Citrus Sinensis ID: 044353


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590------
SLFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGNDLCGAPLSNCTEKNILIPEDENGSGNEDDDEDGVDWLLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCYQIFHVCTCVFYVLNQ
cEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccEEEccccccccccccEEEccccEEEEEEcccccccccccEEEEccccccccccHHccccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccccccccccccccccccccEEEccccccEEEccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccEEEEEccHHHHHcccccEEEcccccccccccHHHHHHcccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccccccccccccEEEccccccEEEEEEEEEEcccEEEEccccccEEEEEcccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccEEEEEEEEHHHHHHHHHHHccc
ccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEEcccccccccccHHccccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEEccccccccccHHHccccccccccccccEEEEcccccccccccHHHHHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccccccccEEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHccHHHccHHHccccccccccccccccccEEEccccccccccccHHccHHHHHHEEHcHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcc
slflrrsqfyGHLTNQLGRFKtlraldlsnntvngpiplslgqianleyldlsnnklngtvseIHFLNLTQLLVFRAHGnslvfkinpnwvppFQLAFLELrschlgprfplwlqsqkklyyldisstrisakiprgfwnsifQYDYLNVSgnqiyggvpkfdspsvplittpsllgsifdlsnnalsgsIFHLICQGENFSKNIEFLKLSKnhfsedipdcwmnwprlrmlnlgnnnftgslpmsIGALNSLMSLNLrnnrlsgiiptsfrNLSILKAldmgenelvgniptwiGETFSRLMILNlrsnkfhgdfpiqlcrlgsLQILDVAYNslsgtiprcinnfsamattdssdpnsgifyassgdneiVEDALLVTKGFLVEYNSILNLVRSIdisknnfsgeipvevtnlqglqslnlshnlftgripdnigvMRSIESLdfsanqlsgqipqsmsnlsFLNYLNLsnnnlngeipsstqlqsfgassfagndlcgaplsncteknilipedengsgnedddedgVDWLLYISMALGFVVGFWCfigpllikrrwRYKYCHFLDrlwdgcfvrkcyqifHVCTCVFYVLNQ
slflrrsqfygHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGNDLCGAPLSNCTEKNILipedengsgneDDDEDGVDWLLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCYQIFHVCTCVFYVLNQ
SLFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGAlnslmslnlrnnrlsGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMsnlsflnylnlsnnnlnGEIPSSTQLQSFGASSFAGNDLCGAPLSNCTEKNILIPedengsgnedddedgvdWLLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCYQIFHVCTCVFYVLNQ
***LRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMA*********GIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSA************NLSFLNYLNLSN********************FAGNDLCGAPLSNCTEKNIL****************GVDWLLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCYQIFHVCTCVFYVL**
SLFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTD***PNSGIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGNDLCGAP****************************DWLLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCYQIFHVCTCVFYVLN*
SLFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGNDLCGAPLSNCTEKNILIPEDE********DEDGVDWLLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCYQIFHVCTCVFYVLNQ
*LFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGNDLCGAPLSNCTEKNILIPEDENGSGNEDDDEDGVDWLLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCYQIFHVCTCVFY****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGNDLCGAPLSNCTEKNILIPEDENGSGNEDDDEDGVDWLLYISMALGFVVGFWCFIGPLLIKRRWRYKYCHFLDRLWDGCFVRKCYQIFHVCTCVFYVLNQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query596 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.798 0.380 0.322 6e-54
Q9C9H7847 Receptor-like protein 12 no no 0.895 0.630 0.301 2e-53
C0LGQ5 1249 LRR receptor-like serine/ no no 0.783 0.373 0.323 4e-51
Q9FL28 1173 LRR receptor-like serine/ no no 0.823 0.418 0.309 6e-50
C0LGS2 1136 Probable LRR receptor-lik no no 0.867 0.455 0.303 9e-48
Q9ZPS9 1143 Serine/threonine-protein no no 0.837 0.436 0.295 9e-47
C0LGW6 966 LRR receptor-like serine/ no no 0.731 0.451 0.310 1e-44
Q9LVP0 1102 Probable leucine-rich rep no no 0.802 0.433 0.312 3e-43
Q9SHI2 1101 Leucine-rich repeat recep no no 0.744 0.403 0.309 4e-43
Q6XAT2 967 LRR receptor-like serine/ no no 0.719 0.443 0.303 5e-43
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  212 bits (540), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 177/548 (32%), Positives = 262/548 (47%), Gaps = 72/548 (13%)

Query: 2   LFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTV 61
           LFL  +Q  G +  ++   ++L+ LDLSNNT+ G IP SL Q+  L  L L+NN L GT+
Sbjct: 342 LFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTL 401

Query: 62  SEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLY 121
           S     NLT L  F  + N+L  K+        +L  + L         P+ + +  +L 
Sbjct: 402 SS-SISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGEMPVEIGNCTRLQ 460

Query: 122 YLDISSTRISAKIPRGF-----------------------WNSIFQYDYLNVSGNQIYGG 158
            +D    R+S +IP                            +  Q   ++++ NQ+ G 
Sbjct: 461 EIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGS 520

Query: 159 VPK----FDSPSVPLITTPSLLGSIFD------------LSNNALSGSIFHLICQGENFS 202
           +P       +  + +I   SL G++ D             S+N  +GSI  L       S
Sbjct: 521 IPSSFGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSNKFNGSISPLCGSSSYLS 580

Query: 203 KNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNNR 262
            ++     ++N F  DIP        L  L LG N FTG +P + G ++ L  L++  N 
Sbjct: 581 FDV-----TENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTFGKISELSLLDISRNS 635

Query: 263 LSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCR 322
           LSGIIP        L  +D+  N L G IPTW+G+    L  L L SNKF G  P ++  
Sbjct: 636 LSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGK-LPLLGELKLSSNKFVGSLPTEIFS 694

Query: 323 LGSLQILDVAYNSLSGTIPRCINNFSAM-ATTDSSDPNSGIFYASSGDNEIVEDALLVTK 381
           L ++  L +  NSL+G+IP+ I N  A+ A     +  SG   ++ G             
Sbjct: 695 LTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGK------------ 742

Query: 382 GFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQS-LNLSHNLFTGRIPDNIGVMR 440
                    L+ +  + +S+N  +GEIPVE+  LQ LQS L+LS+N FTGRIP  I  + 
Sbjct: 743 ---------LSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLP 793

Query: 441 SIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGN-DL 499
            +ESLD S NQL G++P  + ++  L YLNLS NNL G++    Q   + A +F GN  L
Sbjct: 794 KLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKL--KKQFSRWQADAFVGNAGL 851

Query: 500 CGAPLSNC 507
           CG+PLS+C
Sbjct: 852 CGSPLSHC 859




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query596
224072885 1024 predicted protein [Populus trichocarpa] 0.951 0.553 0.490 1e-147
315436720 1020 verticillium wilt resistance-like protei 0.951 0.555 0.500 1e-145
255547794 909 serine-threonine protein kinase, plant-t 0.947 0.621 0.478 1e-141
350284759 980 receptor-like protein [Malus micromalus] 0.961 0.584 0.459 1e-140
350284741 982 receptor-like protein [Malus x domestica 0.944 0.573 0.464 1e-140
255539443 1054 serine-threonine protein kinase, plant-t 0.922 0.521 0.479 1e-140
209970618 967 M18-S3Bp [Malus floribunda] 0.958 0.590 0.458 1e-139
209970607 1045 M18S-3Ap [Malus floribunda] 0.964 0.550 0.467 1e-139
350284751 980 receptor-like protein [Malus baccata] 0.937 0.570 0.461 1e-139
350284749 980 receptor-like protein [Malus baccata] 0.937 0.570 0.461 1e-139
>gi|224072885|ref|XP_002303927.1| predicted protein [Populus trichocarpa] gi|222841359|gb|EEE78906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  530 bits (1365), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 304/620 (49%), Positives = 406/620 (65%), Gaps = 53/620 (8%)

Query: 1    SLFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGT 60
            SL L     +G LTN LG+F+ L  L L +N+++GPIP++LG++ +L  L LS+NKLNGT
Sbjct: 414  SLDLAGCLLFGQLTNHLGKFRNLAYLGLRSNSISGPIPMALGELVSLRSLVLSDNKLNGT 473

Query: 61   ------------------------VSEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQL 96
                                    VSE+HF NL  L  F A GN L  +++P+W+PP QL
Sbjct: 474  LPKSFGELTKLEEMDISHNLFQGEVSEVHFANLKNLRNFSAAGNQLNLRVSPDWIPP-QL 532

Query: 97   AFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIY 156
             F++LRS ++GP+FP W++  + L YLDIS++ IS+ IP  FW   F+ +YLN+S NQI 
Sbjct: 533  VFIDLRSWNVGPQFPKWVRPLEHLSYLDISNSSISSTIPIWFWTMSFRMEYLNLSHNQIQ 592

Query: 157  GGVP---KFD-SPSVPLITT---------PSLLGSI--FDLSNNALSGSIFHLICQGENF 201
            G +P   K D + S PL+           PS+  ++   DLSNN+ SGS+ + +C   + 
Sbjct: 593  GVIPSKLKLDFTASYPLVDLSSNQFKGPLPSIFSNVGALDLSNNSFSGSMLNFLCHKIDE 652

Query: 202  SKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNN 261
             KN++ L L +N  S  IPDCW +W  L  + L NN  +G++P SIGAL+ L SL++RN+
Sbjct: 653  LKNMQVLNLGENLLSGVIPDCWSSWQYLVAIKLSNNKLSGNIPDSIGALSLLESLHIRNS 712

Query: 262  RLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLC 321
             LSG +P S +N + L  LD+ ENELVG++P WIG+ FS +++LN+R+NKFHG  P +LC
Sbjct: 713  SLSGKLPISLKNCTKLITLDVAENELVGSMPAWIGKRFSSMVVLNMRANKFHGRIPRELC 772

Query: 322  RLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYASSGDNEIVEDALLVTK 381
             L SLQILD+A+N LS +IP C N  SAMAT + S    G  Y  SG +   ++ LLV K
Sbjct: 773  NLASLQILDLAHNRLSWSIPTCFNKLSAMATRNDS---LGKIYLDSGSSTF-DNVLLVMK 828

Query: 382  GFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRS 441
            G +VEY++IL  VRSID+S N   GEIP EVT L  LQSLNLS N  TGRIP+ IG +R 
Sbjct: 829  GKVVEYSTILKFVRSIDLSSNALCGEIPEEVTRLSELQSLNLSQNSLTGRIPEGIGSLRY 888

Query: 442  IESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGNDLCG 501
            +ES+DFS NQLSG+IPQSMS+L+FL++LNLS+N L G IPS TQLQSFG SSF+GN+LCG
Sbjct: 889  LESMDFSVNQLSGEIPQSMSDLTFLSHLNLSDNRLRGRIPSGTQLQSFGPSSFSGNELCG 948

Query: 502  APLS-NCTEKNILIPEDENGSGNEDDDEDGVD--WLLYISMALGFVVGFWCFIGPLLIKR 558
             PLS NC+  N    E E      ++D +G+   W  Y+SM LGF+VGFW  +GPL+  R
Sbjct: 949  PPLSKNCSVDNKFHVEHE-----REEDGNGLKGRW-FYVSMVLGFIVGFWGVVGPLMFNR 1002

Query: 559  RWRYKYCHFLDRLWDGCFVR 578
            RWRY Y HFLDRL D  + R
Sbjct: 1003 RWRYVYYHFLDRLRDQIWWR 1022




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|315436720|gb|ADU18533.1| verticillium wilt resistance-like protein [Gossypium barbadense] Back     alignment and taxonomy information
>gi|255547794|ref|XP_002514954.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223546005|gb|EEF47508.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|350284759|gb|AEQ27751.1| receptor-like protein [Malus micromalus] Back     alignment and taxonomy information
>gi|350284741|gb|AEQ27742.1| receptor-like protein [Malus x domestica] Back     alignment and taxonomy information
>gi|255539443|ref|XP_002510786.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223549901|gb|EEF51388.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|209970618|gb|ACJ03070.1| M18-S3Bp [Malus floribunda] Back     alignment and taxonomy information
>gi|209970607|gb|ACJ03066.1| M18S-3Ap [Malus floribunda] Back     alignment and taxonomy information
>gi|350284751|gb|AEQ27747.1| receptor-like protein [Malus baccata] Back     alignment and taxonomy information
>gi|350284749|gb|AEQ27746.1| receptor-like protein [Malus baccata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query596
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.899 0.612 0.31 8.9e-55
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.882 0.605 0.308 3.9e-53
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.901 0.569 0.303 2.2e-51
TAIR|locus:2119535725 RLP48 "receptor like protein 4 0.843 0.693 0.295 2.8e-51
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.907 0.730 0.294 1.7e-50
TAIR|locus:2046397589 RLP22 "receptor like protein 2 0.800 0.809 0.315 5.8e-50
TAIR|locus:2055772983 RLP19 "receptor like protein 1 0.889 0.539 0.285 3.8e-49
TAIR|locus:2173777792 RLP54 "receptor like protein 5 0.828 0.623 0.315 1.2e-48
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.812 0.596 0.314 2.4e-48
TAIR|locus:2094603835 RLP37 "receptor like protein 3 0.909 0.649 0.303 7.9e-48
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 570 (205.7 bits), Expect = 8.9e-55, P = 8.9e-55
 Identities = 186/600 (31%), Positives = 276/600 (46%)

Query:     2 LFLRRSQFYGHLT-NQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGT 60
             +FL  +Q  G L    +     L  L L  N + GPIP S+ ++ NL  LDLS+  + G 
Sbjct:   284 IFLDNNQLSGTLEFGNISSPSNLLVLQLGGNNLRGPIPTSISRLVNLRTLDLSHFNIQGQ 343

Query:    61 VSEIHFLNLTQL-LVFRAHGNSLV----------FK------INPNWV----------PP 93
             V    F +L  L  ++ +H N+            FK      ++ N V          PP
Sbjct:   344 VDFNIFSHLKLLGNLYLSHSNTTTTIDLNAVLSCFKMLISLDLSGNHVLVTNKSSVSDPP 403

Query:    94 FQL-AFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSG 152
               L   L L  C +   FP  L++Q+++  LDIS+ +I  ++P   W  + Q +Y+++S 
Sbjct:   404 LGLIGSLNLSGCGI-TEFPDILRTQRQMRTLDISNNKIKGQVPS--W-LLLQLEYMHISN 459

Query:   153 NQIYG--GVPKFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKL 210
             N   G     K +   VP    PS+    F  SNN  SG I   IC      +++  L L
Sbjct:   460 NNFIGFERSTKLEKTVVP---KPSM--KHFFGSNNNFSGKIPSFICS----LRSLIILDL 510

Query:   211 SKNHFSEDIPDCWMNWPR-LRMLNLGNNNFTGSLPMSIGAXXXXXXXXXXXXXXXGIIPT 269
             S N+FS  IP C   +   L  LNL  N  +GSLP +I                 G +P 
Sbjct:   511 SNNNFSGAIPPCVGKFKSTLSDLNLRRNRLSGSLPKTI--IKSLRSLDVSHNELEGKLPR 568

Query:   270 SFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSLQIL 329
             S  + S L+ L++  N +    P W+  +  +L +L LRSN FHG   I   R   L+I+
Sbjct:   569 SLIHFSTLEVLNVESNRINDTFPFWLS-SLKKLQVLVLRSNAFHGR--IHKTRFPKLRII 625

Query:   330 DVAYNSLSGTIPR-CINNFSAMATTDSSDPNSGIFYASSGDNEIVEDALLVTKGFLVEYN 388
             D++ N  +GT+P  C   ++ M + + ++      Y  SG     +  +L+ KG  +E  
Sbjct:   626 DISRNHFNGTLPSDCFVEWTGMHSLEKNEDRFNEKYMGSGYYH--DSMVLMNKGLEMELV 683

Query:   389 SILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFS 448
              IL +  ++D S N F GEIP  +  L+ L  LNLS N FTG IP ++G +R +ESLD S
Sbjct:   684 RILKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVS 743

Query:   449 ANQLSGQIPQSMXXXXXXXXXXXXXXXXXGEIPSSTQLQSFGASSFAGN-DLCGAPLSNC 507
              N+LSG+IPQ +                 G++P  TQ ++  ASSF  N  LCG PL  C
Sbjct:   744 RNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVPGGTQFRTQSASSFEENLGLCGRPLEEC 803

Query:   508 TEKNILIPXXXXXXXXXXXXXXXXXWLLYISMALGFVVGF--WCFIGPLLI--KRRWRYK 563
                +   P                  L +I+ A+GF  G      IG +++  K RW +K
Sbjct:   804 RVVHEPTPSGESETLESEQV------LSWIAAAIGFTPGIVLGLTIGHIVLSSKPRWFFK 857


GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006457 "protein folding" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046397 RLP22 "receptor like protein 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173777 RLP54 "receptor like protein 54" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00031679
hypothetical protein (1024 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query596
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-55
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-26
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  200 bits (510), Expect = 6e-55
 Identities = 159/504 (31%), Positives = 248/504 (49%), Gaps = 21/504 (4%)

Query: 2   LFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTV 61
           L L  + F G +    G    L  LDLSNN ++G IP  +G  ++L+ LDL  N L G +
Sbjct: 123 LNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKI 180

Query: 62  SEIHFLNLTQLLVFRAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLY 121
                 NLT L       N LV +I         L ++ L   +L    P  +     L 
Sbjct: 181 P-NSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLN 239

Query: 122 YLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSLLGSIFD 181
           +LD+    ++  IP    N +    YL +  N++ G +P        LI+         D
Sbjct: 240 HLDLVYNNLTGPIPSSLGN-LKNLQYLFLYQNKLSGPIPPSIFSLQKLIS--------LD 290

Query: 182 LSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFTG 241
           LS+N+LSG I  L+ Q     +N+E L L  N+F+  IP    + PRL++L L +N F+G
Sbjct: 291 LSDNSLSGEIPELVIQ----LQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSG 346

Query: 242 SLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSR 301
            +P ++G  N+L  L+L  N L+G IP    +   L  L +  N L G IP  +G   S 
Sbjct: 347 EIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRS- 405

Query: 302 LMILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPN-S 360
           L  + L+ N F G+ P +  +L  +  LD++ N+L G I     +  ++     +     
Sbjct: 406 LRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFF 465

Query: 361 GIFYASSGDNEIVEDALLVTKGFLVEYNSILNL--VRSIDISKNNFSGEIPVEVTNLQGL 418
           G    S G   +    L   +        + +L  +  + +S+N  SGEIP E+++ + L
Sbjct: 466 GGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKL 525

Query: 419 QSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNG 478
            SL+LSHN  +G+IP +   M  +  LD S NQLSG+IP+++ N+  L  +N+S+N+L+G
Sbjct: 526 VSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHG 585

Query: 479 EIPSSTQLQSFGASSFAGN-DLCG 501
            +PS+    +  AS+ AGN DLCG
Sbjct: 586 SLPSTGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 596
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.54
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
PLN03150623 hypothetical protein; Provisional 99.26
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.8
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.78
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.72
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.62
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.46
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.27
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.25
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.12
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.97
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.85
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.84
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.7
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.66
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.63
PRK15386426 type III secretion protein GogB; Provisional 97.63
PRK15386426 type III secretion protein GogB; Provisional 97.61
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.42
KOG4341483 consensus F-box protein containing LRR [General fu 97.21
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.2
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG4341483 consensus F-box protein containing LRR [General fu 97.04
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.46
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.08
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.03
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.81
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.79
KOG4308478 consensus LRR-containing protein [Function unknown 94.49
KOG4308478 consensus LRR-containing protein [Function unknown 93.49
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.22
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.08
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.75
smart0037026 LRR Leucine-rich repeats, outliers. 91.75
smart0037026 LRR Leucine-rich repeats, outliers. 90.85
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.85
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.79
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.31
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 86.29
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 83.34
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 81.84
KOG0473 326 consensus Leucine-rich repeat protein [Function un 81.01
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 80.77
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.75
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.6e-54  Score=495.43  Aligned_cols=494  Identities=33%  Similarity=0.473  Sum_probs=346.2

Q ss_pred             CeeecCCCccccCCcccc-CCCCCCEEECcCCcccccCCccCcCCCCCCEEECcCCcCccccChhhhhcCCCCcEEEccC
Q 044353            1 SLFLRRSQFYGHLTNQLG-RFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHG   79 (596)
Q Consensus         1 ~l~L~~n~l~~~~~~~l~-~l~~L~~L~ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~~l~~L~~L~L~~   79 (596)
                      +|+|++|++++.+|..+. .+++|++|++++|.+++.+|.  ..+++|++|+|++|.+.+.+|. .+.++++|++|++++
T Consensus        97 ~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~-~~~~l~~L~~L~L~~  173 (968)
T PLN00113         97 TINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPN-DIGSFSSLKVLDLGG  173 (968)
T ss_pred             EEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCCh-HHhcCCCCCEEECcc
Confidence            378999999888887654 889999999999988876664  4578888888888888777776 788888888888888


Q ss_pred             CeeeeEeCCCCCCCCCccEEEccCCCCCCCcchhhcCCCCCcEEEcccCcCcccCChhHHhcCCCCcEEEcccccccccC
Q 044353           80 NSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGV  159 (596)
Q Consensus        80 n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~i~~~~~~~~~~~l~~L~~L~l~~n~l~~~~  159 (596)
                      |.+.+..+..+.++++|++|++++|.+.+..|..++++++|+.|++++|.+++.+|..+. .+++|++|++++|.+++..
T Consensus       174 n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~L~~n~l~~~~  252 (968)
T PLN00113        174 NVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIG-GLTSLNHLDLVYNNLTGPI  252 (968)
T ss_pred             CcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHh-cCCCCCEEECcCceecccc
Confidence            888877888888888888888888888888888888888888888888888877777764 4688888888888887766


Q ss_pred             CCCCCCCCCc--cc---------cC----CCCC-ceEEcccCccccccccccccCCCCCCCccEEeCcCCcCCCCCCccc
Q 044353          160 PKFDSPSVPL--IT---------TP----SLLG-SIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCW  223 (596)
Q Consensus       160 ~~~~~~~~~~--~~---------~~----~~~~-~~l~ls~n~l~~~~~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~~  223 (596)
                      |..+......  +.         +|    .+.. +.+++++|.+.+..+..+    ..+++|+.|++++|.+.+..|..+
T Consensus       253 p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~----~~l~~L~~L~l~~n~~~~~~~~~~  328 (968)
T PLN00113        253 PSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELV----IQLQNLEILHLFSNNFTGKIPVAL  328 (968)
T ss_pred             ChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhH----cCCCCCcEEECCCCccCCcCChhH
Confidence            6554432111  00         01    0111 444555555444333222    224555555555555555555555


Q ss_pred             CCCCCCcEEEcccccccccCCccCcCCCCCcEEEccCCcccccCChhhcCCCCCCEEEccCCcccccCchhhhhhccccc
Q 044353          224 MNWPRLRMLNLGNNNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLM  303 (596)
Q Consensus       224 ~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~  303 (596)
                      ..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.+|..+. .+++|+
T Consensus       329 ~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~-~~~~L~  407 (968)
T PLN00113        329 TSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLG-ACRSLR  407 (968)
T ss_pred             hcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHh-CCCCCC
Confidence            5555555555555555555555555555555555555555555555555555555555555555555555544 456666


Q ss_pred             EEEccCCcCcCcCCcccCCCCCCcEEeCCCCcCcccCCccccccccCcccCCCCCCCCccccCCCCCceeeeeEEE---e
Q 044353          304 ILNLRSNKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYASSGDNEIVEDALLV---T  380 (596)
Q Consensus       304 ~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~l~l~~~~~~~~~~~~~~~~~~~~~~~~---~  380 (596)
                      .|++++|.+++..|..+..+++|+.|++++|.+++.+|..+..+++|+.++++.+......+............+.   .
T Consensus       408 ~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l  487 (968)
T PLN00113        408 RVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQF  487 (968)
T ss_pred             EEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCcc
Confidence            6666666666666666666666666666666666666666666666666666655432111111101111111111   1


Q ss_pred             ccceeecccccccccEEEccCCcccccCCccccCcccCCeeeccCccCcccCCccccCCCCCCEEECCCCcCcccCCccc
Q 044353          381 KGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSM  460 (596)
Q Consensus       381 ~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~  460 (596)
                      .+..+..+..+++|+.|+|++|.+.+.+|..+..+++|++|+|++|.+++.+|..+..+++|+.|+|++|++++.+|..+
T Consensus       488 ~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l  567 (968)
T PLN00113        488 SGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNL  567 (968)
T ss_pred             CCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhH
Confidence            22333445568889999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCEEecccccCccCCCCCCccCccccccccCCC-CCCCC
Q 044353          461 SNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGND-LCGAP  503 (596)
Q Consensus       461 ~~l~~L~~L~ls~N~l~~~~~~~~~~~~l~~~~~~~n~-lc~~~  503 (596)
                      ..+++|+.|++++|++.+.+|...++.++....+.||+ +|+.+
T Consensus       568 ~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        568 GNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             hcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            99999999999999999999999888899888999999 89754



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query596
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-29
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-29
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-11
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 127 bits (318), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 147/589 (24%), Positives = 218/589 (37%), Gaps = 124/589 (21%) Query: 16 QLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVF 75 + R L LD+S+N + IP LG + L++LD+S NKL+G S T+L + Sbjct: 192 DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLL 249 Query: 76 RAHGNSLVFKINPNWVPPFQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIP 135 N V GP PL L+S L YL ++ + + +IP Sbjct: 250 NISSNQFV-----------------------GPIPPLPLKS---LQYLSLAENKFTGEIP 283 Query: 136 RGFWNSIFQYDYLNVSGNQIYGGVPKFD----------------SPSVPLITTPSLLGS- 178 + L++SGN YG VP F S +P+ T + G Sbjct: 284 DFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLK 343 Query: 179 -------------------------IFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKN 213 DLS+N SG I +CQ N ++ L L N Sbjct: 344 VLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ--NPKNTLQELYLQNN 401 Query: 214 HFSEDIPDCWMNWPRLRMLNLGNNNFTGSLPMSIGA------------------------ 249 F+ IP N L L+L N +G++P S+G+ Sbjct: 402 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMY 461 Query: 250 XXXXXXXXXXXXXXXGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRS 309 G IP+ N + L + + N L G IP WIG L IL L + Sbjct: 462 VKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGR-LENLAILKLSN 520 Query: 310 NKFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYASSGD 369 N F G+ P +L SL LD+ N +GTIP + S + ++ + G Sbjct: 521 NSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGM 580 Query: 370 NEIVEDA--LLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNL 427 + A LL +G E + L+ +I+ + G N + L++S+N+ Sbjct: 581 KKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNM 640 Query: 428 F------------------------TGRIPDNIGVMRSIESLDFSANQLSGQIPQSMXXX 463 +G IPD +G +R + LD S+N+L G+IPQ+M Sbjct: 641 LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSAL 700 Query: 464 XXXXXXXXXXXXXXGEIPSSTQLQSFGASSFAGN-DLCGAPLSNCTEKN 511 G IP Q ++F + F N LCG PL C N Sbjct: 701 TMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSN 749
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query596
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-118
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-90
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-87
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-86
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-42
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-74
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-19
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-50
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-47
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-50
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-47
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-49
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-42
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-39
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-41
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-40
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-38
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  368 bits (948), Expect = e-118
 Identities = 146/515 (28%), Positives = 212/515 (41%), Gaps = 47/515 (9%)

Query: 1   SLFLRRSQFYGHLTNQL-GRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNG 59
            L L  ++F G + + L G   TL  LDLS N   G +P   G  + LE L LS+N  +G
Sbjct: 273 YLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSG 332

Query: 60  TVSEIHFLNLTQLLVFRAHGNSLVFKINPNWV--PPFQLAFLELRSCHLGPRFP--LWLQ 115
            +     L +  L V     N    ++ P  +      L  L+L S +        L   
Sbjct: 333 ELPMDTLLKMRGLKVLDLSFNEFSGEL-PESLTNLSASLLTLDLSSNNFSGPILPNLCQN 391

Query: 116 SQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVPKFDSPSVPLITTPSL 175
            +  L  L + +   + KIP    N   +   L++S N + G +P        L +   L
Sbjct: 392 PKNTLQELYLQNNGFTGKIPPTLSN-CSELVSLHLSFNYLSGTIPSS------LGSLSKL 444

Query: 176 LGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLG 235
                 L  N L G I   +       K +E L L  N  + +IP    N   L  ++L 
Sbjct: 445 --RDLKLWLNMLEGEIPQELMYV----KTLETLILDFNDLTGEIPSGLSNCTNLNWISLS 498

Query: 236 NNNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWI 295
           NN  TG +P  IG L +L  L L NN  SG IP    +   L  LD+  N   G IP  +
Sbjct: 499 NNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM 558

Query: 296 GETFSRLMILNLRSNKFHGDFPIQLCRLGSLQILDVAYN--SLSGTIPRCINNFSAMATT 353
            +         + +N   G   + +   G  +    A N     G     +N  S     
Sbjct: 559 FK-----QSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPC 613

Query: 354 DSSDPNSGIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVT 413
           + +                         G           +  +D+S N  SG IP E+ 
Sbjct: 614 NITSRV--------------------YGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIG 653

Query: 414 NLQGLQSLNLSHNLFTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSN 473
           ++  L  LNL HN  +G IPD +G +R +  LD S+N+L G+IPQ+MS L+ L  ++LSN
Sbjct: 654 SMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSN 713

Query: 474 NNLNGEIPSSTQLQSFGASSFAGND-LCGAPLSNC 507
           NNL+G IP   Q ++F  + F  N  LCG PL  C
Sbjct: 714 NNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query596
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.44
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.29
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.17
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.83
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.59
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.16
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.03
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.47
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 88.97
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 87.96
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 85.44
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 84.88
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-59  Score=519.70  Aligned_cols=496  Identities=30%  Similarity=0.433  Sum_probs=362.9

Q ss_pred             eeecCCCccccCCccccCCCCCCEEECcCCcccccCCccCcCCCCCCEEECcCCcCccccChhhhhcCCCCcEEEccCCe
Q 044353            2 LFLRRSQFYGHLTNQLGRFKTLRALDLSNNTVNGPIPLSLGQIANLEYLDLSNNKLNGTVSEIHFLNLTQLLVFRAHGNS   81 (596)
Q Consensus         2 l~L~~n~l~~~~~~~l~~l~~L~~L~ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~~l~~L~~L~L~~n~   81 (596)
                      |+|++|++++.+|. ++++++|++|++++|.+++.+|..+..+++|++|++++|++++.++..   .+++|++|++++|.
T Consensus       205 L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~---~l~~L~~L~L~~n~  280 (768)
T 3rgz_A          205 LDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL---PLKSLQYLSLAENK  280 (768)
T ss_dssp             EECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC---CCTTCCEEECCSSE
T ss_pred             EECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc---ccCCCCEEECcCCc
Confidence            67888888877776 888888888888888888777888888888888888888887666642   77888888888888


Q ss_pred             eeeEeCCCCCCC-CCccEEEccCCCCCCCcchhhcCCCCCcEEEcccCcCcccCChhHHhcCCCCcEEEcccccccccCC
Q 044353           82 LVFKINPNWVPP-FQLAFLELRSCHLGPRFPLWLQSQKKLYYLDISSTRISAKIPRGFWNSIFQYDYLNVSGNQIYGGVP  160 (596)
Q Consensus        82 l~~~~~~~~~~l-~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~i~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~  160 (596)
                      +++..+..+... ++|++|++++|++.+..|..++++++|++|++++|.+++.+|...+..+++|++|++++|++++..|
T Consensus       281 l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p  360 (768)
T 3rgz_A          281 FTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP  360 (768)
T ss_dssp             EEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCC
T ss_pred             cCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCcccc
Confidence            887777777664 8899999999988888888888899999999999988888887766668889999999998887776


Q ss_pred             CCCCCCCCccccCCCCCceEEcccCccccccccccccCCCCCCCccEEeCcCCcCCCCCCcccCCCCCCcEEEccccccc
Q 044353          161 KFDSPSVPLITTPSLLGSIFDLSNNALSGSIFHLICQGENFSKNIEFLKLSKNHFSEDIPDCWMNWPRLRMLNLGNNNFT  240 (596)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~l~ls~n~l~~~~~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~  240 (596)
                      ..+.....       .-+.+++++|.+.+..+..++.  ..+++|++|++++|.+.+.+|..+..+++|++|++++|.++
T Consensus       361 ~~l~~l~~-------~L~~L~Ls~N~l~~~~~~~~~~--~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~  431 (768)
T 3rgz_A          361 ESLTNLSA-------SLLTLDLSSNNFSGPILPNLCQ--NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS  431 (768)
T ss_dssp             TTHHHHTT-------TCSEEECCSSEEEEECCTTTTC--STTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEE
T ss_pred             HHHHhhhc-------CCcEEEccCCCcCCCcChhhhh--cccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCccc
Confidence            65432210       0155666666666554433321  11345666666666666566666666666666666666666


Q ss_pred             ccCCccCcCCCCCcEEEccCCcccccCChhhcCCCCCCEEEccCCcccccCchhhhhhcccccEEEccCCcCcCcCCccc
Q 044353          241 GSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQL  320 (596)
Q Consensus       241 ~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~  320 (596)
                      +..|..+..+++|+.|++++|.+.+..|..+..+++|++|++++|++.+.+|..+. .+++|++|++++|.+++.+|..+
T Consensus       432 ~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~-~l~~L~~L~L~~N~l~~~~p~~~  510 (768)
T 3rgz_A          432 GTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS-NCTNLNWISLSNNRLTGEIPKWI  510 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGG-GCTTCCEEECCSSCCCSCCCGGG
T ss_pred             CcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHh-cCCCCCEEEccCCccCCcCChHH
Confidence            66666666666666666666666666666666666666666666666655555554 56666666666666666666666


Q ss_pred             CCCCCCcEEeCCCCcCcccCCccccccccCcccCCCCCCCCcccc-CCCC------------Ccee--------------
Q 044353          321 CRLGSLQILDVAYNSLSGTIPRCINNFSAMATTDSSDPNSGIFYA-SSGD------------NEIV--------------  373 (596)
Q Consensus       321 ~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~l~l~~~~~~~~~~-~~~~------------~~~~--------------  373 (596)
                      +.+++|++|++++|++++.+|..+.+++.|+.++++.+...-..+ ....            ..+.              
T Consensus       511 ~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  590 (768)
T 3rgz_A          511 GRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGA  590 (768)
T ss_dssp             GGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSS
T ss_pred             hcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccc
Confidence            666666666666666666666666666666666665543210000 0000            0000              


Q ss_pred             -----------------------eeeEEEeccceeecccccccccEEEccCCcccccCCccccCcccCCeeeccCccCcc
Q 044353          374 -----------------------EDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTG  430 (596)
Q Consensus       374 -----------------------~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~  430 (596)
                                             ........+..+..+..+++|+.||+++|.+++.+|..++.+++|+.|+|++|+++|
T Consensus       591 ~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g  670 (768)
T 3rgz_A          591 GNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG  670 (768)
T ss_dssp             EEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             ccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCC
Confidence                                   000011223334455678899999999999999999999999999999999999999


Q ss_pred             cCCccccCCCCCCEEECCCCcCcccCCccccCCCCCCEEecccccCccCCCCCCccCccccccccCCC-CCCCCCCCCCC
Q 044353          431 RIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGND-LCGAPLSNCTE  509 (596)
Q Consensus       431 ~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~ls~N~l~~~~~~~~~~~~l~~~~~~~n~-lc~~~~~~c~~  509 (596)
                      .+|+.++.+++|+.|||++|++++.+|..+..++.|++||+++|+++|.+|...++.++...++.||| +||.|+..|..
T Consensus       671 ~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~  750 (768)
T 3rgz_A          671 SIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDP  750 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCS
T ss_pred             CCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999 99999888864


Q ss_pred             CC
Q 044353          510 KN  511 (596)
Q Consensus       510 ~~  511 (596)
                      ..
T Consensus       751 ~~  752 (768)
T 3rgz_A          751 SN  752 (768)
T ss_dssp             CC
T ss_pred             Cc
Confidence            43



>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 596
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 9e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 9e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 89.4 bits (220), Expect = 3e-20
 Identities = 68/262 (25%), Positives = 111/262 (42%), Gaps = 6/262 (2%)

Query: 253 LMSLNLRNNRLSGI--IPTSFRNLSILKALDMGENELVGNIPTWIGETFSRLMILNLRSN 310
           + +L+L    L     IP+S  NL  L  L +G    +           ++L  L +   
Sbjct: 52  VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHT 111

Query: 311 KFHGDFPIQLCRLGSLQILDVAYNSLSGTIPRCINNFSAMATTD-SSDPNSGIFYASSGD 369
              G  P  L ++ +L  LD +YN+LSGT+P  I++   +       +  SG    S G 
Sbjct: 112 NVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGS 171

Query: 370 NEIVEDALLVTKGFLVE--YNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNL 427
              +  ++ +++  L      +  NL  +      N        +               
Sbjct: 172 FSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKN 231

Query: 428 FTGRIPDNIGVMRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQ 487
                   +G+ +++  LD   N++ G +PQ ++ L FL+ LN+S NNL GEIP    LQ
Sbjct: 232 SLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQ 291

Query: 488 SFGASSFAGND-LCGAPLSNCT 508
            F  S++A N  LCG+PL  CT
Sbjct: 292 RFDVSAYANNKCLCGSPLPACT 313


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query596
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.75
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.61
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.19
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.77
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=3.1e-31  Score=260.68  Aligned_cols=259  Identities=32%  Similarity=0.579  Sum_probs=236.4

Q ss_pred             CCccEEeCcCCcCCC--CCCcccCCCCCCcEEEccc-ccccccCCccCcCCCCCcEEEccCCcccccCChhhcCCCCCCE
Q 044353          203 KNIEFLKLSKNHFSE--DIPDCWMNWPRLRMLNLGN-NNFTGSLPMSIGALNSLMSLNLRNNRLSGIIPTSFRNLSILKA  279 (596)
Q Consensus       203 ~~L~~L~l~~n~l~~--~~~~~~~~l~~L~~L~l~~-n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~  279 (596)
                      .+++.|+++++.+.+  .+|..++++++|++|++++ |.+++.+|..|.++++|++|+|++|++.+..+..+..+++|+.
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~  129 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVT  129 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCE
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcc
Confidence            479999999999987  4788999999999999987 7899899999999999999999999999999999999999999


Q ss_pred             EEccCCcccccCchhhhhhcccccEEEccCCcCcCcCCcccCCCCCC-cEEeCCCCcCcccCCccccccccCcccCCCCC
Q 044353          280 LDMGENELVGNIPTWIGETFSRLMILNLRSNKFHGDFPIQLCRLGSL-QILDVAYNSLSGTIPRCINNFSAMATTDSSDP  358 (596)
Q Consensus       280 L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~l~~n~l~~~~~~~~~~l~~L~~l~l~~~  358 (596)
                      +++++|.+.+.+|..+. .++.++.+++++|.+.+.+|..+..+..+ +.+++++|++++..|..+..+.          
T Consensus       130 l~l~~N~~~~~~p~~l~-~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~----------  198 (313)
T d1ogqa_         130 LDFSYNALSGTLPPSIS-SLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN----------  198 (313)
T ss_dssp             EECCSSEEESCCCGGGG-GCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC----------
T ss_pred             cccccccccccCchhhc-cCcccceeeccccccccccccccccccccccccccccccccccccccccccc----------
Confidence            99999999888888887 79999999999999998999988888776 8999999999988887765432          


Q ss_pred             CCCccccCCCCCceeeeeEEEeccceeecccccccccEEEccCCcccccCCccccCcccCCeeeccCccCcccCCccccC
Q 044353          359 NSGIFYASSGDNEIVEDALLVTKGFLVEYNSILNLVRSIDISKNNFSGEIPVEVTNLQGLQSLNLSHNLFTGRIPDNIGV  438 (596)
Q Consensus       359 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~  438 (596)
                                                         ...++++++...+.+|..+..+++++.+++++|.+.+.++ .++.
T Consensus       199 -----------------------------------~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~  242 (313)
T d1ogqa_         199 -----------------------------------LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGL  242 (313)
T ss_dssp             -----------------------------------CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCC
T ss_pred             -----------------------------------cccccccccccccccccccccccccccccccccccccccc-cccc
Confidence                                               3468899999999999999999999999999999986655 5888


Q ss_pred             CCCCCEEECCCCcCcccCCccccCCCCCCEEecccccCccCCCCCCccCccccccccCCC-CCCCCCCCCC
Q 044353          439 MRSIESLDFSANQLSGQIPQSMSNLSFLNYLNLSNNNLNGEIPSSTQLQSFGASSFAGND-LCGAPLSNCT  508 (596)
Q Consensus       439 l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~ls~N~l~~~~~~~~~~~~l~~~~~~~n~-lc~~~~~~c~  508 (596)
                      +++|+.|+|++|++++.+|+.+.++++|++|+|++|+++|.+|....+..++.+.+.+|+ +||.|+..|+
T Consensus       243 ~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         243 SKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             CTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSSCCC
T ss_pred             ccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCCCCC
Confidence            999999999999999999999999999999999999999999988889999999999999 9999988784



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure