910233 Predicted ATPase [General function prediction only 98.44
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.43
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.39
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.38
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 98.37
PRK05399854 DNA mismatch repair protein MutS; Provisional 98.28
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 98.28
PRK07196434 fliI flagellum-specific ATP synthase; Validated 98.2
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.2
PF1355562 AAA_29: P-loop containing region of AAA domain 98.19
PRK02224880 chromosome segregation protein; Provisional 98.18
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 98.15
PRK13764602 ATPase; Provisional 98.15
PF09818448 ABC_ATPase: Predicted ATPase of the ABC class; Int 98.12
TIGR00767415 rho transcription termination factor Rho. Members 98.11
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 98.09
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.04
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 98.04
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 97.95
PRK13891852 conjugal transfer protein TrbE; Provisional 97.91
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 97.9
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.88
TIGR00611365 recf recF protein. All proteins in this family for 97.87
PRK09825176 idnK D-gluconate kinase; Provisional 97.85
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.85
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.83
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 97.82
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 97.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.79
PRK09183259 transposase/IS protein; Provisional 97.77
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.77
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.74
PRK06002450 fliI flagellum-specific ATP synthase; Validated 97.73
PRK08149428 ATP synthase SpaL; Validated 97.73
PRK00300205 gmk guanylate kinase; Provisional 97.72
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.71
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 97.7
PLN02796347 D-glycerate 3-kinase 97.67
TIGR026801353 conserved hypothetical protein TIGR02680. Members 97.65
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 97.65
COG3044554 Predicted ATPase of the ABC class [General functio 97.63
PRK05688451 fliI flagellum-specific ATP synthase; Validated 97.61
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.61
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.6
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.59
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.58
TIGR02546422 III_secr_ATP type III secretion apparatus H+-trans 97.57
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.3e-83  Score=762.48  Aligned_cols=490  Identities=61%  Similarity=0.990  Sum_probs=429.2

Q ss_pred             CCcccCC---CC---CCCCcHHhhhHHHhhccCCchhhhhhhccccC-----CCC---cccccccCCcHHHHHHHHHHHH
Q 044321           30 AGAFSMS---SR---EEQDDEEALIWAAVLEKLPTYNRLKKGILTTS-----RGE---ANEVDVNNLGQQERQRLVEKLV   95 (521)
Q Consensus        30 ~~~~~~~---~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~---~~~~~~~~l~~~~~~~~~~r~~   95 (521)
                      +++|++.   .+   +.+||||+|+||| +||||||+|+|++++.+.     .|+   ..++|+.+||.++++.+++|++
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  102 (1470)
T PLN03140         24 EDVFSGGSQSRRRTSSVDEDEEALKWAA-IEKLPTYSRLRTSIMKSFVENDVYGNQLLHKEVDVTKLDGNDRQKFIDMVF  102 (1470)
T ss_pred             hhhhhccchhccccccccCChHhhhhHH-hhhCCchhhhhhhhhhcccccccccccccccccccccCChHHHHHHHHhhh
Confidence            5888552   12   3478999999999 999999999999999653     122   2369999999999999999999


Q ss_pred             HHHccCcHHHHHHHHhhhhhcCCCCCceeEEeeeeEEEEEeecCCCCCCcchhhhhhHHHhhhhhcccccCCCCcceeee
Q 044321           96 KVAEVYNEEFLLKLKNRIARVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKKHLTILK  175 (521)
Q Consensus        96 ~~~~~~~~~~~~~~~~~~~~~g~~~~~~~v~f~~l~~~~~~~~~~~~~~t~~~~~~~~~~~~l~~~~~~~~~~~~~~iL~  175 (521)
                      ++.++|+++|+.+++++.+++|+++|+++|+|+||+|++++.++.+.+||++|.+.+.++.+....+...+++.++.||+
T Consensus       103 ~~~~~d~~~~~~~~~~~~~~~~~~~~~~~v~~~~l~v~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~k~~~~~IL~  182 (1470)
T PLN03140        103 KVAEEDNEKFLKKFRNRIDRVGIKLPTVEVRFEHLTVEADCYIGSRALPTLPNAARNIAESALGMLGINLAKKTKLTILK  182 (1470)
T ss_pred             cccchhHHHHHHHHHhhhccccCCCCCCeeEEeCCEEEEEecCCcccCCcHHHHHHHHHHHHHHHhccccCCCccceecc
Confidence            99999999999999999999999999999999999999999999999999999999988876654433223334578999


Q ss_pred             eeEEEEeCCcEEEEEcCCCChHHHHHHHHhCCCCCCC-------------------CceeeecCCccccCCCCHHHHHHH
Q 044321          176 DVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSL-------------------KNRCDISQHDVHIGEMTVRETLAF  236 (521)
Q Consensus       176 dVS~~I~~Ge~~~LlGpnGSGKSTLLk~LaG~l~~~~-------------------~~~~~v~q~d~~~~~lTV~E~l~f  236 (521)
                      ||||.|+||++++|+||||||||||||+|+|+++++.                   +..+||+|++.|++.+||+||+.|
T Consensus       183 ~vs~~i~~Ge~~~llGpnGSGKSTLLk~LaG~l~~~~~~~G~I~~nG~~~~~~~~~~~i~yv~Q~d~~~~~lTV~EtL~f  262 (1470)
T PLN03140        183 DASGIIKPSRMTLLLGPPSSGKTTLLLALAGKLDPSLKVSGEITYNGYRLNEFVPRKTSAYISQNDVHVGVMTVKETLDF  262 (1470)
T ss_pred             CCeEEEeCCeEEEEEcCCCCCHHHHHHHHhCCCCCCCcceeEEEECCEechhhcccceeEEecccccCCCcCcHHHHHHH
Confidence            9999999999999999999999999999999987641                   113899999999999999999999


Q ss_pred             HHHhccCchhhHHHHHHHHHHHhcCCCCCCChHHHHHHHhhhchhhhhHHHHHHHHcCCCccccccccCccCCCCChHHH
Q 044321          237 SARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGDEILRGISGGQR  316 (521)
Q Consensus       237 ~~~~~~~~~~~~~~~~l~~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~iL~~lgL~~~~dt~vg~~~~r~LSGGqr  316 (521)
                      +++|++.+.++++..++++.++..++.|+.+++.++++...++.+.+..++.+|+.+||++|+||.||++++++||||||
T Consensus       263 ~a~~~~~~~~~~~~~~~~~~ek~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~L~~lGL~~~~~t~vg~~~~rglSGGer  342 (1470)
T PLN03140        263 SARCQGVGTRYDLLSELARREKDAGIFPEAEVDLFMKATAMEGVKSSLITDYTLKILGLDICKDTIVGDEMIRGISGGQK  342 (1470)
T ss_pred             HHHhcCCCCcccchhhcCHHHHhccCCCchhhHHHHHHhhhhcchhhHHHHHHHHHcCCccccCceeCCccccCCCcccc
Confidence            99988765554444455566666666666677778887777666667788999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCCcEEEEeCCChhh----HHHHHHHHHHHHHHcCCeEEEEEecChhHHHhhcCeEEEEeCCEEEEecCH
Q 044321          317 KRVTTGEMLVGPAQALFMDEISNST----TFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPR  392 (521)
Q Consensus       317 QRvaIAraLv~~P~iLlLDEPTs~~----~~~i~~~L~~l~~~~~~t~ii~i~h~~~~~~~l~D~VivL~~G~iv~~G~~  392 (521)
                      |||+||++|+.+|++|||||||+++    +.++++.|+++++..+.|+|+++||+.++++++||+|++|++|+++|+|++
T Consensus       343 kRVsia~aL~~~p~vlllDEPTsGLDs~t~~~i~~~Lr~la~~~g~Tviis~Hqp~~~i~~lfD~vilL~~G~ivy~G~~  422 (1470)
T PLN03140        343 KRVTTGEMIVGPTKTLFMDEISTGLDSSTTYQIVKCLQQIVHLTEATVLMSLLQPAPETFDLFDDIILLSEGQIVYQGPR  422 (1470)
T ss_pred             eeeeehhhhcCCCcEEEEeCCCcCccHHHHHHHHHHHHHHHHhcCCEEEEEecCCCHHHHHHhheEEEeeCceEEEeCCH
Confidence            9999999999999999999999965    456777788876655778888888988999999999999999999999999


Q ss_pred             hHHHHHHHHcCCCCCCCCCHHHHHHHhhChHHHHHHHhhccCCccccChhHHHHHHHhchhhhhHHHhhcCccccccccc
Q 044321          393 EYVLEFFKFMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLEDELRIPFDKRKSHR  472 (521)
Q Consensus       393 ~~v~~~f~~~g~~~p~~~~~adfl~~v~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  472 (521)
                      +++.+||+++||.||+++++|||++++++++++.+||.....|+.+.++++|+++|++|+.++++.+++..|+++++.++
T Consensus       423 ~~~~~yF~~lGf~cP~~~n~ADFl~~v~s~~~~~~~~~~~~~p~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~  502 (1470)
T PLN03140        423 DHILEFFESCGFKCPERKGTADFLQEVTSKKDQEQYWADRNKPYRYISVSEFAERFKSFHVGMQLENELSVPFDKSQSHK  502 (1470)
T ss_pred             HHHHHHHHHcCCCCCCCCChHHHHHHhcCchhhhhhhhccCCccccCCHHHHHHHHHhcHHHHHHHHHHhhhhhhhhccc
Confidence            99999999999999999999999999999988889997777888889999999999999999999988888887777777


Q ss_pred             ccccccccCCCHHHHHHHHHHHhHHHhhcChHHHHHHHHHHHhccccC
Q 044321          473 AALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFKLSQNENAPRFI  520 (521)
Q Consensus       473 ~~~~~~~y~~s~~~q~~~~~~R~~~~~~r~~~~~~~~~~q~~~~~~~~  520 (521)
                      .++..++|.+|+|+|+++|++|+|++++||++++++|++|.+++++++
T Consensus       503 ~~~~~~~y~~s~~~q~~~~~~R~~~~~~Rd~~~~~~r~~~~ii~ali~  550 (1470)
T PLN03140        503 AALVFSKYSVPKMELLKACWDKEWLLMKRNAFVYVFKTVQIIIVAAIA  550 (1470)
T ss_pred             ccccCCCCcCCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHH
Confidence            777778899999999999999999999999999999999999988653



>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>COG3044 Predicted ATPase of the ABC class [General function prediction only] Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query521
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 9e-10
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 4e-09
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-06
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 9e-09
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-08
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 6e-07
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 7e-07
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 9e-07
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 2e-06
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 2e-06
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 5e-06
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 1e-04
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 5e-06
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 2e-05
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 6e-06
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-05
1sgw_A214 Putative ABC transporter; structural genomics, P p 2e-05
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 4e-05
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 4e-05
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 1e-04
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-04
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 5e-04
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 2e-04
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 2e-04
1g6h_A257 High-affinity branched-chain amino acid transport 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 74.5 bits (182), Expect = 4e-14
 Identities = 85/545 (15%), Positives = 158/545 (28%), Gaps = 186/545 (34%)

Query: 64  KGILTTSRGEANEVD--VNNLGQQERQRL------------VEKLVKVAEVYNEEFLLKL 109
           K IL+       E+D  + +                     V+K V+     N +FL+  
Sbjct: 43  KSILSKE-----EIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLM-- 95

Query: 110 KNRIARVGISLPTIEVRFEHLNVEAEAYVGSRALPTFFNFCANIVEGFLNSLNILPSRKK 169
            + I       P++             Y+  R      +   N  + F    N+  SR +
Sbjct: 96  -SPIKTEQRQ-PSMM---------TRMYIEQR------DRLYNDNQVF-AKYNV--SRLQ 135

Query: 170 HLTILKDVSGIIRPGRMTLLLGPPGSVKTTL----------------------------- 200
               L+     +RP +  L+ G  GS KT +                             
Sbjct: 136 PYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSP 195

Query: 201 ------LLALAGKLDSSLKNRCDISQ---HDVHIGEMTVRETL----------------- 234
                 L  L  ++D +  +R D S      +H  +  +R  L                 
Sbjct: 196 ETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQN 255

Query: 235 -----AFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVI---- 285
                AF+  C+       +L   TR              V    +A     +S+     
Sbjct: 256 AKAWNAFNLSCK-------ILL-TTR-----------FKQVTDFLSAATTTHISLDHHSM 296

Query: 286 ---TDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTT 342
               D +  +L      D    D  L       R+ +TT    +        D ++    
Sbjct: 297 TLTPDEVKSLLLK--YLDCRPQD--LP------REVLTTNPRRLSIIAESIRDGLATWDN 346

Query: 343 FQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDI-ILISNGHIVYQGPREYVLEFF-K 400
           ++ VN   +   I+E +  +++L+PA E   +FD + +   + HI    P   +L     
Sbjct: 347 WKHVN-CDKLTTIIESS--LNVLEPA-EYRKMFDRLSVFPPSAHI----PTI-LLSLIWF 397

Query: 401 FMGFECPKRKGVADFLQEVTSQKEQQQYWAREEEPYRFVTVKGFTDTFKSFYLGKKLEDE 460
            +             + ++      ++              K  T +  S YL      E
Sbjct: 398 DVIKSDVM-----VVVNKLHKYSLVEKQP------------KESTISIPSIYL------E 434

Query: 461 LRIPFDKRKS-HRAALTTKIYGVSEKQLLESCMSRELLPMKRNSFVYIFK-----LSQNE 514
           L++  +   + HR+ +    Y + +           + P       Y +      L   E
Sbjct: 435 LKVKLENEYALHRSIVDH--YNIPKT----FDSDDLIPPYLDQ---YFYSHIGHHLKNIE 485

Query: 515 NAPRF 519
           +  R 
Sbjct: 486 HPERM 490


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query521
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 100.0
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.98
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.97
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.97
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.97
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.97
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.97
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.96
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.96
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.96
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.95
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.95
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.94
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.94
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.93
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.93
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.92
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.92
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.91
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.89
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.88
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.86
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.84
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.84
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.81
1e69_A322 Chromosome segregation SMC protein; structural mai 99.8
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.78
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.77
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.75
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.75
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.74
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.73
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.72
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.71
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.71
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.7
2og2_A359 Putative signal recognition particle receptor; nuc 99.7
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.69
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.69
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.68
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.66
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.66
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.64
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.61
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.59
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.59
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.58
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.58
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 99.57
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.55
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.55
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.54
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.54
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.54
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.53
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.52
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.51
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.48
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.46
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.46
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.45
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.45
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.44
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.44
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.41
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.39
3kta_B173 Chromosome segregation protein SMC; structural mai 99.35
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.24
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.22
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 99.22
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.21
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.2
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.2
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.2
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.18
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.16
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.14
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.13
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.12
2ewv_A372 Twitching motility protein PILT; pilus retraction 99.11
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.11
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.1
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 99.09
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.08
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.06
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.06
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 99.04
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.04
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.01
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 98.98
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 98.97
1p9r_A418 General secretion pathway protein E; bacterial typ 98.94
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.88
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.86
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.83
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.81
2r6a_A454 DNAB helicase, replicative helicase; replication, 98.78
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.77
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.69
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.69
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.67
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.59
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.58
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.58
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.58
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.56
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.53
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.51
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.49
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 98.47
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.45
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.39
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 98.28
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 98.27
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 98.26
3kta_A182 Chromosome segregation protein SMC; structural mai 98.23
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.23
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.21
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.19
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.15
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.14
2oap_1511 GSPE-2, type II secretion system protein; hexameri 98.09
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.08
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.07
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.07
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 98.03
2z43_A324 DNA repair and recombination protein RADA; archaea 98.02
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.97
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.95
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.95
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.93
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.92
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.9
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.9
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.88
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.83
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.82
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.77
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.73
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.71
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.71
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.7
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.68
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.67
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.66
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.65
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.6
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.59
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.57
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.48
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.45
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.44
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.42
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.41
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.38
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.38
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.37
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.35
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.35
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.33
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 97.32
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.3
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.28
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 97.27
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.25
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.25
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.23
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.23
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.22
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.2
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.2
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.19
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.15
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.09
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.06
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 97.05
3ice_A422 Transcription termination factor RHO; transcriptio 97.04
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.04
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.03
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.02
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.01
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.99
1xp8_A366 RECA protein, recombinase A; recombination, radior 96.99
2www_A349 Methylmalonic aciduria type A protein, mitochondri 96.96
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.96
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.93
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.91
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.89
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.88
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.87
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.86
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 96.86
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 96.86
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.85
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.84
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.83
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.82
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 96.81
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.79
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.77
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.77
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.77
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.77
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 96.76
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.67
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.67
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.66
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 96.62
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.61
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 96.6
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.59
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 96.58
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.58
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.57
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.57
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.51
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 96.5
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.5
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.49
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.46
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.46
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 96.45
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.44
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.44
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.44
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 96.43
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.39
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.38
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.38
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 96.38
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.36
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.35
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.34
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.34
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.31
1via_A175 Shikimate kinase; structural genomics, transferase 96.3
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.3
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.29
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.25
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.24
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.21
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.19
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.19
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.18
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.17
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 96.13
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.11
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 96.11
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.09
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 96.03
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.02
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.0
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.0
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 95.98
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.97
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 95.96
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.95
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.93
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.91
2ged_A193 SR-beta, signal recognition particle receptor beta 95.9
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 95.89
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.89
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.84
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.84
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.83
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 95.83
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.83
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 95.83
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 95.83
3bos_A242 Putative DNA replication factor; P-loop containing 95.83
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.82
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.82
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 95.82
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 95.82
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.81
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 95.8
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.79
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.79
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 95.78
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 95.78
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.78
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.76
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 95.75
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 95.74
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 95.74
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 95.73
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 95.72
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 95.71
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.71
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 95.71
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.7
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.69
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 95.69
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.69
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.69
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.66
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 95.66
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.64
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 95.62
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.6
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 95.59
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 95.57
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.56
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.56
3lxw_A247 GTPase IMAP family member 1; immunity, structural 95.55
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 95.55
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.51
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 95.5
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.49
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.48
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.46
3t1o_A198 Gliding protein MGLA; G domain containing protein, 95.45
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.43
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 95.42
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.41
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 95.41
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 95.4
3iby_A256 Ferrous iron transport protein B; G protein, G dom 95.4
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.38
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.38
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.38
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.37
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 95.36
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.36
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 95.34
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 95.34
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 95.33
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.33
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 95.31
1nrj_B218 SR-beta, signal recognition particle receptor beta 95.3
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 95.3
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 95.29
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 95.29
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 95.29
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.27
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.26
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.26
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.26
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.26
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 95.25
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 95.24
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 95.24
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 95.23
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 95.2
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 95.19
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 95.19
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 95.19
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 95.18
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.18
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 95.16
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 95.15
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 95.15
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 95.14
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 95.12
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 95.11
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.11
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 95.1
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 95.1
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.1
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 95.09
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 95.09
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.09
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 95.08
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.06
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 95.05
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 95.04
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 95.03
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 95.02
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 95.01
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 95.01
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 95.0
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.0
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 94.99
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 94.99
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 94.97
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 94.97
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 94.97
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 94.97
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 94.96
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.96
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.95
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 94.94
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 94.94
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 94.93
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 94.93
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 94.92
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 94.89
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 94.87
1jal_A363 YCHF protein; nucleotide-binding fold, structural 94.86
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 94.86
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 94.85
3llu_A196 RAS-related GTP-binding protein C; structural geno 94.85
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 94.81
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 94.79
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 94.78
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 94.78
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 94.76
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 94.75
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 94.74
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 94.73
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 94.73
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 94.73
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 94.69
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 94.67
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 94.65
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.62
2fh5_B214 SR-beta, signal recognition particle receptor beta 94.6
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 94.56
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 94.56
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.54
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 94.52
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 94.52
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 94.5
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 94.5
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 94.49
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 94.48
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 94.47
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 94.47
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 94.45
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 94.39
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 94.38
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 94.38
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 94.37
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 94.37
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.34
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 94.32
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 94.29
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 94.29
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 94.29
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 94.29
2hf9_A226 Probable hydrogenase nickel incorporation protein 94.24
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.23
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 94.21
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.18
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.17
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 94.16
3cnl_A262 YLQF, putative uncharacterized protein; circular p 94.12
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.09
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.99
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 93.99
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 93.98
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 93.96
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.96
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.96
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 93.93
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 93.86
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 93.85
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 93.81
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 93.73
2qgz_A308 Helicase loader, putative primosome component; str 93.6
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 93.58
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.56
1tue_A212 Replication protein E1; helicase, replication, E1E 93.5
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 93.48
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 93.42
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
Probab=100.00  E-value=1.9e-41  Score=352.09  Aligned_cols=203  Identities=21%  Similarity=0.272  Sum_probs=165.6

Q ss_pred             cceeeeeeEEEEeCCcEEEEEcCCCChHHHHHHHHhCCCCCCCC----------------------ceeeecCCccccCC
Q 044321          170 HLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLK----------------------NRCDISQHDVHIGE  227 (521)
Q Consensus       170 ~~~iL~dVS~~I~~Ge~~~LlGpnGSGKSTLLk~LaG~l~~~~~----------------------~~~~v~q~d~~~~~  227 (521)
                      ...+|+||||+|++||+++|+||||||||||+++|+|+++|+.+                      ..+||+|+..+++.
T Consensus        40 ~~~aL~~vsl~i~~Gei~~IiGpnGaGKSTLlr~i~GL~~p~~G~I~i~G~~i~~~~~~~~~~~r~~Ig~v~Q~~~l~~~  119 (366)
T 3tui_C           40 TIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSS  119 (366)
T ss_dssp             EEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECSSCCHHHHHHHHTTEEEECSSCCCCTT
T ss_pred             CeEEEEeeEEEEcCCCEEEEEcCCCchHHHHHHHHhcCCCCCceEEEECCEECCcCCHHHHHHHhCcEEEEeCCCccCCC
Confidence            35799999999999999999999999999999999999987521                      23899999999999


Q ss_pred             CCHHHHHHHHHHhccCchhhHHHHHHHHHHHhcCCCCCCChHHHHHHHhhhchhhhhHHHHHHHHcCCCccccccccCcc
Q 044321          228 MTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGDEI  307 (521)
Q Consensus       228 lTV~E~l~f~~~~~~~~~~~~~~~~l~~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~iL~~lgL~~~~dt~vg~~~  307 (521)
                      +||+||+.|+....+...                                  .+...+++++|+.+||.+..+.+++   
T Consensus       120 ~TV~env~~~~~~~~~~~----------------------------------~~~~~~v~~lL~~vgL~~~~~~~~~---  162 (366)
T 3tui_C          120 RTVFGNVALPLELDNTPK----------------------------------DEVKRRVTELLSLVGLGDKHDSYPS---  162 (366)
T ss_dssp             SCHHHHHHHHHHHSCCCH----------------------------------HHHHHHHHHHHHHHTCGGGTTCCTT---
T ss_pred             CCHHHHHHHHHHhcCCCH----------------------------------HHHHHHHHHHHHHcCCchHhcCChh---
Confidence            999999999865543211                                  1123356789999999988877665   


Q ss_pred             CCCCChHHHHHHHHHHHHcCCCcEEEEeCCChhhHHHHHHHHHHHHHHc---CCeEEEEEecChhHHHhhcCeEEEEeCC
Q 044321          308 LRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHIL---EGTILISLLQPAPETYDLFDDIILISNG  384 (521)
Q Consensus       308 ~r~LSGGqrQRvaIAraLv~~P~iLlLDEPTs~~~~~i~~~L~~l~~~~---~~t~ii~i~h~~~~~~~l~D~VivL~~G  384 (521)
                        .|||||||||+|||||+.+|++|||||||+++|......+.++++++   .+++|++++|+...+..+||+|++|++|
T Consensus       163 --~LSGGqkQRVaIArAL~~~P~lLLlDEPTs~LD~~~~~~i~~lL~~l~~~~g~Tii~vTHdl~~~~~~aDrv~vl~~G  240 (366)
T 3tui_C          163 --NLSGGQKQRVAIARALASNPKVLLCDQATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNG  240 (366)
T ss_dssp             --TSCHHHHHHHHHHHHTTTCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHSCCEEEEEESCHHHHHHHCSEEEEEETT
T ss_pred             --hCCHHHHHHHHHHHHHhcCCCEEEEECCCccCCHHHHHHHHHHHHHHHHhCCCEEEEEecCHHHHHHhCCEEEEEECC
Confidence              59999999999999999999999999999988876666555554432   2566677789999999999999999999


Q ss_pred             EEEEecCHhHHHHHHHHcCCCCCCCCCHHHHHHHh
Q 044321          385 HIVYQGPREYVLEFFKFMGFECPKRKGVADFLQEV  419 (521)
Q Consensus       385 ~iv~~G~~~~v~~~f~~~g~~~p~~~~~adfl~~v  419 (521)
                      ++++.|++++++        ..|.......|+...
T Consensus       241 ~iv~~g~~~ev~--------~~p~~~~~~~~~~~~  267 (366)
T 3tui_C          241 ELIEQDTVSEVF--------SHPKTPLAQKFIQST  267 (366)
T ss_dssp             EEEECCBHHHHH--------SSCCSHHHHHHHHHH
T ss_pred             EEEEEcCHHHHH--------hCCCcHHHHHHHhhc
Confidence            999999999984        345555556666554



>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 521
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 6e-18
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-17
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 1e-16
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-16
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 5e-16
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 5e-16
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 6e-16
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-15
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 5e-15
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 6e-15
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 1e-14
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 2e-14
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 7e-14
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 5e-13
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 6e-13
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 7e-13
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 2e-12
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 3e-10
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-08
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 4e-06
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 0.003
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 0.003
d1nlfa_274 c.37.1.11 (A:) Hexameric replicative helicase repA 0.004
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Peptide transporter Tap1, C-terminal ABC domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 81.1 bits (200), Expect = 6e-18
 Identities = 48/237 (20%), Positives = 90/237 (37%), Gaps = 22/237 (9%)

Query: 165 PSRKKHLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSLKNRCDISQHDVH 224
           P+R     +L+ ++  +RPG +T L+GP GS K+T+   L             +      
Sbjct: 22  PNRPDV-LVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQP---TGGQLLLDGKP 77

Query: 225 IGEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSV 284
           + +   R       +   VG   ++     +   A G+   P ++    AA   G     
Sbjct: 78  LPQYEHRY---LHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAH--- 131

Query: 285 ITDYILKILGLDVCADTMVGDEILRGISGGQRKRVTTGEMLVGPAQALFMDEISNS---- 340
                  I GL    DT V +   + +SGGQR+ V     L+     L +D+ +++    
Sbjct: 132 -----SFISGLPQGYDTEVDEAGSQ-LSGGQRQAVALARALIRKPCVLILDDATSALDAN 185

Query: 341 TTFQIVNSLRQFIHILEGTILISLLQPAPETYDLFDDIILISNGHIVYQGPREYVLE 397
           +  Q+   L +       ++L+          +  D I+ +  G I   G  + ++E
Sbjct: 186 SQLQVEQLLYESPERYSRSVLLITQH--LSLVEQADHILFLEGGAIREGGTHQQLME 240


>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query521
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.7
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.45
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.4
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.64
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.59
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.12
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 98.04
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 98.01
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.63
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.51
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 97.49
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.38
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.38
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.29
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.29
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.25
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.19
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.19
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.19
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.15
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.13
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.01
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.01
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.0
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.99
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.96
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.95
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.94
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.91
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.9
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 96.89
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.88
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.88
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.87
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.8
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.77
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.72
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.71
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.69
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.68
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.67
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.67
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.65
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.62
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.55
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.54
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 96.54
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.51
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.48
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.48
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.45
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.44
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.41
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.4
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.39
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.37
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.36
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.36
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.35
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.35
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.32
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.32
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 96.32
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.29
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 96.29
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.27
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.25
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.24
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.23
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.22
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.22
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.22
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.2
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.17
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.16
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.16
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.15
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.15
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.14
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.14
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 96.09
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.08
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.07
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.07
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.99
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.97
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.92
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.9
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.86
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.85
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.8
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.79
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.79
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.73
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 95.72
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.7
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.69
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.66
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.65
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.64
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.64
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.6
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.53
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.49
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.48
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.43
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.38
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.34
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.33
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.32
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.27
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.25
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.22
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.21
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.1
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.01
d1okkd2207 GTPase domain of the signal recognition particle r 94.97
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.94
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.9
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.88
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 94.87
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 94.87
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.83
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.81
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 94.8
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 94.79
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.79
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.64
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.62
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.61
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.58
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.57
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 94.56
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.56
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.56
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 94.55
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.54
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.54
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.53
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.52
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.51
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 94.49
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.44
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.44
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.42
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.31
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 94.25
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 94.25
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.25
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.22
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 94.22
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 94.16
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 94.13
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.1
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 94.09
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.08
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 94.05
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 93.97
d1vmaa2213 GTPase domain of the signal recognition particle r 93.93
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.92
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 93.91
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 93.87
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.83
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.75
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 93.74
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.7
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 93.69
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.67
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.65
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 93.65
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 93.62
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.61
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.6
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.53
d2qy9a2211 GTPase domain of the signal recognition particle r 93.53
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 93.5
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 93.47
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 93.41
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 93.33
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.3
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 93.25
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.82
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.81
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.78
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 92.77
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 92.76
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.73
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 92.58
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.46
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.44
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.42
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.28
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 92.2
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.07
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.0
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.99
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 91.7
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 91.36
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 91.23
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.13
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.12
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.55
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.41
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.27
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.21
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 90.14
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 89.97
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.67
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 89.65
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 89.53
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.15
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 88.78
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.7
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 88.44
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 88.2
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 87.93
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 87.83
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 86.48
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.84
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.77
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 85.37
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 83.86
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 83.8
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 83.77
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 82.48
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 82.32
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 82.31
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 82.11
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 82.09
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 81.33
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 80.54
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 80.53
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 80.15
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]
Probab=100.00  E-value=1.6e-46  Score=366.68  Aligned_cols=201  Identities=27%  Similarity=0.366  Sum_probs=168.2

Q ss_pred             CcceeeeeeEEEEeCCcEEEEEcCCCChHHHHHHHHhCCCCCCC-----------------------CceeeecCCcccc
Q 044321          169 KHLTILKDVSGIIRPGRMTLLLGPPGSVKTTLLLALAGKLDSSL-----------------------KNRCDISQHDVHI  225 (521)
Q Consensus       169 ~~~~iL~dVS~~I~~Ge~~~LlGpnGSGKSTLLk~LaG~l~~~~-----------------------~~~~~v~q~d~~~  225 (521)
                      +++++|+||||+|++||+++|+||||||||||+++|+|++.|+.                       +..+||+|++.++
T Consensus        14 g~~~al~~vsl~i~~Ge~~~liG~sGaGKSTll~~i~gl~~p~sG~I~~~g~~i~~~~~~~~~~~~~r~ig~v~Q~~~L~   93 (240)
T d1g2912          14 GEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVPPKDRDIAMVFQSYALY   93 (240)
T ss_dssp             TTEEEEEEEEEEEETTCEEEEECSTTSSHHHHHHHHHTSSCCSEEEEEETTEEEEEGGGTEECCGGGSSEEEECSCCCCC
T ss_pred             CCEEEEcceeeEEcCCCEEEEECCCCChHHHHHHHHhcCCCCCCCEEEECCEEecccchhhhcccccccceecccchhhc
Confidence            34579999999999999999999999999999999999998862                       1238999999999


Q ss_pred             CCCCHHHHHHHHHHhccCchhhHHHHHHHHHHHhcCCCCCCChHHHHHHHhhhchhhhhHHHHHHHHcCCCccccccccC
Q 044321          226 GEMTVRETLAFSARCQGVGSRYEMLAELTRREKAAGIKPDPDIDVFMKAAATEGQEVSVITDYILKILGLDVCADTMVGD  305 (521)
Q Consensus       226 ~~lTV~E~l~f~~~~~~~~~~~~~~~~l~~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~iL~~lgL~~~~dt~vg~  305 (521)
                      +.+||.||+.|+....+...                                  .+.+.+++++|+.+||.+..+.+++ 
T Consensus        94 ~~ltV~eni~~~~~~~~~~~----------------------------------~e~~~~v~~~l~~~~l~~~~~~~p~-  138 (240)
T d1g2912          94 PHMTVYDNIAFPLKLRKVPR----------------------------------QEIDQRVREVAELLGLTELLNRKPR-  138 (240)
T ss_dssp             TTSCHHHHHHHHHHHTTCCH----------------------------------HHHHHHHHHHHHHHTCGGGTTCCGG-
T ss_pred             chhhhhHhhhhhHHHcCCCH----------------------------------HHHHHHHHHHHHHcCChhHhcCChh-
Confidence            99999999999877654321                                  1234467889999999998887765 


Q ss_pred             ccCCCCChHHHHHHHHHHHHcCCCcEEEEeCCChhhHHHHHHHHHHHHHHc---CCeEEEEEecChhHHHhhcCeEEEEe
Q 044321          306 EILRGISGGQRKRVTTGEMLVGPAQALFMDEISNSTTFQIVNSLRQFIHIL---EGTILISLLQPAPETYDLFDDIILIS  382 (521)
Q Consensus       306 ~~~r~LSGGqrQRvaIAraLv~~P~iLlLDEPTs~~~~~i~~~L~~l~~~~---~~t~ii~i~h~~~~~~~l~D~VivL~  382 (521)
                          .|||||||||+|||||+.+|++|||||||+++|......+.+++.++   .++++|++||+.+++..+||+|++|+
T Consensus       139 ----~LSGGqkQRv~IAraL~~~P~iLllDEPt~~LD~~~~~~i~~~l~~l~~~~g~tvi~vTHd~~~~~~~~drv~vm~  214 (240)
T d1g2912         139 ----ELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMN  214 (240)
T ss_dssp             ----GSCHHHHHHHHHHHHHHTCCSEEEEECTTTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESCHHHHHHHCSEEEEEE
T ss_pred             ----hCCHHHHHHHHHHHHHhcCCCEEEecCCCcccCHHHHHHHHHHHHHHHhccCCEEEEEcCCHHHHHHhCCEEEEEE
Confidence                49999999999999999999999999999988776655555554332   25667778899999999999999999


Q ss_pred             CCEEEEecCHhHHHHHHHHcCCCCCCCCCHHHHH
Q 044321          383 NGHIVYQGPREYVLEFFKFMGFECPKRKGVADFL  416 (521)
Q Consensus       383 ~G~iv~~G~~~~v~~~f~~~g~~~p~~~~~adfl  416 (521)
                      +|+|++.|++++++        ..|.+..+++|+
T Consensus       215 ~G~iv~~G~~~el~--------~~P~~~~~~~fi  240 (240)
T d1g2912         215 RGVLQQVGSPDEVY--------DKPANTFVAGFI  240 (240)
T ss_dssp             TTEEEEEECHHHHH--------HSCSBHHHHHHS
T ss_pred             CCEEEEEcCHHHHH--------hCCCCHHHHHhC
Confidence            99999999999984        467776666663



>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure