Citrus Sinensis ID: 044411

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MSSLNDRIGFGLSVTGEFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDIDTYMKTDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAEGKILYHGPRKVCPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDMFHKKFKESPFGKKLEEDLSELYDKSESKKRSVSFAVFSLSRWEVFKACMSRELLLAKRNYFLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLERLAVFYKQKE
cccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHcccccHHHHHHHHccHHHHHccccccccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHcEEEEcccEEEEEccccccccccccHHHHHHHccHHHHHHHHcccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ccEEccEcccccEEccccEccEEEEEEEccccccccEEEEEHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccEEEEEEHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHccccEEEEcccccccccccHcHHHHHHcccHHHHHHcccccccEEEEEHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEEEEcc
msslndrigfglsvtgefvpqkLSAYVSQydlhipemtvretldfstycqgvgsRADILLELsgreeeariipdpdidtymktdynlkilgldicadtLVGDAIRRgisggqkrrlttgemlvGPIKAMFMDKitngldistsFQIVTCLQHLAHITDATILISllqpspetfdlFDDIILMAEGkilyhgprkvcpdrKAVADFVLEVISRkdqaqywfhnelphsfvpvdmfhkkfkespfgkklEEDLSELYdkseskkrsVSFAVFSLSRWEVFKACMSRELLLAKRNYFLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLERLAVFYKQKE
msslndrigfglsvtgefvpQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLElsgreeeariipdpdidtyMKTDYNLKILGLDICADTLVGDAIRrgisggqkrrlttgemLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAEGKILyhgprkvcpDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDMFHKKFKESPFGKKLEEDLSELydkseskkrsvSFAVFSLSRWEVFKACMSRELLLAKRNYFLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLERLAVFYKQKE
MSSLNDRIGFGLSVTGEFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDIDTYMKTDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAEGKILYHGPRKVCPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDMFHKKFKESPFGKKLEEDLSELYDKSESKKRSVSFAVFSLSRWEVFKACMSRELLLAKRNYFLYLFKtiqiiiiatmtmtLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLERLAVFYKQKE
*******IGFGLSVTGEFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDIDTYMKTDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAEGKILYHGPRKVCPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDMFHKKF**************************VSFAVFSLSRWEVFKACMSRELLLAKRNYFLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLERLAVFY****
MSSLNDRIGFGLSVTGEFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGV*****************RIIPDPDIDTYMKTDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAEGKILYHGPRKVCPDRKAVADFVLEVISRKDQ************FVPVDMFHKKFKESPFGKKLE*************************RWEVFKACMSRELLLAKRNYFLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLERLAVFYKQ**
MSSLNDRIGFGLSVTGEFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDIDTYMKTDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAEGKILYHGPRKVCPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDMFHKKFKESPFGKKLEEDLSEL*********SVSFAVFSLSRWEVFKACMSRELLLAKRNYFLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLERLAVFYKQKE
MSSLNDRIGFGLSVTGEFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDIDTYMKTDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAEGKILYHGPRKVCPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDMFHKKFKESPFGKKLEEDLSELYDKSESKKRSVSFAVFSLSRWEVFKACMSRELLLAKRNYFLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLERLAVFYKQK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLNDRIGFGLSVTGEFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDIDTYMKTDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAEGKILYHGPRKVCPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDMFHKKFKESPFGKKLEEDLSELYDKSESKKRSVSFAVFSLSRWEVFKACMSRELLLAKRNYFLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLERLAVFYKQKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query363 2.2.26 [Sep-21-2011]
Q5W274 1447 Pleiotropic drug resistan N/A no 0.955 0.239 0.672 1e-146
Q9ZUT8 1413 ABC transporter G family yes no 0.969 0.249 0.611 1e-138
Q9LFH0 1450 ABC transporter G family no no 0.955 0.239 0.621 1e-137
Q7PC83 1397 ABC transporter G family no no 0.991 0.257 0.563 1e-125
Q7PC81 1390 ABC transporter G family no no 0.955 0.249 0.578 1e-124
Q8GZ52 1400 ABC transporter G family no no 0.955 0.247 0.570 1e-123
Q7PC82 1392 ABC transporter G family no no 0.955 0.249 0.575 1e-121
O24367 1441 Pleiotropic drug resistan N/A no 0.955 0.240 0.529 1e-112
Q2PCF1 1461 Pleiotropic drug resistan N/A no 0.955 0.237 0.528 1e-111
Q7PC86 1442 ABC transporter G family no no 0.955 0.240 0.539 1e-111
>sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 Back     alignment and function desciption
 Score =  518 bits (1334), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 249/370 (67%), Positives = 299/370 (80%), Gaps = 23/370 (6%)

Query: 17  EFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPD 76
           EFVPQK SAYVSQ DLHIPEMTVRETLD+S+  QGVGSRA+I+ +LS RE+EA ++PDPD
Sbjct: 241 EFVPQKTSAYVSQNDLHIPEMTVRETLDYSSRFQGVGSRAEIMTDLSRREKEAGVVPDPD 300

Query: 77  IDTYMK------------TDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVG 124
           IDTYMK            TDY LKILGLDICADTLVGDA+RRGISGGQK+RLTTGE++VG
Sbjct: 301 IDTYMKAISIEGQKKNLQTDYILKILGLDICADTLVGDAMRRGISGGQKKRLTTGELIVG 360

Query: 125 PIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAE 184
           PIKA+FMD+I+NGLD ST++QIV CLQ LAHITDATIL+SLLQP+PETFDLFDDIILMAE
Sbjct: 361 PIKALFMDEISNGLDSSTTYQIVACLQQLAHITDATILVSLLQPAPETFDLFDDIILMAE 420

Query: 185 GKILYHGPRKV-----------CPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDM 233
           GKILYHGPR             CP+RK VADF+ EV S+KDQAQYW   +  + FV VDM
Sbjct: 421 GKILYHGPRNSALEFFESCGFKCPERKGVADFLQEVTSKKDQAQYWHGTKETYKFVSVDM 480

Query: 234 FHKKFKESPFGKKLEEDLSELYDKSESKKRSVSFAVFSLSRWEVFKACMSRELLLAKRNY 293
             +KFKESP+ KKL E+LS  YD S S + S++F  +SL +WE+F+ACMSRE LL KRN 
Sbjct: 481 LSRKFKESPYRKKLNEELSVPYDNSRSHRNSITFRDYSLPKWELFRACMSREFLLMKRNS 540

Query: 294 FLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLE 353
           F+Y+FKT+Q+ IIA++TMT+FLRT M+ D+ HANY++G+LFYAL+IL+VDG  E+ MT+ 
Sbjct: 541 FIYIFKTVQLAIIASITMTVFLRTRMDTDLVHANYYLGALFYALIILLVDGFPELSMTIT 600

Query: 354 RLAVFYKQKE 363
           RLAVFYKQ E
Sbjct: 601 RLAVFYKQSE 610
May be a general defense protein.
Nicotiana tabacum (taxid: 4097)
>sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 Back     alignment and function description
>sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 Back     alignment and function description
>sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 Back     alignment and function description
>sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 Back     alignment and function description
>sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 Back     alignment and function description
>sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1 Back     alignment and function description
>sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 Back     alignment and function description
>sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
296089838 1406 unnamed protein product [Vitis vinifera] 0.955 0.246 0.672 1e-145
225450466 1448 PREDICTED: pleiotropic drug resistance p 0.955 0.239 0.672 1e-145
75321780 1447 RecName: Full=Pleiotropic drug resistanc 0.955 0.239 0.672 1e-144
224099040 1476 predicted protein [Populus trichocarpa] 0.994 0.244 0.619 1e-144
224109722 1406 predicted protein [Populus trichocarpa] 0.955 0.246 0.648 1e-141
356565445 1452 PREDICTED: pleiotropic drug resistance p 0.955 0.238 0.648 1e-141
224099038 1459 predicted protein [Populus trichocarpa] 0.969 0.241 0.640 1e-141
224132634 1250 predicted protein [Populus trichocarpa] 0.955 0.277 0.645 1e-141
359477643 1492 PREDICTED: pleiotropic drug resistance p 0.991 0.241 0.614 1e-140
297736800 1486 unnamed protein product [Vitis vinifera] 0.991 0.242 0.614 1e-140
>gi|296089838|emb|CBI39657.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  522 bits (1345), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 249/370 (67%), Positives = 301/370 (81%), Gaps = 23/370 (6%)

Query: 17  EFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPD 76
           EFVPQK SAY+SQYDLHIPEMTVRET+DFS  CQGVGSRA+ + E+S RE++A I+PDPD
Sbjct: 196 EFVPQKTSAYISQYDLHIPEMTVRETIDFSARCQGVGSRAETMSEVSRREKQAGIVPDPD 255

Query: 77  IDTYMK------------TDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVG 124
           IDTYMK            TDY LKILGLDICADT+VGDA+RRGISGGQK+RLTTGEM+VG
Sbjct: 256 IDTYMKAISVEGLKRTLQTDYILKILGLDICADTMVGDAMRRGISGGQKKRLTTGEMIVG 315

Query: 125 PIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAE 184
           P +A+FMD+I+NGLD ST+FQIV  L+ L HI DATIL+SLLQP+PETFDLFDDIILMAE
Sbjct: 316 PTRALFMDEISNGLDSSTTFQIVAYLRQLVHIIDATILVSLLQPAPETFDLFDDIILMAE 375

Query: 185 GKILYHGPRK-----------VCPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDM 233
           G I+YHGP              CP+RK VADF+ EVISR+DQAQYW+H E  HS+V V  
Sbjct: 376 GIIVYHGPCSHILEFFEDCGFRCPERKGVADFLQEVISRRDQAQYWYHTEQAHSYVSVHT 435

Query: 234 FHKKFKESPFGKKLEEDLSELYDKSESKKRSVSFAVFSLSRWEVFKACMSRELLLAKRNY 293
           F +KFKESPFGKKLEE LS+ +DKS S K ++SF+ +SLS+WE+F+ACMSRE LL KRN 
Sbjct: 436 FSRKFKESPFGKKLEEKLSKPFDKSHSHKNALSFSKYSLSKWELFRACMSREFLLMKRNS 495

Query: 294 FLYLFKTIQIIIIATMTMTLFLRTGMEVDVFHANYFMGSLFYALVILIVDGISEIPMTLE 353
           F+Y+FK+ Q++IIA +TMT+FLRT M+VD+ HANY++GSLFYALVIL+VDG  E+ MT+ 
Sbjct: 496 FIYVFKSTQLVIIAAITMTVFLRTRMDVDIIHANYYLGSLFYALVILLVDGFPELSMTVS 555

Query: 354 RLAVFYKQKE 363
           RL VFYKQ++
Sbjct: 556 RLPVFYKQRD 565

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225450466|ref|XP_002280231.1| PREDICTED: pleiotropic drug resistance protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|75321780|sp|Q5W274.1|PDR3_TOBAC RecName: Full=Pleiotropic drug resistance protein 3; AltName: Full=NtPDR3 gi|55056942|emb|CAH39853.1| PDR-like ABC transporter [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224099040|ref|XP_002311359.1| predicted protein [Populus trichocarpa] gi|222851179|gb|EEE88726.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224109722|ref|XP_002333208.1| predicted protein [Populus trichocarpa] gi|222835114|gb|EEE73549.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356565445|ref|XP_003550950.1| PREDICTED: pleiotropic drug resistance protein 3-like [Glycine max] Back     alignment and taxonomy information
>gi|224099038|ref|XP_002311358.1| predicted protein [Populus trichocarpa] gi|222851178|gb|EEE88725.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132634|ref|XP_002321371.1| predicted protein [Populus trichocarpa] gi|222868367|gb|EEF05498.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359477643|ref|XP_002266393.2| PREDICTED: pleiotropic drug resistance protein 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736800|emb|CBI26001.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
TAIR|locus:2037703 1442 ABCG35 "ATP-binding cassette G 0.955 0.240 0.514 3.5e-96
TAIR|locus:2049867 1413 ABCG33 "ATP-binding cassette G 0.779 0.200 0.598 4.5e-94
TAIR|locus:2084081 1450 ABCG37 "ATP-binding cassette G 0.779 0.195 0.602 1.2e-93
TAIR|locus:2025931 1469 PEN3 "PENETRATION 3" [Arabidop 0.955 0.236 0.495 5.8e-92
TAIR|locus:2094952 1416 ABCG29 "ATP-binding cassette G 0.969 0.248 0.490 2.6e-91
TAIR|locus:2019693 1454 ABCG39 "ATP-binding cassette G 0.955 0.238 0.509 6.6e-91
TAIR|locus:2044893 1453 ABCG34 "ATP-binding cassette G 0.955 0.238 0.501 2.1e-88
TAIR|locus:2196593 1423 ABCG40 "ATP-binding cassette G 0.969 0.247 0.480 3.3e-85
TAIR|locus:2039523 1420 ABCG32 "ATP-binding cassette G 0.955 0.244 0.450 1.8e-80
TAIR|locus:2045683 1426 ABCG31 "ATP-binding cassette G 0.955 0.243 0.440 2.7e-78
TAIR|locus:2037703 ABCG35 "ATP-binding cassette G35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 962 (343.7 bits), Expect = 3.5e-96, P = 3.5e-96
 Identities = 191/371 (51%), Positives = 256/371 (69%)

Query:    17 EFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPD 76
             EFVP K SAY+SQ DLH+  MTV+ETLDFS  CQGVG+R D+L EL+ RE++A I P+ D
Sbjct:   238 EFVPIKTSAYISQNDLHVGIMTVKETLDFSARCQGVGTRYDLLNELARREKDAGIFPEAD 297

Query:    77 IDTYMK------------TDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVG 124
             +D +MK            TDY LKILGLDIC DT+VGD + RGISGGQK+R+TTGEM+VG
Sbjct:   298 VDLFMKASAAQGVKSSLITDYTLKILGLDICKDTIVGDDMMRGISGGQKKRVTTGEMIVG 357

Query:   125 PIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAE 184
             P K +FMD+I+ GLD ST+FQIV CLQ + H+T+AT+LISLLQP+PETFDLFDDIIL++E
Sbjct:   358 PTKTLFMDEISTGLDSSTTFQIVKCLQQIVHLTEATVLISLLQPAPETFDLFDDIILLSE 417

Query:   185 GKILYHGPRK-----------VCPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDM 233
             G+I+Y GPR             CP+RK  ADF+ EV S+KDQ QYW     P+ ++PV  
Sbjct:   418 GQIVYQGPRDHILEFFESFGFKCPERKGTADFLQEVTSKKDQEQYWVDPNRPYRYIPVSE 477

Query:   234 FHKKFKESPFGKKLEEDLSELYDKSESKKRSVSFAVFSLSRWEVFKACMSRELLLAKRNY 293
             F   FK+   G KL  +LS  YDKS+S K ++ F  +S+ + E+ K+C  +E +L KRN 
Sbjct:   478 FASSFKKFHVGSKLSNELSVPYDKSKSHKAALMFDKYSIKKTELLKSCWDKEWMLMKRNS 537

Query:   294 FLYLFKXXXXXXXXXXXXXLFLRTGMEV-DVFHANYFMGSLFYALVILIVDGISEIPMTL 352
             F Y+FK             L+LRT M   +   AN ++GSL +A+++ + +G++E+ MT+
Sbjct:   538 FFYVFKTVQIIIIAAITSTLYLRTEMHTRNEIDANIYVGSLLFAMIVNMFNGLAEMAMTI 597

Query:   353 ERLAVFYKQKE 363
             +RL VFYKQ++
Sbjct:   598 QRLPVFYKQRD 608
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0016020 "membrane" evidence=IEA;IDA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
GO:0006855 "drug transmembrane transport" evidence=ISS
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0016132 "brassinosteroid biosynthetic process" evidence=RCA
GO:0052541 "plant-type cell wall cellulose metabolic process" evidence=RCA
GO:0052546 "cell wall pectin metabolic process" evidence=RCA
TAIR|locus:2049867 ABCG33 "ATP-binding cassette G33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084081 ABCG37 "ATP-binding cassette G37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025931 PEN3 "PENETRATION 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094952 ABCG29 "ATP-binding cassette G29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019693 ABCG39 "ATP-binding cassette G39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044893 ABCG34 "ATP-binding cassette G34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196593 ABCG40 "ATP-binding cassette G40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039523 ABCG32 "ATP-binding cassette G32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045683 ABCG31 "ATP-binding cassette G31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00022529001
SubName- Full=Chromosome chr14 scaffold_27, whole genome shotgun sequence; (864 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 1e-150
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 3e-80
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 2e-44
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 1e-31
cd03234226 cd03234, ABCG_White, White pigment protein homolog 6e-29
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 5e-25
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 2e-22
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 3e-20
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 2e-19
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 4e-17
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 3e-15
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 2e-09
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 8e-07
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 1e-06
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-06
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 5e-06
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 5e-06
pfam01061 210 pfam01061, ABC2_membrane, ABC-2 type transporter 8e-06
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 6e-05
COG4987573 COG4987, CydC, ABC-type transport system involved 7e-05
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 8e-05
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 1e-04
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 1e-04
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 2e-04
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 2e-04
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 3e-04
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 4e-04
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 4e-04
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 4e-04
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 5e-04
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 5e-04
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 6e-04
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 7e-04
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 8e-04
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 0.001
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 0.001
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 0.001
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 0.001
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 0.001
COG4988559 COG4988, CydD, ABC-type transport system involved 0.002
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 0.002
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 0.002
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 0.002
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 0.004
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 0.004
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 0.004
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information 
 Score =  458 bits (1180), Expect = e-150
 Identities = 193/382 (50%), Positives = 271/382 (70%), Gaps = 33/382 (8%)

Query: 9   GFGLSVTGEFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEE 68
           G+ L+   EFVP+K SAY+SQ D+H+  MTV+ETLDFS  CQGVG+R D+L EL+ RE++
Sbjct: 229 GYRLN---EFVPRKTSAYISQNDVHVGVMTVKETLDFSARCQGVGTRYDLLSELARREKD 285

Query: 69  ARIIPDPDIDTYMK------------TDYNLKILGLDICADTLVGDAIRRGISGGQKRRL 116
           A I P+ ++D +MK            TDY LKILGLDIC DT+VGD + RGISGGQK+R+
Sbjct: 286 AGIFPEAEVDLFMKATAMEGVKSSLITDYTLKILGLDICKDTIVGDEMIRGISGGQKKRV 345

Query: 117 TTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLF 176
           TTGEM+VGP K +FMD+I+ GLD ST++QIV CLQ + H+T+AT+L+SLLQP+PETFDLF
Sbjct: 346 TTGEMIVGPTKTLFMDEISTGLDSSTTYQIVKCLQQIVHLTEATVLMSLLQPAPETFDLF 405

Query: 177 DDIILMAEGKILYHGPRK-----------VCPDRKAVADFVLEVISRKDQAQYWFHNELP 225
           DDIIL++EG+I+Y GPR             CP+RK  ADF+ EV S+KDQ QYW     P
Sbjct: 406 DDIILLSEGQIVYQGPRDHILEFFESCGFKCPERKGTADFLQEVTSKKDQEQYWADRNKP 465

Query: 226 HSFVPVDMFHKKFKESPFGKKLEEDLSELYDKSESKKRSVSFAVFSLSRWEVFKACMSRE 285
           + ++ V  F ++FK    G +LE +LS  +DKS+S K ++ F+ +S+ + E+ KAC  +E
Sbjct: 466 YRYISVSEFAERFKSFHVGMQLENELSVPFDKSQSHKAALVFSKYSVPKMELLKACWDKE 525

Query: 286 LLLAKRNYFLYLFKTIQIIIIATMTMTLFLRTGM----EVDVFHANYFMGSLFYALVILI 341
            LL KRN F+Y+FKT+QIII+A +  T+FLRT M    E D      ++G+L ++++I +
Sbjct: 526 WLLMKRNAFVYVFKTVQIIIVAAIASTVFLRTEMHTRNEED---GALYIGALLFSMIINM 582

Query: 342 VDGISEIPMTLERLAVFYKQKE 363
            +G +E+ + ++RL VFYKQ++
Sbjct: 583 FNGFAELALMIQRLPVFYKQRD 604

Length = 1470
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 363
PLN03140 1470 ABC transporter G family member; Provisional 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
PLN03211 659 ABC transporter G-25; Provisional 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.97
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.97
COG1127263 Ttg2A ABC-type transport system involved in resist 99.97
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.97
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.97
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.97
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.97
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.97
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.97
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.97
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.97
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.97
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.97
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.97
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.97
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.97
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.97
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.97
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.96
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.96
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.96
COG0410237 LivF ABC-type branched-chain amino acid transport 99.96
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.96
COG0411250 LivG ABC-type branched-chain amino acid transport 99.96
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.96
PRK13537306 nodulation ABC transporter NodI; Provisional 99.96
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.96
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.96
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.96
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.96
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.96
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.96
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.95
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.95
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.95
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.95
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.95
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.95
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.95
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.95
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.95
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.95
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.95
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.95
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.95
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.95
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.95
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.95
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.95
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.95
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.95
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.95
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.95
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.94
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.94
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.94
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.94
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.94
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.94
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.94
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.94
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.94
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.94
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.94
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.94
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.94
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.94
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.94
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.94
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.94
cd03234226 ABCG_White The White subfamily represents ABC tran 99.94
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.94
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.94
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.94
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.94
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.94
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.94
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.94
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.94
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.94
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.94
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.94
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.94
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.94
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.94
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.94
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.94
PRK09984262 phosphonate/organophosphate ester transporter subu 99.94
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.94
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.94
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.94
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.94
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.94
COG1123 539 ATPase components of various ABC-type transport sy 99.94
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.94
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.93
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.93
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.93
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.93
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.93
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.93
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.93
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.93
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.93
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.93
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.93
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.93
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.93
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.93
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.93
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.93
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK10908222 cell division protein FtsE; Provisional 99.93
COG4181228 Predicted ABC-type transport system involved in ly 99.93
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.93
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.93
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.93
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.93
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.93
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.93
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.93
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.93
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.93
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.93
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.93
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.93
COG4152300 ABC-type uncharacterized transport system, ATPase 99.93
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.93
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.93
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.93
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.93
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.93
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.93
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.92
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.92
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.92
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.92
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.92
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.92
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.92
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.92
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.92
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.92
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.92
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.92
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.92
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.92
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.92
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.92
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.92
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.92
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.92
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.92
COG1123539 ATPase components of various ABC-type transport sy 99.92
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.92
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.92
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.92
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.92
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.92
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.92
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.92
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.92
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.91
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.91
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.91
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.91
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.91
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.91
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.91
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.91
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.91
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.91
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.91
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.91
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.91
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.91
COG4988559 CydD ABC-type transport system involved in cytochr 99.91
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.91
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.91
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.91
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.91
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.91
COG4172534 ABC-type uncharacterized transport system, duplica 99.91
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.91
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.91
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.91
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.91
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.91
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.91
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.9
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.9
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.9
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.9
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.9
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.9
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.9
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.9
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.9
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.9
COG4172 534 ABC-type uncharacterized transport system, duplica 99.9
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.9
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.9
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.9
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.9
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.9
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.9
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.9
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.9
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.9
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.9
COG4559259 ABC-type hemin transport system, ATPase component 99.89
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.89
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.89
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.89
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.89
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.89
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.89
PRK10938 490 putative molybdenum transport ATP-binding protein 99.89
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.89
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.89
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.89
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.89
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.89
PRK13409590 putative ATPase RIL; Provisional 99.89
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.89
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.89
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.89
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.89
COG4987573 CydC ABC-type transport system involved in cytochr 99.89
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.89
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.89
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.89
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.88
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.88
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.88
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.88
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.88
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.88
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.88
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.88
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.88
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.88
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.88
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.88
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.88
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.88
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.88
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.88
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.88
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.88
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.87
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.87
cd03246173 ABCC_Protease_Secretion This family represents the 99.87
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.87
PRK10938490 putative molybdenum transport ATP-binding protein 99.87
COG4619223 ABC-type uncharacterized transport system, ATPase 99.87
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.87
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.87
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.87
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.87
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.86
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.86
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.86
PLN032321495 ABC transporter C family member; Provisional 99.86
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.86
PLN031301622 ABC transporter C family member; Provisional 99.86
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.86
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.86
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.86
PLN03130 1622 ABC transporter C family member; Provisional 99.86
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.85
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.85
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.85
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.85
PLN03232 1495 ABC transporter C family member; Provisional 99.85
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.85
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.85
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.85
PTZ002431560 ABC transporter; Provisional 99.85
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.85
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.85
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.85
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.85
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.84
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.84
COG4586325 ABC-type uncharacterized transport system, ATPase 99.84
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.84
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.84
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.84
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.84
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.83
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.83
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.83
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.83
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.82
PRK11147635 ABC transporter ATPase component; Reviewed 99.82
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.82
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.82
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.82
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.81
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.81
PRK13409 590 putative ATPase RIL; Provisional 99.81
PTZ00243 1560 ABC transporter; Provisional 99.8
PLN03073718 ABC transporter F family; Provisional 99.8
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.79
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.79
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.78
COG4136213 ABC-type uncharacterized transport system, ATPase 99.78
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.77
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.76
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.76
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.75
PRK11147 635 ABC transporter ATPase component; Reviewed 99.75
COG0488 530 Uup ATPase components of ABC transporters with dup 99.75
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 99.74
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 99.74
COG4133209 CcmA ABC-type transport system involved in cytochr 99.73
PLN03073 718 ABC transporter F family; Provisional 99.73
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.73
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.72
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.72
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.71
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.71
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.71
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.71
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.7
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.69
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.69
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.69
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.68
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.66
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.65
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.65
KOG00541381 consensus Multidrug resistance-associated protein/ 99.64
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.64
COG0488530 Uup ATPase components of ABC transporters with dup 99.6
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.6
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.57
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.55
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.53
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.51
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.51
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.49
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.47
KOG0062582 consensus ATPase component of ABC transporters wit 99.46
COG4178604 ABC-type uncharacterized transport system, permeas 99.44
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.42
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.41
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.4
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.39
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.38
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.37
PRK10869553 recombination and repair protein; Provisional 99.35
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 99.33
PHA02562562 46 endonuclease subunit; Provisional 99.31
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.31
KOG0062 582 consensus ATPase component of ABC transporters wit 99.26
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.25
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.19
PRK03918880 chromosome segregation protein; Provisional 99.19
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.17
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.15
PRK01156895 chromosome segregation protein; Provisional 99.14
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.14
PRK102461047 exonuclease subunit SbcC; Provisional 99.13
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.04
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 99.03
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 99.01
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 98.99
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 98.98
PRK00064361 recF recombination protein F; Reviewed 98.98
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.96
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 98.91
PRK02224880 chromosome segregation protein; Provisional 98.91
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 98.88
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 98.76
PRK14079349 recF recombination protein F; Provisional 98.76
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 98.75
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 98.72
TIGR00611365 recf recF protein. All proteins in this family for 98.7
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.66
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 98.64
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 98.52
TIGR026801353 conserved hypothetical protein TIGR02680. Members 98.49
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 98.47
KOG0063 592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.46
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 98.45
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.38
PRK00409 782 recombination and DNA strand exchange inhibitor pr 98.38
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 98.34
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.34
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.22
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 98.22
PRK13695174 putative NTPase; Provisional 98.09
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 98.09
PRK13830818 conjugal transfer protein TrbE; Provisional 97.75
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 97.7
PF01061 210 ABC2_membrane: ABC-2 type transporter; InterPro: I 97.58
cd01128249 rho_factor Transcription termination factor rho is 97.57
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 97.52
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.45
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 97.42
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 97.41
PF13175415 AAA_15: AAA ATPase domain 97.38
COG3910233 Predicted ATPase [General function prediction only 97.37
PRK06067234 flagellar accessory protein FlaH; Validated 97.2
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.18
KOG09641200 consensus Structural maintenance of chromosome pro 97.14
PRK13891852 conjugal transfer protein TrbE; Provisional 97.04
COG4637373 Predicted ATPase [General function prediction only 96.99
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 96.97
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 96.87
COG11961163 Smc Chromosome segregation ATPases [Cell division 96.84
PF13166712 AAA_13: AAA domain 96.13
PRK13873811 conjugal transfer ATPase TrbE; Provisional 96.05
PRK07721438 fliI flagellum-specific ATP synthase; Validated 96.04
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 95.88
KOG09331174 consensus Structural maintenance of chromosome pro 95.77
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 95.72
PRK05399854 DNA mismatch repair protein MutS; Provisional 95.57
PF09818448 ABC_ATPase: Predicted ATPase of the ABC class; Int 95.44
TIGR00152188 dephospho-CoA kinase. This model produces scores i 94.97
PRK13898800 type IV secretion system ATPase VirB4; Provisional 94.9
KOG09961293 consensus Structural maintenance of chromosome pro 94.88
COG1195363 RecF Recombinational DNA repair ATPase (RecF pathw 94.76
PRK06793432 fliI flagellum-specific ATP synthase; Validated 94.7
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.68
KOG09621294 consensus DNA repair protein RAD50, ABC-type ATPas 93.67
PRK14088440 dnaA chromosomal replication initiation protein; P 93.46
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 92.93
PRK08699325 DNA polymerase III subunit delta'; Validated 92.84
KOG00181141 consensus Structural maintenance of chromosome pro 92.6
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 92.26
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 91.41
smart00382148 AAA ATPases associated with a variety of cellular 91.23
COG4694758 Uncharacterized protein conserved in bacteria [Fun 90.81
PF135141111 AAA_27: AAA domain 90.18
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 90.06
PRK04296190 thymidine kinase; Provisional 88.9
COG3044554 Predicted ATPase of the ABC class [General functio 88.5
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 87.46
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 87.18
PRK048631486 mukB cell division protein MukB; Provisional 86.96
PRK13764602 ATPase; Provisional 86.73
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 86.65
TIGR01070840 mutS1 DNA mismatch repair protein MutS. 86.56
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 85.79
COG49131104 Uncharacterized protein conserved in bacteria [Fun 85.54
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 84.98
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 84.93
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 84.53
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.5e-55  Score=481.12  Aligned_cols=345  Identities=54%  Similarity=0.959  Sum_probs=282.8

Q ss_pred             ccceeEEEEccccccCCCCcHHHHHHhhhhhccCCCchhhhhhhcHHHHhhhcCCCCCcc------------hhhhHHHH
Q 044411           19 VPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDID------------TYMKTDYN   86 (363)
Q Consensus        19 ~~~~~~~yv~Q~~~~~~~lTV~E~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~~v~~~   86 (363)
                      .+++.++||+|++.+++.+||+|||.|++.+++.+.+.+...+....++..+..|+.+.+            ....++.+
T Consensus       236 ~~~~~i~yv~Q~d~~~~~lTV~EtL~f~a~~~~~~~~~~~~~~~~~~ek~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~  315 (1470)
T PLN03140        236 VPRKTSAYISQNDVHVGVMTVKETLDFSARCQGVGTRYDLLSELARREKDAGIFPEAEVDLFMKATAMEGVKSSLITDYT  315 (1470)
T ss_pred             cccceeEEecccccCCCcCcHHHHHHHHHHhcCCCCcccchhhcCHHHHhccCCCchhhHHHHHHhhhhcchhhHHHHHH
Confidence            346789999999999999999999999988765432221111222222222222221111            01136789


Q ss_pred             HHHcCCcccccccccCCcCCCCChHHHHHHHHHHHHhCCCcEEEEeCCCCCCCHHhHHHHHHHHHHHhhcCCCEEEEEec
Q 044411           87 LKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLL  166 (363)
Q Consensus        87 l~~lgL~~~~~~~vg~~~~~~LSGGqrqRv~ia~aL~~~P~lLlLDEPtsGLD~~~~~~i~~~l~~l~~~~g~tii~~~h  166 (363)
                      ++.+||++++||.+|+..+++|||||||||+||++|+.+|+++||||||+|||+.++.++++.|+++++..|+|+|+++|
T Consensus       316 L~~lGL~~~~~t~vg~~~~rglSGGerkRVsia~aL~~~p~vlllDEPTsGLDs~t~~~i~~~Lr~la~~~g~Tviis~H  395 (1470)
T PLN03140        316 LKILGLDICKDTIVGDEMIRGISGGQKKRVTTGEMIVGPTKTLFMDEISTGLDSSTTYQIVKCLQQIVHLTEATVLMSLL  395 (1470)
T ss_pred             HHHcCCccccCceeCCccccCCCcccceeeeehhhhcCCCcEEEEeCCCcCccHHHHHHHHHHHHHHHHhcCCEEEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999999999998766899999999


Q ss_pred             CCChHHHhhhcceeeecCCeEEEecCCC-----------CCCCCCChHHHHHHhcCcchhhhhhhcCCCCCCCCChHHHH
Q 044411          167 QPSPETFDLFDDIILMAEGKILYHGPRK-----------VCPDRKAVADFVLEVISRKDQAQYWFHNELPHSFVPVDMFH  235 (363)
Q Consensus       167 ~~~~~~~~~~D~v~vL~~G~iv~~G~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  235 (363)
                      ||.++++++||+|++|++|+++|+|+++           .||++.+++||++++++..++.++|.....|....++++++
T Consensus       396 qp~~~i~~lfD~vilL~~G~ivy~G~~~~~~~yF~~lGf~cP~~~n~ADFl~~v~s~~~~~~~~~~~~~p~~~~~~~~~~  475 (1470)
T PLN03140        396 QPAPETFDLFDDIILLSEGQIVYQGPRDHILEFFESCGFKCPERKGTADFLQEVTSKKDQEQYWADRNKPYRYISVSEFA  475 (1470)
T ss_pred             CCCHHHHHHhheEEEeeCceEEEeCCHHHHHHHHHHcCCCCCCCCChHHHHHHhcCchhhhhhhhccCCccccCCHHHHH
Confidence            9988999999999999999999999976           79999999999999998766555554333343446789999


Q ss_pred             HHHhcChhhhhHHHHHHhhhhcccccccccccccccCcHHHHHHHHHHHHHHHHhhchHHHHHHHHHHHHHHHHHHHHhh
Q 044411          236 KKFKESPFGKKLEEDLSELYDKSESKKRSVSFAVFSLSRWEVFKACMSRELLLAKRNYFLYLFKTIQIIIIATMTMTLFL  315 (363)
Q Consensus       236 ~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~l~~R~~~~~~R~~~~~~~r~~~~~~~~l~~g~~f~  315 (363)
                      ++|+++..++++.++++.+.++...++.......|..++|.|++.|++|++++++||+.++..|+++.+++|+++|++||
T Consensus       476 ~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~s~~~q~~~~~~R~~~~~~Rd~~~~~~r~~~~ii~ali~GsvF~  555 (1470)
T PLN03140        476 ERFKSFHVGMQLENELSVPFDKSQSHKAALVFSKYSVPKMELLKACWDKEWLLMKRNAFVYVFKTVQIIIVAAIASTVFL  555 (1470)
T ss_pred             HHHHhcHHHHHHHHHHhhhhhhhhcccccccCCCCcCCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHh
Confidence            99999988887777766555443333333445678999999999999999999999999999999999999999999999


Q ss_pred             ccCCCcch-hhHHHHHHHHHHHHHHHHHhhhhhhHHHHHhHHhHhhccC
Q 044411          316 RTGMEVDV-FHANYFMGSLFYALVILIVDGISEIPMTLERLAVFYKQKE  363 (363)
Q Consensus       316 ~~~~~~~~-~~~~~~~g~lf~~~~~~~~~~~~~~~~~~~~r~vf~~er~  363 (363)
                      +++.+... .+.+.+.|++||++++.+|+++++++.++.+||||+|||+
T Consensus       556 ~~~~~~~~~~~~~~~~g~lff~~l~~~~~~~~~l~~~~~~r~vf~ker~  604 (1470)
T PLN03140        556 RTEMHTRNEEDGALYIGALLFSMIINMFNGFAELALMIQRLPVFYKQRD  604 (1470)
T ss_pred             cCCCCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccchhHHhhh
Confidence            87654332 2557788999999999999999999999999999999985

>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF01061 ABC2_membrane: ABC-2 type transporter; InterPro: IPR013525 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PF13175 AAA_15: AAA ATPase domain Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK13891 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>COG4637 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PRK13873 conjugal transfer ATPase TrbE; Provisional Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK13898 type IV secretion system ATPase VirB4; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG4694 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG3044 Predicted ATPase of the ABC class [General function prediction only] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>TIGR01070 mutS1 DNA mismatch repair protein MutS Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>COG4913 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 3e-04
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 3e-04
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 5e-04
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 5e-04
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 6e-04
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 6e-04
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 6e-04
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure 
Iteration: 1

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 5/98 (5%)
Query: 97  DTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHI 156
           +T+VG+    G+SGGQ++R+     LV   K +  D+ T+ LD  +   I+  +  +   
Sbjct: 130 NTIVGEQ-GAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKG 188
Query: 157 TDATILISLLQPSPETFDLFDDIILMAEGKILYHGPRK 194
               I+ + L     T    D II+M +GKI+  G  K
Sbjct: 189 RTVIIIAARL----STVKNADRIIVMEKGKIVEQGKHK 222
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 4e-08
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 4e-07
1sgw_A214 Putative ABC transporter; structural genomics, P p 7e-06
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 4e-05
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 1e-04
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score = 52.5 bits (127), Expect = 4e-08
 Identities = 38/176 (21%), Positives = 61/176 (34%), Gaps = 41/176 (23%)

Query: 18  FVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDI 77
           ++P++  AY          M   E L F      V          S  E E  +      
Sbjct: 92  YLPEEAGAY--------RNMQGIEYLRF------VAG----FYASSSSEIEEMV------ 127

Query: 78  DTYMKTDYNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNG 137
                 +   +I GL       V        S G  R+L     L+   +   +D+ T+G
Sbjct: 128 ------ERATEIAGLGEKIKDRVS-----TYSKGMVRKLLIARALMVNPRLAILDEPTSG 176

Query: 138 LDISTSFQIVTCLQHLAHITDATILIS--LLQPSPETFDLFDDIILMAEGKILYHG 191
           LD+  + ++   L+  +     TIL+S   +    E   L D I L+  G I+  G
Sbjct: 177 LDVLNAREVRKILKQASQ-EGLTILVSSHNM---LEVEFLCDRIALIHNGTIVETG 228
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.97
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.97
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 99.97
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.97
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.97
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 99.97
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 99.97
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 99.97
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 99.97
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.97
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.97
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 99.97
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.97
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.97
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.97
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.97
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.96
1g6h_A257 High-affinity branched-chain amino acid transport 99.96
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.96
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.96
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.96
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.96
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.95
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.95
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.95
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.95
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.95
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.94
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.94
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.94
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.94
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.94
2ghi_A260 Transport protein; multidrug resistance protein, M 99.93
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 99.93
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.93
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.92
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.92
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.92
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.92
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.92
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.92
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.91
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.91
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.91
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.91
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.9
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.89
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.89
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.89
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.87
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.87
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.86
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.85
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.85
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.85
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.84
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.83
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.82
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.8
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.8
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.79
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.79
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.79
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.78
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.78
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.76
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 99.76
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.75
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.72
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.67
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.67
3kta_B173 Chromosome segregation protein SMC; structural mai 99.65
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.6
1e69_A322 Chromosome segregation SMC protein; structural mai 99.6
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.6
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.6
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.52
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.48
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.42
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.39
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.35
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.29
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.2
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.12
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.11
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.06
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.04
2og2_A359 Putative signal recognition particle receptor; nuc 99.0
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 98.97
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 98.9
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 98.87
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 98.85
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.83
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 98.77
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 98.77
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.75
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 98.65
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.64
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 98.55
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.49
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.47
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.41
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.37
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.34
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.33
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.32
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.3
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.29
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.26
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.16
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.15
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 98.15
2eyu_A261 Twitching motility protein PILT; pilus retraction 98.14
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.92
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.83
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.79
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 97.71
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.67
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.62
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.49
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.29
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.19
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.09
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.02
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.0
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.98
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.88
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 96.83
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.63
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.21
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 96.09
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 96.05
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 95.63
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.56
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 94.88
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.87
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 93.83
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 93.81
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.52
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.44
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 93.25
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 93.1
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 92.86
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 92.52
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 92.45
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 92.41
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 92.38
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 92.08
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 91.61
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 91.59
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 91.25
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 90.24
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 88.64
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 88.57
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 87.48
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 86.81
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 85.43
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
Probab=99.97  E-value=6.7e-32  Score=257.30  Aligned_cols=149  Identities=19%  Similarity=0.238  Sum_probs=127.1

Q ss_pred             ccceeEEEEccccccCCCCcHHHHHHhhhhhccCCCchhhhhhhcHHHHhhhcCCCCCcchhhhHHHHHHHcCCcccccc
Q 044411           19 VPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDIDTYMKTDYNLKILGLDICADT   98 (363)
Q Consensus        19 ~~~~~~~yv~Q~~~~~~~lTV~E~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~lgL~~~~~~   98 (363)
                      ..++.+|||+|+..++|.+||+||+.|+...++...          .+.            .++++++++.+||.+..++
T Consensus        77 ~~~r~ig~vfQ~~~l~p~ltV~eni~~~l~~~~~~~----------~~~------------~~~v~~~l~~~gL~~~~~r  134 (359)
T 3fvq_A           77 VRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRT----------AQE------------RQRIEAMLELTGISELAGR  134 (359)
T ss_dssp             GGGSCCEEECTTCCCCTTSCHHHHHHTTSTTSSCCS----------HHH------------HHHHHHHHHHHTCGGGTTS
T ss_pred             hhhCCEEEEeCCCcCCCCCCHHHHHHHHHHHcCCCh----------HHH------------HHHHHHHHHHcCCchHhcC
Confidence            346789999999999999999999999765432111          111            1258889999999998887


Q ss_pred             cccCCcCCCCChHHHHHHHHHHHHhCCCcEEEEeCCCCCCCHHhHHHHHHHHHHHhhcCCCEEEEEecCCChHHHhhhcc
Q 044411           99 LVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSPETFDLFDD  178 (363)
Q Consensus        99 ~vg~~~~~~LSGGqrqRv~ia~aL~~~P~lLlLDEPtsGLD~~~~~~i~~~l~~l~~~~g~tii~~~h~~~~~~~~~~D~  178 (363)
                      .++     +|||||||||+|||||+.+|++|||||||+|||+..+..+.+.|+++.++.|.|+|++||+. +++..+|||
T Consensus       135 ~~~-----~LSGGq~QRValArAL~~~P~lLLLDEPts~LD~~~r~~l~~~l~~~~~~~g~tvi~vTHd~-~ea~~~aDr  208 (359)
T 3fvq_A          135 YPH-----ELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDR-EEALQYADR  208 (359)
T ss_dssp             CGG-----GSCHHHHHHHHHHHHHTTCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHTTCEEEEECCCH-HHHHHHCSE
T ss_pred             Chh-----hCCHHHHHHHHHHHHHHcCCCEEEEeCCcccCCHHHHHHHHHHHHHHHHhCCCEEEEEeCCH-HHHHHHCCE
Confidence            765     59999999999999999999999999999999999999999988887766799999988654 689999999


Q ss_pred             eeeecCCeEEEecCCCC
Q 044411          179 IILMAEGKILYHGPRKV  195 (363)
Q Consensus       179 v~vL~~G~iv~~G~~~~  195 (363)
                      |++|++|+++..|++++
T Consensus       209 i~vl~~G~i~~~g~~~e  225 (359)
T 3fvq_A          209 IAVMKQGRILQTASPHE  225 (359)
T ss_dssp             EEEEETTEEEEEECHHH
T ss_pred             EEEEECCEEEEEeCHHH
Confidence            99999999999998864
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 363
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 3e-12
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 1e-11
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 4e-09
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 4e-08
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 7e-08
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 9e-08
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-07
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 2e-07
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 3e-07
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 4e-07
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 4e-07
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 5e-07
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 2e-06
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 2e-06
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 4e-06
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-05
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-05
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 4e-05
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 7e-05
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-04
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]

 Score = 63.3 bits (154), Expect = 3e-12
 Identities = 36/185 (19%), Positives = 66/185 (35%), Gaps = 31/185 (16%)

Query: 25  AYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDIDTYMKTD 84
           + V Q     P MTV E + F    +               E + R+             
Sbjct: 81  SMVFQSYAVWPHMTVYENIAFPLKIKK----------FPKDEIDKRV------------R 118

Query: 85  YNLKILGLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSF 144
           +  ++L ++   +          +SGGQ++R+     +V     + MD+  + LD     
Sbjct: 119 WAAELLQIEELLNRYPAQ-----LSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRV 173

Query: 145 QIVTCLQHLAHITDATILISLLQPSPETFDLFDDIILMAEGKILYHG-PRKV--CPDRKA 201
            +   ++ L      T +        E   + D I +M  G++L  G P +V   P+   
Sbjct: 174 AMRAEIKKLQQKLKVTTIYVTHDQV-EAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVF 232

Query: 202 VADFV 206
           VA F+
Sbjct: 233 VATFI 237
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.98
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.98
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.96
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.96
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.96
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.96
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.95
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.95
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.94
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.89
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.55
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.25
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.84
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.41
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.24
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 97.36
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 93.63
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 92.86
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Sulfate/molybdate ABC transporter, ATP-binding protein
species: Methanosarcina acetivorans [TaxId: 2214]

Probab=100.00  E-value=2.7e-37  Score=273.88  Aligned_cols=154  Identities=22%  Similarity=0.232  Sum_probs=133.0

Q ss_pred             CccccCccccceeEEEEccccccCCCCcHHHHHHhhhhhccCCCchhhhhhhcHHHHhhhcCCCCCcchhhhHHHHHHHc
Q 044411           11 GLSVTGEFVPQKLSAYVSQYDLHIPEMTVRETLDFSTYCQGVGSRADILLELSGREEEARIIPDPDIDTYMKTDYNLKIL   90 (363)
Q Consensus        11 ~~~~~~~~~~~~~~~yv~Q~~~~~~~lTV~E~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~l   90 (363)
                      |.++......++.+|||||++.+||.+||+||+.|+...++...                         .+++.++++.+
T Consensus        61 G~~i~~~~~~~r~ig~v~Q~~~l~~~~tV~enl~~~~~~~~~~~-------------------------~~~~~~~l~~~  115 (229)
T d3d31a2          61 GKDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKD-------------------------PKRVLDTARDL  115 (229)
T ss_dssp             TEECTTSCHHHHTCEEECTTCCCCTTSCHHHHHHHHHHHHCCCC-------------------------HHHHHHHHHHT
T ss_pred             cEeccccchhHhcceeeccccccCccccHHHHHHHHHhhccccH-------------------------HHHHHHHHHHh
Confidence            44554444456789999999999999999999999876543211                         12478889999


Q ss_pred             CCcccccccccCCcCCCCChHHHHHHHHHHHHhCCCcEEEEeCCCCCCCHHhHHHHHHHHHHHhhcCCCEEEEEecCCCh
Q 044411           91 GLDICADTLVGDAIRRGISGGQKRRLTTGEMLVGPIKAMFMDKITNGLDISTSFQIVTCLQHLAHITDATILISLLQPSP  170 (363)
Q Consensus        91 gL~~~~~~~vg~~~~~~LSGGqrqRv~ia~aL~~~P~lLlLDEPtsGLD~~~~~~i~~~l~~l~~~~g~tii~~~h~~~~  170 (363)
                      +|.+..|+.++     .|||||||||+|||||+++|++|||||||+|||+.++..+++.|+++.++.|.|||+++|+ ..
T Consensus       116 ~l~~~~~~~~~-----~LSGG~~QRvaiAraL~~~P~iLllDEPts~LD~~~~~~i~~~l~~l~~~~g~tii~vtHd-~~  189 (229)
T d3d31a2         116 KIEHLLDRNPL-----TLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHITHD-QT  189 (229)
T ss_dssp             TCTTTTTSCGG-----GSCHHHHHHHHHHHHTTSCCSEEEEESSSTTSCHHHHHHHHHHHHHHHHHTTCEEEEEESC-HH
T ss_pred             cchhhHhCChh-----hCCHHHhcchhhhhhhhccCCceeecCCCcCCCHHHHHHHHHHHHHHHhcCCcEEEEEcCC-HH
Confidence            99999887765     5999999999999999999999999999999999999999999999987779999998865 46


Q ss_pred             HHHhhhcceeeecCCeEEEecCCCC
Q 044411          171 ETFDLFDDIILMAEGKILYHGPRKV  195 (363)
Q Consensus       171 ~~~~~~D~v~vL~~G~iv~~G~~~~  195 (363)
                      ++..+||||++|++|++++.|++++
T Consensus       190 ~~~~~~drv~vm~~G~iv~~g~~~e  214 (229)
T d3d31a2         190 EARIMADRIAVVMDGKLIQVGKPEE  214 (229)
T ss_dssp             HHHHHCSEEEEESSSCEEEEECHHH
T ss_pred             HHHHhCCEEEEEECCEEEEEcCHHH
Confidence            8999999999999999999999874
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure