Citrus Sinensis ID: 044491

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460

LAEKFIMNEHESLSKEDRISQLPDGILCHILSFLPIKCALATCILSSRWKFVWTLLPNLCFDERLHMRPVYGQHMGYIFRKDGFCFSEDPNPVFENFVTRVLHLTNPTAIGKFSLDRWALSDLTRFRSWVDSIIMRNVCEIELFLGSHKLVRLPESICTLKTLEVLKLYSDFVIKIPPSGLCFRSLKVLTVVLEYPDNNLTERLFSICPALEDLSIGHLDDKSLINFNISSTTLKRLCLSFTNGVAYSNNWHKVMIATPNLELLNIHDFCMVSYMFHELPPFTKVFIDIFYDDGWSWVQSGRAQRLLNSLTKAKFLALSADTVYALDKIYKDVFPKFPNVTCLAVKVELFGWRLLPIILSSLPNLEEFVFEKKLSCHFEEFGWIEQPNIPLCLLLHVKKIEIKKFEGQKDELGLVKYLLKNCKVLNKVIIRCKETASKENLCQKLDKLQRGSMTCEVEIF

cccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHcccHHHcccccEEEEEccccccccccccccEEEEccccccccccccHHHHHHHHHHcccccccEEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEEEEccccHHHHHHcccccccccEEEcccccccEEEEEEEccEEEEEEEEcccccccccccEEEEEccccEEEEEEccccccEEEEcccccEEEEEEEEEcccccccccccHHHHHccccccEEEEEEccEEEEEEccccccccccccEEEEEEEEEcccccHHHHHHcccccccEEEEEEccccccccccccccccccHHHcccEEEEEEEEEcccHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHcccccccccEEEEc

ccHHHHHHcccccccccHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEcccccccccccEEEcccEEEEEEEcEEEccccccccccHHHEEEEEEEEEccHHHHHHHHHcccHHHEEEEEEccccccEEEEEEccccEEEEEEEcccccccccccEEEEEcccEEEEEEEccccccEEEEcccccEEEEEEEEEccccccccHHHHHHHHHHHHcccEEEEccccHEHHcccccccccccccEEEEEEEcccccHHHHHHHHHccccccEEEEEcccccccccccccccccccHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcEEEEEEcccccHHHHHHHHHcccccccccEEEEc

LAEKFIMNEheslskedrisqlpdgilchilsflPIKCALATCILSSRWKFVWTLlpnlcfderlhmrpvygqhmgyifrkdgfcfsedpnpvfeNFVTRVLHltnptaigkfsldrwalsdltrfrSWVDSIIMRNVCEIELFlgshklvrlpesictlktLEVLKLYSDfvikippsglcfrsLKVLTVVLeypdnnlterlfsicpaledlsighlddkslinfnISSTTLKRLCLSFtngvaysnNWHKVMIatpnlellnihDFCMvsymfhelppftKVFIDIFyddgwswvqSGRAQRLLNSLTKAKFLALSADTVYALDKIykdvfpkfpnvtclAVKVELFGWRLlpiilsslpnleefVFEKKLschfeefgwieqpniplclLLHVKKIEIKKFEGQKDELGLVKYLLKNCKVLNKVIIRCKETASKENLCQKLDklqrgsmtceveif

LAEKFIMNEHESLSKEDRISQLPDGILCHILSFLPIKCALATCILSSRWKFVWTLLPNLCFDERLHMRPVYGQHMGYIFRKDGFCFSEDPNPVFENFVTRVLHLTnptaigkfsldrwaLSDLTRFRSWVDSIIMRNVCEIELFLGSHKLVRLPESICTLKTLEVLKLYSDFVIKIPPSGLCFRSLKVLTVVLEYPDNNLTERLFSICPALEDLSIGHLDDKSLINFNISSTTLKRLCLSFTNGVAYSNNWHKVMIATPNLELLNIHDFCMVSYMFHELPPFTKVFIDIFYDDGWSWVQSGRAQRLLNSLTKAKFLALSADTVYALDKIYKDVFPKFPNVTCLAVKVELFGWRLLPIILSSLPNLEEFVFEKKLSCHFEEFGWIEQPNIPLCLLLHVKKIEIKKfegqkdelGLVKYLLKNCKVLNKVIIRcketaskenlcqkldklqrgsmtceveif

LAEKFIMNEHESLSKEDRISQLPDGILCHILSFLPIKCALATCILSSRWKFVWTLLPNLCFDERLHMRPVYGQHMGYIFRKDGFCFSEDPNPVFENFVTRVLHLTNPTAIGKFSLDRWALSDLTRFRSWVDSIIMRNVCEIELFLGSHKLVRLPESICTLKTLEVLKLYSDFVIKIPPSGLCFRSLKVLTVVLEYPDNNLTERLFSICPALEDLSIGHLDDKSLINFNISSTTLKRLCLSFTNGVAYSNNWHKVMIATPNLELLNIHDFCMVSYMFHELPPFTKVFIDIFYDDGWSWVQSGRAQRLLNSLTKAKFLALSADTVYALDKIYKDVFPKFPNVTCLAVKVELFGWRllpiilsslpNLEEFVFEKKLSCHFEEFGWIEQPNIPLCLLLHVKKIEIKKFEGQKDELGLVKYLLKNCKVLNKVIIRCKETASKENLCQKLDKLQRGSMTCEVEIF

*********************LPDGILCHILSFLPIKCALATCILSSRWKFVWTLLPNLCFDERLHMRPVYGQHMGYIFRKDGFCFSEDPNPVFENFVTRVLHLTNPTAIGKFSLDRWALSDLTRFRSWVDSIIMRNVCEIELFLGSHKLVRLPESICTLKTLEVLKLYSDFVIKIPPSGLCFRSLKVLTVVLEYPDNNLTERLFSICPALEDLSIGHLDDKSLINFNISSTTLKRLCLSFTNGVAYSNNWHKVMIATPNLELLNIHDFCMVSYMFHELPPFTKVFIDIFYDDGWSWVQSGRAQRLLNSLTKAKFLALSADTVYALDKIYKDVFPKFPNVTCLAVKVELFGWRLLPIILSSLPNLEEFVFEKKLSCHFEEFGWIEQPNIPLCLLLHVKKIEIKKFEGQKDELGLVKYLLKNCKVLNKVIIRCKETASKENLCQ*****************

***************EDRISQLPDGILCHILSFLPIKCALATCILSSRWKFVWTLLPNLCFDERLHMRP******GYIFRKDGFCFSEDPNPVFENFVTRVLHLTNPTAIGKFSLDRWALSDLTRFRSWVDSIIMRNVCEIELFLGSHKLVRLPESICTLKTLEVLKLYSDFVIKIPPSGLCFRSLKVLTVVLEYPDNNLTERLFSICPALEDLSIGHLDDKSLINFNISSTTLKRLCLSFTNGVAYSNNWHKVMIATPNLELLNIHDFCMVSYMFHELPPFTKVFIDIFYDDGWSWVQSGRAQRLLNSLTKAKFLALSADTVYALDKIYKDVFPKFPNVTCLAVKVELFGWRLLPIILSSLPNLEEFVFEKKLSCHFEEFGWIEQPNIPLCLLLHVKKIEIKKFEGQKDELGLVKYLLKNCKVLNKVIIRCKETASKENLCQKLDKLQRGSMTCEVEIF

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		460	2.2.26 [Sep-21-2011]
Q9FZ52		449	F-box/FBD/LRR-repeat prot	yes	no	0.897	0.919	0.283	5e-36
Q9FM89		422	F-box/FBD/LRR-repeat prot	no	no	0.882	0.962	0.280	2e-34
Q9SCQ5		427	Putative FBD-associated F	no	no	0.843	0.908	0.283	5e-32
Q9FNI8		466	FBD-associated F-box prot	no	no	0.919	0.907	0.268	1e-29
Q1PED9		388	F-box/LRR-repeat protein	no	no	0.747	0.886	0.295	4e-29
Q9LXR6		457	Putative F-box protein At	no	no	0.873	0.879	0.268	6e-29
Q56XS8		456	F-box/FBD/LRR-repeat prot	no	no	0.904	0.912	0.243	2e-28
Q8GXW6		482	F-box/LRR-repeat protein	no	no	0.871	0.831	0.275	9e-28
Q94B46		468	F-box/LRR-repeat protein	no	no	0.908	0.893	0.291	1e-27
Q9FNJ4		443	Putative F-box/FBD/LRR-re	no	no	0.917	0.952	0.266	1e-27

>sp\|Q9FZ52\|FDL3_ARATH F-box/FBD/LRR-repeat protein At1g16930 OS=Arabidopsis thaliana GN=At1g16930 PE=2 SV=1	Back alignment and function desciption

 Score =  152 bits (384), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 134/472 (28%), Positives = 216/472 (45%), Gaps = 59/472 (12%)

Query: 11  ESLSKEDRISQLPDGILCHILSFLPIKCALATCILSSRWKFVWTLLPNLCFDERLHMRPV 70
           E     DRIS LPD +LC ILS L  K ++ T +LS RW+ +W  +P             
Sbjct: 9   EKQRNSDRISNLPDSLLCQILSDLSTKESVCTSVLSKRWRNLWLHVP------------- 55

Query: 71  YGQHMGYIFRKDGFCFSEDPNPVFENFVTRVLHLTNPTAIGKFSL-DRWALSDLTRFRSW 129
                  +   D   F +D   VF +FV R L   N   + +F L       D +RF+SW
Sbjct: 56  -------VLDLDSNNFPDD--DVFVSFVNRFLGSENEQHLERFKLIYEVNEHDASRFKSW 106

Query: 130 VDSIIMRNVCEIEL---FLGSHKLVRLPESICTLKTLEVLKLYSDFVIKIPPSGLCFRSL 186
           ++++I R VC   +        +LV++P S+ + + L  L+LY   V    P  +    +
Sbjct: 107 INAVIKRRVCHFNVHNEVDDDDELVKMPLSLYSCERLVNLQLYR--VALDHPESVSLPCV 164

Query: 187 KVLTV-VLEYPDNNLTERLFSICPALEDLSIGHLDDKSLINFNISSTTLKRLCLSFTNGV 245
           K++ + +++Y  ++  E L S CP LE+L+I    + SL    + S +LK   +   +  
Sbjct: 165 KIMHLDMVKYDADSTLEILISGCPVLEELTIVRDPNDSLEVVCVRSQSLKSFKI---DSE 221

Query: 246 AYSNNWHKVMIATPNLELLNIHDFCMVSYMFHELPPFTKVFIDIF----YDDGWSWVQSG 301
            Y +  H V I  P LE +N+ D    S++ H + PF KV ID+     Y+D      S 
Sbjct: 222 RYESQNHVVTIDAPRLEYMNLCDHRSDSFIIHNIGPFAKVDIDVIFNVEYNDPLEPDDSS 281

Query: 302 RAQ---RLLNSLTKAKFLALSADTVYAL-DKIYKDVFPKFPNVTCLAVKVELFGWRLLPI 357
           +     + L  L+    + +S+DT+  + D    +  P+F N++ L    E   W +LP 
Sbjct: 282 KIAMLGKFLTGLSTVSEMVISSDTLQVIHDYCKMEQLPQFSNLSRLHAYFEDTWWEMLPT 341

Query: 358 ILSSLPNLEEFVFEKKLSCHFEEFGWIEQPNIPLCLL-----LHVK-------KIEIKKF 405
            L S PNL   V E    C F +   I+   +P C L     +H+K       + E +  
Sbjct: 342 FLESFPNLHSLVME--FDC-FPDTEQIDLSYVPQCFLSSLEFVHLKTPYVVNMQKEGRPL 398

Query: 406 EGQKDELGLVKYLLKNCKVLNKVIIRCKETASKENLCQKLDKLQRGSMTCEV 457
            G   +  L KY L+N   L K+ +    +AS  N+  ++  + R S +C+V
Sbjct: 399 TGTSSKRKLAKYFLENGAALKKLTV----SASFCNIIDEIKAIPRSSTSCQV 446

Arabidopsis thaliana (taxid: 3702)

>sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420 OS=Arabidopsis thaliana GN=At5g56420 PE=2 SV=1	Back alignment and function description

>sp\|Q9SCQ5\|FBD10_ARATH Putative FBD-associated F-box protein At3g50710 OS=Arabidopsis thaliana GN=At3g50710 PE=4 SV=1	Back alignment and function description

>sp\|Q9FNI8\|FBD32_ARATH FBD-associated F-box protein At5g22730 OS=Arabidopsis thaliana GN=At5g22730 PE=2 SV=2	Back alignment and function description

>sp\|Q1PED9\|FBL63_ARATH F-box/LRR-repeat protein At3g59190 OS=Arabidopsis thaliana GN=At3g59190 PE=2 SV=1	Back alignment and function description

>sp\|Q9LXR6\|FB207_ARATH Putative F-box protein At3g58860 OS=Arabidopsis thaliana GN=At3g58860 PE=4 SV=1	Back alignment and function description

>sp\|Q56XS8\|FDL2_ARATH F-box/FBD/LRR-repeat protein At1g13780 OS=Arabidopsis thaliana GN=At1g13780 PE=2 SV=1	Back alignment and function description

>sp\|Q8GXW6\|FBL59_ARATH F-box/LRR-repeat protein At3g58930 OS=Arabidopsis thaliana GN=At3g58930 PE=2 SV=1	Back alignment and function description

>sp\|Q94B46\|FBL74_ARATH F-box/LRR-repeat protein At4g14096 OS=Arabidopsis thaliana GN=At4g14096 PE=2 SV=1	Back alignment and function description

>sp\|Q9FNJ4\|FDL32_ARATH Putative F-box/FBD/LRR-repeat protein At5g22670 OS=Arabidopsis thaliana GN=At5g22670 PE=4 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		460
147812093		607	hypothetical protein VITISV_040899 [Viti	0.919	0.696	0.352	9e-54
296086770		411	unnamed protein product [Vitis vinifera]	0.817	0.914	0.317	6e-45
297844624		452	F-box family protein [Arabidopsis lyrata	0.897	0.913	0.282	3e-34
15219959		449	F-box/RNI-like/FBD-like domains-containi	0.897	0.919	0.283	3e-34
15241211		422	F-box/FBD/LRR-repeat protein [Arabidopsi	0.882	0.962	0.280	1e-32
297819758		426	F-box family protein [Arabidopsis lyrata	0.839	0.906	0.291	2e-31
224114976		462	predicted protein [Populus trichocarpa]	0.9	0.896	0.300	3e-31
296086764		348	unnamed protein product [Vitis vinifera]	0.669	0.885	0.321	9e-31
297796525		423	F-box family protein [Arabidopsis lyrata	0.878	0.955	0.269	3e-30
15229834		427	putative FBD-associated F-box protein [A	0.843	0.908	0.283	3e-30

>gi\|147812093\|emb\|CAN74740.1\| hypothetical protein VITISV_040899 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  217 bits (553), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 162/459 (35%), Positives = 237/459 (51%), Gaps = 36/459 (7%)

Query: 17  DRISQLPDGILCHILSFLPIKCALATCILSSRWKFVWTLLPNLCFDERLHMRPVYGQHMG 76
           D IS LPD +LCHILSFLP K A+ T ILS RW+++W  +P L FD+ L + P     + 
Sbjct: 10  DIISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNPSTLVEL- 68

Query: 77  YIFRKDGFCFSEDPNPVFENFVTRVLHLTNPTAIGKFSLDRWALSDLTRFRSWVDSIIMR 136
                      E+   +F+NFV  VL  +  + I KF L  +  ++L    SW+   + R
Sbjct: 69  -----------EERIIMFQNFVDGVLRHSEVSCIKKFRLG-YRDNNLDSVYSWICIALER 116

Query: 137 NVCEIELFLGSHKLVRLPESICTLKTLEVLKLYSDFVIKIPPSGLCFRSLKVLTV-VLEY 195
            V E++L L     V LP      KTL V+KL     + IP + +   SLK L +  +EY
Sbjct: 117 RVQELDLHLLIDWRVELPPMFFICKTLVVVKLSCALFLDIPTT-VWLPSLKALHLKSVEY 175

Query: 196 PDNNLTERLFSICPALEDLSIGHLDDKSLINFNISSTTLKRL-CLSFTNGVAY----SNN 250
            D++  ++L S CP LE+L I   +  +    N+S+ +LK L    FT+G A+     + 
Sbjct: 176 SDDDSIQKLLSGCPVLEELVIEREERDNQWVVNVSNPSLKILRIFFFTDGFAHPYEQEDQ 235

Query: 251 WHKVMIATPNLELLNIHDFCMVSYMFHELPPFTKVFIDIFYDD----------GWSWVQS 300
            +KV++  PNLE L+I D+    Y   +LP   K FID+  D           G S+   
Sbjct: 236 DYKVVVDAPNLEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISY--H 293

Query: 301 GRAQRLLNSLTKAKFLALSADTVYALDKIYKDV-FPKFPNVTCLA-VKVELFGWRLLPII 358
           G    LL  ++  K L+L+  T+ +L     D   P F N+T L  + +  F W  LP  
Sbjct: 294 GPIYELLGRISNVKCLSLTGVTLDSLSGTIGDYKLPTFHNMTRLEFLFIGGFNWDFLPNF 353

Query: 359 LSSLPNLEEFVFEKKLSCHFEEFGWIEQPNIPLCLLLHVKKIEIKKFEGQKDELGLVKYL 418
           L S PNLE  V E   +      GW+    +P CL+LH+K+IEI++  G+  EL  V+YL
Sbjct: 354 LHSSPNLEALVIETGYTNELIPEGWLMPLQVPACLVLHLKEIEIRRIVGEDYELEAVEYL 413

Query: 419 LKNCKVLNKVIIRCKETASKEN--LCQKLDKLQRGSMTC 455
           LKN +VL ++ I C E+   +   +C+KL  L RGS +C
Sbjct: 414 LKNAEVLQQMTIDCHESYMDQEFCVCKKLLGLPRGSRSC 452

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296086770\|emb\|CBI32919.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297844624\|ref\|XP_002890193.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi\|297336035\|gb\|EFH66452.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|15219959\|ref\|NP_173137.1\| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana] gi\|75263252\|sp\|Q9FZ52.1\|FDL3_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At1g16930 gi\|9802769\|gb\|AAF99838.1\|AC051629_5 Hypothetical protein [Arabidopsis thaliana] gi\|332191402\|gb\|AEE29523.1\| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|15241211|ref|NP_200453.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|42573694|ref|NP_974943.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75262699|sp|Q9FM89.1|FDL38_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At5g56420 gi|10177841|dbj|BAB11270.1| unnamed protein product [Arabidopsis thaliana] gi|332009379|gb|AED96762.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|332009380|gb|AED96763.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297819758\|ref\|XP_002877762.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi\|297323600\|gb\|EFH54021.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|224114976\|ref\|XP_002316907.1\| predicted protein [Populus trichocarpa] gi\|222859972\|gb\|EEE97519.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296086764\|emb\|CBI32913.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297796525\|ref\|XP_002866147.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi\|297311982\|gb\|EFH42406.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|15229834\|ref\|NP_190640.1\| putative FBD-associated F-box protein [Arabidopsis thaliana] gi\|75265626\|sp\|Q9SCQ5.1\|FBD10_ARATH RecName: Full=Putative FBD-associated F-box protein At3g50710 gi\|6561974\|emb\|CAB62440.1\| putative protein [Arabidopsis thaliana] gi\|332645179\|gb\|AEE78700.1\| putative FBD-associated F-box protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		460
TAIR\|locus:2101674		427	AT3G50710 "AT3G50710" [Arabido	0.876	0.943	0.279	7.7e-32
TAIR\|locus:2015681		449	AT1G16930 "AT1G16930" [Arabido	0.784	0.804	0.263	1.1e-28
TAIR\|locus:2082861		630	AT3G49150 "AT3G49150" [Arabido	0.908	0.663	0.280	2.3e-26
TAIR\|locus:2099019		457	AT3G58860 "AT3G58860" [Arabido	0.869	0.875	0.269	4.7e-26
TAIR\|locus:2081297		388	AT3G59190 "AT3G59190" [Arabido	0.752	0.891	0.292	7.9e-26
TAIR\|locus:2162489		450	AT5G22660 "AT5G22660" [Arabido	0.793	0.811	0.241	1.4e-25
TAIR\|locus:2162499		443	AT5G22670 "AT5G22670" [Arabido	0.778	0.808	0.25	1.7e-25
TAIR\|locus:505006162		422	AT1G32375 "AT1G32375" [Arabido	0.515	0.561	0.311	1.9e-25
TAIR\|locus:2165071		435	AT5G56810 [Arabidopsis thalian	0.636	0.673	0.233	2.1e-25
TAIR\|locus:2057422		442	AT2G26030 "AT2G26030" [Arabido	0.897	0.934	0.263	2.8e-25

TAIR\|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 349 (127.9 bits), Expect = 7.7e-32, P = 7.7e-32
 Identities = 129/461 (27%), Positives = 206/461 (44%)

Query:    17 DRISQLPDGILCHILSFLPIKCALATCILSSRWKFVWTLLPNLCFDERLHMRP-VYGQHM 75
             DRIS L D +L  I+S LP K  + T +LS RWKF+W ++P L FD+   + P  YG+ +
Sbjct:     2 DRISNLSDDLLLKIVSSLPTKDVVVTMLLSKRWKFLWMMVPKLRFDDEFELEPSYYGRFL 61

Query:    76 GYIFRKDGFCFSEDPNPVFENFVTRVLHLTNPTAIGKFSLDRWALSDLTRFRSWVDSIIM 135
              Y+          D + V      +VL         KF++     S+     +W+   ++
Sbjct:    62 KYV----------DKSMVLNR--AQVLETV------KFNVGPCCSSE--DIATWIRIGMV 101

Query:   136 RNVCEIEL-----FLGSHKLVRLPESICTLKTLEVLKLYSDFVIKIPPSGLCFRSLKVLT 190
             RN+ E+E+     +   H+ ++LP+S+ T + LEVLKL S  V+ +P   +CF SLK L 
Sbjct:   102 RNMRELEISHCEGYFREHRSIKLPKSLYTYEKLEVLKLASTVVLNVPID-VCFPSLKSLH 160

Query:   191 VV-LEYPDNNLTERLFSICPALEDLSIGHLDDKSLINFNISS-----TTLKRLCLSFTNG 244
             +V +EY       RL S CP LE+L +    DKS  +F++ S      TL+ L +  T+G
Sbjct:   161 LVCVEYKTKKSHRRLLSGCPVLEELVL----DKSYNSFHVRSFYVEIPTLQSLSILDTSG 216

Query:   245 VAYSNNWHKVMIATPNLELLNIHDFCMVSYMFHELPPFTKVFIDIFYDDGWSWVQSGRAQ 304
               Y +     ++  P L+  N  DF     +   +P    V I + Y +          +
Sbjct:   217 ELYGD--FTFVVNAPALKYFNFVDFYGDLCLRDNMPEVVDVNIKVIYRN---------PK 265

Query:   305 RLLNSLTKAKFLALSADTVYALDKIYKDVFPKFPNVTCLAVKV--ELFGWRXXXXXXXXX 362
             +LL  L   K L+L       L   + + +       C    +  +L  W          
Sbjct:   266 KLLGPLKSVKRLSLCLSPSTTLHN-HMEFYQLVHLELCGDALMWWDLLTWMLQSSPKLQV 324

Query:   363 XNLEEFVFEKK--LSCHFEEFGWIEQPNIPLCLLLHVKKIEIKKFEGQKDELGLVKYLLK 420
               + E   E+   L    EE  W E  ++P CLL H+   E K +    +E  +V Y+LK
Sbjct:   325 LKIYECKCEEHDYLDDPIEEH-WEEPSSVPQCLLFHLNIFEWKYYNAGDEEKKVVAYILK 383

Query:   421 NCKVLNKVIIRCKETA-SKENLCQKLDKL---QRGSMTCEV 457
             N + L             KE   ++L++L    R S +C++
Sbjct:   384 NARQLKTATFSAASYLYPKEERSRELNELVYMARASSSCQL 424

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

TAIR\|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2082861 AT3G49150 "AT3G49150" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2099019 AT3G58860 "AT3G58860" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2081297 AT3G59190 "AT3G59190" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2162489 AT5G22660 "AT5G22660" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2162499 AT5G22670 "AT5G22670" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:505006162 AT1G32375 "AT1G32375" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2165071 AT5G56810 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2057422 AT2G26030 "AT2G26030" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		460
smart00579		72	smart00579, FBD, domain in FBox and BRCT domain co	4e-12
pfam08387		51	pfam08387, FBD, FBD	3e-10

>gnl\|CDD\|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins	Back alignment and domain information

 Score = 61.0 bits (149), Expect = 4e-12
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 392 CLLLHVKKIEIKKFEGQKDELGLVKYLLKNCKVLNKVIIRCKETASKENLC--QKLDKLQ 449
           CLL  ++ +EIK + G ++E  LVKY L+N   L K+ I  + +  +E L   ++L  L 
Sbjct: 2   CLLSSLEVLEIKGYRGTEEEKELVKYFLENAPCLKKLTISVETSDDEEKLEILKELLSLP 61

Query: 450 RGSMTCEVEI 459
           R S +C+V+ 
Sbjct: 62  RASSSCQVQF 71

Length = 72

>gnl\|CDD\|203925 pfam08387, FBD, FBD	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		460
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.68
KOG4341		483	consensus F-box protein containing LRR [General fu	99.62
smart00579		72	FBD domain in FBox and BRCT domain containing plan	99.36
PF08387		51	FBD: FBD; InterPro: IPR013596 This region is found	99.11
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.82
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	98.77
PF12937		47	F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B	98.76
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.59
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.45
PF00646		48	F-box: F-box domain; InterPro: IPR001810 The F-box	98.28
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.24
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.23
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.19
smart00256		41	FBOX A Receptor for Ubiquitination Targets.	98.14
KOG4341		483	consensus F-box protein containing LRR [General fu	98.04
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	97.97
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	97.95
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	97.92
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	97.8
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.59
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	97.57
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.56
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	97.56
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	97.43
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.36
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.34
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.33
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.31
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	97.3
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.26
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.25
PF07723		26	LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le	97.04
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.87
KOG0617		264	consensus Ras suppressor protein (contains leucine	96.83
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	96.82
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.72
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.61
KOG0617		264	consensus Ras suppressor protein (contains leucine	96.19
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	96.12
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	95.99
KOG2982		418	consensus Uncharacterized conserved protein [Funct	95.98
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	95.75
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	95.72
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.59
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	95.41
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	95.23
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.14
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	95.01
KOG2997		366	consensus F-box protein FBX9 [General function pre	94.28
PLN03150		623	hypothetical protein; Provisional	94.19
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	94.19
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	94.19
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	94.06
PRK15386		426	type III secretion protein GogB; Provisional	93.76
KOG0472		565	consensus Leucine-rich repeat protein [Function un	93.16
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	93.03
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	92.85
PLN03215		373	ascorbic acid mannose pathway regulator 1; Provisi	92.69
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	92.48
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	92.36
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	90.93
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	89.57
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	88.97
PLN03150		623	hypothetical protein; Provisional	88.58
KOG3864		221	consensus Uncharacterized conserved protein [Funct	87.93
KOG0472		565	consensus Leucine-rich repeat protein [Function un	86.29
PRK15386		426	type III secretion protein GogB; Provisional	85.52
KOG3864		221	consensus Uncharacterized conserved protein [Funct	82.78
PF13013		109	F-box-like_2: F-box-like domain	82.68
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	81.57
PF07723		26	LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le	80.96

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=99.68  E-value=1.2e-18  Score=154.14  Aligned_cols=272  Identities=18%  Similarity=0.106  Sum_probs=166.8

Q ss_pred             cCCCChHHHHHHhcCCcchheeecccchhhhHhhcccCc-ceEeecCCCCccccCCccccccccCCcccCCCCCchHHHH
Q 044491           19 ISQLPDGILCHILSFLPIKCALATCILSSRWKFVWTLLP-NLCFDERLHMRPVYGQHMGYIFRKDGFCFSEDPNPVFENF   97 (460)
Q Consensus        19 is~LPd~iL~~Ils~L~~~d~~~~s~vskrWr~lw~~~~-~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   97 (460)
                      ++.|||||+..|||.|+.+++.+++.|||||+++-+.-. ...+|....   .+.                      ++.
T Consensus        98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r---~i~----------------------p~~  152 (419)
T KOG2120|consen   98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGR---NIH----------------------PDV  152 (419)
T ss_pred             cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCC---ccC----------------------hhH
Confidence            678999999999999999999999999999997643211 122222211   111                      122


Q ss_pred             HHHhhccCCCCcccEEEEEecCCCCcchhhHHHHHHHhcCceEEEEEeccCcceecCCccccCCcccEEEeceeeeecc-
Q 044491           98 VTRVLHLTNPTAIGKFSLDRWALSDLTRFRSWVDSIIMRNVCEIELFLGSHKLVRLPESICTLKTLEVLKLYSDFVIKI-  176 (460)
Q Consensus        98 v~~~l~~~~~~~l~~l~l~~~~~~~~~~~~~wi~~~~~~~l~~L~l~~~~~~~~~lp~~l~~~~~L~~L~L~~~~~~~~-  176 (460)
                      ..+.+.    ..|..|++.-... +...++.-... ++..+|++++.....+...+.-.+..|..|+.|+|.|....+. 
T Consensus       153 l~~l~~----rgV~v~Rlar~~~-~~prlae~~~~-frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSlEg~~LdD~I  226 (419)
T KOG2120|consen  153 LGRLLS----RGVIVFRLARSFM-DQPRLAEHFSP-FRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSLEGLRLDDPI  226 (419)
T ss_pred             HHHHHh----CCeEEEEcchhhh-cCchhhhhhhh-hhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccccccccCcHH
Confidence            222221    1255555553222 22222222221 2346999999776655566666777899999999999965432 


Q ss_pred             CCCcccCCCCcEEEE-EEEECCCccHHHHhccCCcccceEeeeccCCCceeEEEeccccceEEEEeecCccccCCceeEE
Q 044491          177 PPSGLCFRSLKVLTV-VLEYPDNNLTERLFSICPALEDLSIGHLDDKSLINFNISSTTLKRLCLSFTNGVAYSNNWHKVM  255 (460)
Q Consensus       177 ~~~~~~l~~L~~L~L-~~~~~~~~~l~~l~~~cp~Le~L~L~~c~~~~~~~~~i~~~~L~~L~l~~~~~~~~~~~~~~~~  255 (460)
                      ....+--.+|+.|+| .+...+..++.-++++|..|.+|+|..|...... +.+                       .+.
T Consensus       227 ~~~iAkN~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~-Vtv-----------------------~V~  282 (419)
T KOG2120|consen  227 VNTIAKNSNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEK-VTV-----------------------AVA  282 (419)
T ss_pred             HHHHhccccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchh-hhH-----------------------HHh
Confidence            122334678999999 8888878889999999999999999999743211 100                       000


Q ss_pred             EecCCceeEEEeeeeeceEEeecCCCeeEEEEEEEecCCccccccccHHHHhhcCcceeEEEEeccchhhhhhhccccCC
Q 044491          256 IATPNLELLNIHDFCMVSYMFHELPPFTKVFIDIFYDDGWSWVQSGRAQRLLNSLTKAKFLALSADTVYALDKIYKDVFP  335 (460)
Q Consensus       256 ~~~p~L~~L~l~~~~~~~~~~~~~p~L~~l~l~~~~~~~~~~~~~~~~~~~l~~l~~l~~L~l~~~~~~~~~~~~~~~~~  335 (460)
                      --.++|..|+++|+..         +|.                ...+..+.+.++++.+|+++.+.+-.. .+ .+.+-
T Consensus       283 hise~l~~LNlsG~rr---------nl~----------------~sh~~tL~~rcp~l~~LDLSD~v~l~~-~~-~~~~~  335 (419)
T KOG2120|consen  283 HISETLTQLNLSGYRR---------NLQ----------------KSHLSTLVRRCPNLVHLDLSDSVMLKN-DC-FQEFF  335 (419)
T ss_pred             hhchhhhhhhhhhhHh---------hhh----------------hhHHHHHHHhCCceeeeccccccccCc-hH-HHHHH
Confidence            1123445555554422         000                033555666777777777776432111 11 12255


Q ss_pred             CCCceeEEEE-EEeccCcccHHHHHhcCCCCCeEEEeec
Q 044491          336 KFPNVTCLAV-KVELFGWRLLPIILSSLPNLEEFVFEKK  373 (460)
Q Consensus       336 ~~~~L~~L~L-~~~~~~~~~l~~~l~~~p~L~~L~I~~~  373 (460)
                      +|+.|++|++ .|.......+.. +++.|.|..|++.||
T Consensus       336 kf~~L~~lSlsRCY~i~p~~~~~-l~s~psl~yLdv~g~  373 (419)
T KOG2120|consen  336 KFNYLQHLSLSRCYDIIPETLLE-LNSKPSLVYLDVFGC  373 (419)
T ss_pred             hcchheeeehhhhcCCChHHeee-eccCcceEEEEeccc
Confidence            6777788888 777666555442 566788888888877

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>smart00579 FBD domain in FBox and BRCT domain containing plant proteins	Back alignment and domain information

>PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>smart00256 FBOX A Receptor for Ubiquitination Targets	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2997 consensus F-box protein FBX9 [General function prediction only]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13013 F-box-like_2: F-box-like domain	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		460
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04
2e31_A		297	FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui	3e-05
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-04
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 71.0 bits (173), Expect = 3e-13
 Identities = 75/487 (15%), Positives = 147/487 (30%), Gaps = 149/487 (30%)

Query: 53  WTLLPNLCFDERLHMRPVYGQH---MGYIFRKDG-------FCFSEDPNPVFENFVTRVL 102
             +  ++C   ++  +  +      +      +          +  DPN     + +R  
Sbjct: 164 TWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPN-----WTSRSD 218

Query: 103 HLTNPTAIGKFSLDRW--ALSDLTRFRSWVDS-IIMRNVCE---IELF-LGSHKLVRLPE 155
           H +N     K  +      L  L + + + +  +++ NV        F L    L+    
Sbjct: 219 HSSNI----KLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILL---- 270

Query: 156 SICTLKTLEVLKLYSDFVIKIPPSGLCFRSLKVLTVVLEYPDNNLTERLFSICPALEDLS 215
              T +  +V    +DF+           +     + L++    LT          E  S
Sbjct: 271 ---TTRFKQV----TDFLS----------AATTTHISLDHHSMTLTPD--------EVKS 305

Query: 216 IGHLDDKSLINF-NISSTTLKR-------LCLS-----FTNGVAYSNNWHKVMIATPNLE 262
           +       L+ + +     L R         LS       +G+A  +NW  V       +
Sbjct: 306 L-------LLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCD----K 354

Query: 263 LLNIHDFCMVSYMFHELPP--FTKVFID--IFYDDG----------WSWVQSGRAQRLLN 308
           L  I +        + L P  + K+F    +F              W  V       ++N
Sbjct: 355 LTTIIESS-----LNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVN 409

Query: 309 SLTKAKFLAL--SADTVYALDKIYKDVFPKFPN--------VTCLAVKVELFGWRLLPII 358
            L K   L      ++  ++  IY ++  K  N        V    +        L+P  
Sbjct: 410 KLHK-YSLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPY 468

Query: 359 ------------LSSLPNLEEFVFEKKLSCHFEEFGWIEQ-----------PNIPLCLLL 395
                       L ++ + E     + +   F +F ++EQ               L  L 
Sbjct: 469 LDQYFYSHIGHHLKNIEHPERMTLFRMV---FLDFRFLEQKIRHDSTAWNASGSILNTLQ 525

Query: 396 HVKKIE--IKKFEGQKDELGLVKYLLKNCKVLNKVIIRCKETASKENLCQKLDKLQRGSM 453
            +K  +  I   + + + L  V  +L     + + +I  K T          D L+   M
Sbjct: 526 QLKFYKPYICDNDPKYERL--VNAILDFLPKIEENLICSKYT----------DLLRIALM 573

Query: 454 TCEVEIF 460
             +  IF
Sbjct: 574 AEDEAIF 580

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		460
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.87
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.84
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.76
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.27
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.18
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.03
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.03
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.03
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.0
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	98.95
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.93
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	98.93
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	98.92
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.89
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.87
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.85
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.84
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.84
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.83
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	98.83
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	98.82
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.82
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.8
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.8
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	98.79
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	98.79
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.79
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.79
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	98.79
1fs1_A		53	SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L	98.75
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	98.75
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	98.74
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	98.73
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.71
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.71
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.7
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	98.69
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	98.69
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.69
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	98.68
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	98.68
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.67
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	98.67
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	98.66
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.66
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	98.65
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	98.64
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	98.64
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	98.64
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	98.64
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.63
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	98.62
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	98.62
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.61
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	98.59
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.59
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.59
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	98.58
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.58
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	98.58
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.58
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.57
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	98.55
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.54
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.52
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	98.52
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	98.51
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.5
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	98.47
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.44
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.41
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.38
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.38
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.37
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.35
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.35
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	98.35
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.34
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.34
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.34
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.33
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.33
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.31
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.3
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	98.29
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.24
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.23
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.21
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.21
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.2
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.2
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.16
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.16
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.13
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.12
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.12
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	98.09
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.0
2e31_A		297	FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui	97.97
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	97.97
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.94
3m19_A		251	Variable lymphocyte receptor A diversity region; a	97.94
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.9
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	97.88
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	97.85
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.85
3m19_A		251	Variable lymphocyte receptor A diversity region; a	97.8
3l2o_B		312	F-box only protein 4; small G protein fold, UBL co	97.76
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	97.75
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	97.71
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	97.7
3e6j_A		229	Variable lymphocyte receptor diversity region; var	97.66
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	97.66
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	97.64
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	97.59
3e6j_A		229	Variable lymphocyte receptor diversity region; var	97.58
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	97.56
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	97.54
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	97.54
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	97.53
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	97.51
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	97.47
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	97.47
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	97.47
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	97.38
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.38
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	97.35
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	97.29
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	97.28
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	97.25
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.22
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	97.21
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.13
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	97.12
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.06
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	96.97
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	96.82
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	96.75
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	96.58
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	96.53
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	96.49
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	96.34
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.2
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.19
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.14
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.07
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	95.92
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	95.9
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	95.43
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	94.4
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	93.47
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	93.02
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	92.75
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	90.01
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	89.77
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	87.75
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	85.86

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

Probab=99.87  E-value=9.1e-23  Score=211.02  Aligned_cols=340  Identities=12%  Similarity=0.092  Sum_probs=167.0

Q ss_pred             CCCChHHHHHHhcCC-cchheeecccchhhhHhhcccCc-ceEeecCCC-Cccc----cCCccccccc-----cCCcccC
Q 044491           20 SQLPDGILCHILSFL-PIKCALATCILSSRWKFVWTLLP-NLCFDERLH-MRPV----YGQHMGYIFR-----KDGFCFS   87 (460)
Q Consensus        20 s~LPd~iL~~Ils~L-~~~d~~~~s~vskrWr~lw~~~~-~l~~~~~~~-~~~~----~~~~~~~~~~-----~~~~~~~   87 (460)
                      ++||||+|.+||+|| +.+|+++++.|||||++++...+ .+.+..... .++.    +.. ...+--     ..++-..
T Consensus        14 ~~LPdeil~~I~~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~-L~~L~L~~~~~~~~~~~~   92 (592)
T 3ogk_B           14 VATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPN-LRSLKLKGKPRAAMFNLI   92 (592)
T ss_dssp             CCCGGGTHHHHHTTCCCHHHHHHHTTSCHHHHHHHHHHCCEEEESCGGGSCHHHHHHHCTT-CSEEEEECSCGGGGGTCS
T ss_pred             CCCCHHHHHHHHHhcCCHHHHHHHHHHhHHHHHhhhccccEEEEeeccccChHHHHHhCCC-CeEEEecCCcchhhcccc
Confidence            389999999999999 89999999999999998853322 122111000 0000    000 000000     0000000


Q ss_pred             CCCCc-hHHHHHHHhhccCCCCcccEEEEEecCCCCcchhhHHHHHHHhcCceEEEEEecc-CcceecCCccccCCcccE
Q 044491           88 EDPNP-VFENFVTRVLHLTNPTAIGKFSLDRWALSDLTRFRSWVDSIIMRNVCEIELFLGS-HKLVRLPESICTLKTLEV  165 (460)
Q Consensus        88 ~~~~~-~~~~~v~~~l~~~~~~~l~~l~l~~~~~~~~~~~~~wi~~~~~~~l~~L~l~~~~-~~~~~lp~~l~~~~~L~~  165 (460)
                      +.... .....+..+....  +.++.+.+....  -.+....|+......++++|++..+. .....++.....|++|++
T Consensus        93 ~~~~~~~~~~~l~~l~~~~--~~L~~L~L~~~~--i~~~~~~~l~~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~  168 (592)
T 3ogk_B           93 PENWGGYVTPWVTEISNNL--RQLKSVHFRRMI--VSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKT  168 (592)
T ss_dssp             CTTSCCBCHHHHHHHHHHC--TTCCEEEEESCB--CCHHHHHHHHHHHGGGCCEEEEESCEEEEHHHHHHHHHHCTTCSE
T ss_pred             cccccccchHHHHHHHhhC--CCCCeEEeeccE--ecHHHHHHHHHhccccCcEEECcCCCCcCHHHHHHHHhhCCCCCE
Confidence            00000 0111122111111  225566555331  11223344444433347777775432 112223333346677777


Q ss_pred             EEeceeeeeccCC-----CcccCCCCcEEEE-EEEEC--CCccHHHHhccCCcccceEeeeccCCCceeEEEeccccceE
Q 044491          166 LKLYSDFVIKIPP-----SGLCFRSLKVLTV-VLEYP--DNNLTERLFSICPALEDLSIGHLDDKSLINFNISSTTLKRL  237 (460)
Q Consensus       166 L~L~~~~~~~~~~-----~~~~l~~L~~L~L-~~~~~--~~~~l~~l~~~cp~Le~L~L~~c~~~~~~~~~i~~~~L~~L  237 (460)
                      |+|++|...+...     ....+++|++|+| .+.+.  +...+..++..||+|++|.+.+|...++...-...++|+.|
T Consensus       169 L~L~~~~~~~~~~~~l~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~l~~~~~~~~~L~~L  248 (592)
T 3ogk_B          169 LLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEF  248 (592)
T ss_dssp             EECTTCEEECCCSHHHHHHHHHCCCCCEEECTTCCCSSCCHHHHHHHHHHCTTCCEEECSSCBGGGGHHHHHHCTTCCEE
T ss_pred             EECccccccCcchhHHHHHHhcCCCccEEEeeccCCCccCHHHHHHHHhhCCCCcEEeccCccHHHHHHHHhhhhHHHhh
Confidence            7777774332211     1235677777777 55553  23456677777888888888877543322111122445555


Q ss_pred             EEEeecCc-c----------------------ccCCceeEEEecCCceeEEEeeeeece----EEeecCCCeeEEEEEEE
Q 044491          238 CLSFTNGV-A----------------------YSNNWHKVMIATPNLELLNIHDFCMVS----YMFHELPPFTKVFIDIF  290 (460)
Q Consensus       238 ~l~~~~~~-~----------------------~~~~~~~~~~~~p~L~~L~l~~~~~~~----~~~~~~p~L~~l~l~~~  290 (460)
                      .+..+... .                      .......+...+++|++|+++++....    ..+..+++|+.+.+...
T Consensus       249 ~l~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~l~~~~~~~~~L~~L~Ls~~~l~~~~~~~~~~~~~~L~~L~L~~~  328 (592)
T 3ogk_B          249 CGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETRNV  328 (592)
T ss_dssp             EECBCCCCTTCTTSSSCCCCCTTCCEEEETTCCTTTGGGGGGGGGGCCEEEETTCCCCHHHHHHHHTTCTTCCEEEEEGG
T ss_pred             cccccccccchHHHHHHhhccccccccCccccchhHHHHHHhhcCCCcEEecCCCcCCHHHHHHHHHhCcCCCEEeccCc
Confidence            54422100 0                      000111112246678888887765311    12356777887777511


Q ss_pred             ecCCccccccccHHHHhhcCcceeEEEEec-----------cchhhhhhhccccCCCCCceeEEEEEEeccCcccHHHHH
Q 044491          291 YDDGWSWVQSGRAQRLLNSLTKAKFLALSA-----------DTVYALDKIYKDVFPKFPNVTCLAVKVELFGWRLLPIIL  359 (460)
Q Consensus       291 ~~~~~~~~~~~~~~~~l~~l~~l~~L~l~~-----------~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~l~~~l  359 (460)
                             .....+..++..+++|++|.++.           ..+.....  ......+++|++|++.+...+..++..+.
T Consensus       329 -------~~~~~l~~~~~~~~~L~~L~L~~g~~~~~~~~~~~~~~~~~~--~~l~~~~~~L~~L~l~~~~l~~~~~~~l~  399 (592)
T 3ogk_B          329 -------IGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGL--IALAQGCQELEYMAVYVSDITNESLESIG  399 (592)
T ss_dssp             -------GHHHHHHHHHHHCTTCCEEEEECCCCSSTTSSTTCCCCHHHH--HHHHHHCTTCSEEEEEESCCCHHHHHHHH
T ss_pred             -------cCHHHHHHHHHhCCCCCEEEeecCccccccccccCccCHHHH--HHHHhhCccCeEEEeecCCccHHHHHHHH
Confidence                   11134555566777777777772           11111100  00122356677777766556666666666


Q ss_pred             hcCCCCCeEEEeec
Q 044491          360 SSLPNLEEFVFEKK  373 (460)
Q Consensus       360 ~~~p~L~~L~I~~~  373 (460)
                      .+||+|++|++.++
T Consensus       400 ~~~~~L~~L~l~~~  413 (592)
T 3ogk_B          400 TYLKNLCDFRLVLL  413 (592)
T ss_dssp             HHCCSCCEEEEEEC
T ss_pred             hhCCCCcEEEEeec
Confidence            66777777777654

PyMOL of 3ogk

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		460
d2ovrb1		102	a.158.1.1 (B:2263-2364) F-box/WD repeat-containing	6e-07
d1nexb1		100	a.158.1.1 (B:270-369) Cdc4 F-box and linker domain	3e-05

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102	Back information, alignment and structure


class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 45.5 bits (107), Expect = 6e-07
 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 3/66 (4%)

Query: 4  KFIMNEHESLSKEDRISQLPDGILCHILSFLPIKCALATCILSSRWKFV---WTLLPNLC 60
          K +M   E   + D IS LP  +  ++LSFL  K  L        W+ +     L    C
Sbjct: 4  KHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKC 63

Query: 61 FDERLH 66
           +E + 
Sbjct: 64 KEEGID 69

PyMOL of d2ovrb1

>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		460
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.18
d1fs1a1		41	Skp2 {Human (Homo sapiens) [TaxId: 9606]}	99.04
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.95
d2ovrb1		102	F-box/WD repeat-containing protein 7, FBXW7 {Human	98.72
d1nexb1		100	Cdc4 F-box and linker domains {Baker's yeast (Sacc	98.67
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.56
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.51
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.42
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.42
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.29
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.29
d1p22a1		118	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	98.23
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.21
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.06
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.05
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.0
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.97
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	97.97
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	97.85
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	97.81
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	97.77
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	97.72
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	97.69
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	97.64
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.52
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	97.5
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	97.25
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.22
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.22
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.17
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	97.11
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	96.88
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	96.6
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	96.32
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	96.07
d2ifga3		156	High affinity nerve growth factor receptor, N-term	95.67
d2ifga3		156	High affinity nerve growth factor receptor, N-term	94.97
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	94.44
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	94.3
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	93.92
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	93.53
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	92.66
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	90.36
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	87.74

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.18  E-value=1.9e-13  Score=125.14  Aligned_cols=84  Identities=15%  Similarity=0.058  Sum_probs=48.7

Q ss_pred             CceEEEEEeccCcceecCCccccCCcccEEEeceeeeecc-CCCcccCCCCcEEEE-EEEECCCccHHHHhccCCcccce
Q 044491          137 NVCEIELFLGSHKLVRLPESICTLKTLEVLKLYSDFVIKI-PPSGLCFRSLKVLTV-VLEYPDNNLTERLFSICPALEDL  214 (460)
Q Consensus       137 ~l~~L~l~~~~~~~~~lp~~l~~~~~L~~L~L~~~~~~~~-~~~~~~l~~L~~L~L-~~~~~~~~~l~~l~~~cp~Le~L  214 (460)
                      ++++|++..+......++..+..|++|++|+|.+|...+. ......+++|++|+| +|...++.++..++.+||+|++|
T Consensus        47 ~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L  126 (284)
T d2astb2          47 RVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDEL  126 (284)
T ss_dssp             CCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEE
T ss_pred             CCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhcccc
Confidence            5666666433322233344445667777777777743221 122335677777777 66555555666666777777777


Q ss_pred             Eeeecc
Q 044491          215 SIGHLD  220 (460)
Q Consensus       215 ~L~~c~  220 (460)
                      ++.+|.
T Consensus       127 ~ls~c~  132 (284)
T d2astb2         127 NLSWCF  132 (284)
T ss_dssp             ECCCCT
T ss_pred             cccccc
Confidence            777764

PyMOL of d2astb2

>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure