Citrus Sinensis ID: 044512

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MQFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNVKFRLP
ccccccHHHHHHHHHHHHcccccccEEEccccccEEEEEEEcccccEEEEEccccccccccccccccHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHccEEEccHHHHHHHHccccccHHHHHHHHHHccccEEEEEcccccEEEEEcccEEEEccccccccccccccHHHHHHHHHHHHccccHHHHHcccc
ccccccHHHHHHHHHHHHccccccEEEEccccccEEEEEEEcccccEEEEEEEcccHHHHccHHHccHHHHHHccEEEEcEccccccccHHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHccEEEEcHHHHHHHcccccHHHHHHHHHHHcccccEEEEEcccccEEEEEcccEEEEcccEEEEccHHHHHHHHHHHHHHHHcccccHHHHHHccc
MQFGDDEFGHMLVNILKqnnvktegvcfdnhaRTALAFVTLKKNgerefmfyrnpsadmllkdselnMGLIKQAKIFHygsislisepCRSAHMAALKAAKDAGvllsydpnvrlplwpsqdaaRDGIKSIWNHadlikvsddevnfltkggdaekdDVVMSLWHDNLKLLLVTYGAkgcgyftkkfkgrvpgfsvktidttgagdaFVGSFLVSVAkdanifnvkfrlp
MQFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGYFtkkfkgrvpGFSVKTIDTTGAGDAFVGSFLVsvakdanifnvkfrlp
MQFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYGSISLISEPCRSahmaalkaakdaGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNVKFRLP
*******FGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNVKF***
MQFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFN*KFRLP
MQFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNVKFRLP
*QFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNV***L*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNVKFRLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
O82616324 Putative fructokinase-5 O yes no 0.986 0.700 0.789 1e-104
Q0J8G4336 Fructokinase-2 OS=Oryza s yes no 0.986 0.675 0.745 3e-96
A2YQL4336 Fructokinase-2 OS=Oryza s N/A no 0.986 0.675 0.745 3e-96
Q6XZ78335 Fructokinase-2 OS=Zea may N/A no 0.986 0.677 0.75 3e-90
Q42896328 Fructokinase-2 OS=Solanum N/A no 0.986 0.692 0.657 1e-85
Q7XJ81328 Fructokinase-2 OS=Solanum N/A no 0.986 0.692 0.653 8e-85
Q9M1B9326 Probable fructokinase-4 O no no 0.986 0.696 0.627 1e-82
Q9LNE4345 Probable fructokinase-3 O no no 0.986 0.657 0.627 3e-81
Q9LNE3329 Probable fructokinase-2 O no no 0.986 0.689 0.622 8e-81
Q9SID0325 Probable fructokinase-1 O no no 0.986 0.698 0.605 5e-79
>sp|O82616|SCRK5_ARATH Putative fructokinase-5 OS=Arabidopsis thaliana GN=At4g10260 PE=2 SV=1 Back     alignment and function desciption
 Score =  378 bits (970), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 180/228 (78%), Positives = 206/228 (90%), Gaps = 1/228 (0%)

Query: 2   QFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLL 61
           +FGDDEFGHMLVNILK+N V +EGVCFD +ARTALAFVTLKK+GEREFMFYRNPSADMLL
Sbjct: 59  KFGDDEFGHMLVNILKKNGVNSEGVCFDTNARTALAFVTLKKDGEREFMFYRNPSADMLL 118

Query: 62  KDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQ 121
           K+SELN  LIK+AKIFHYGSISLISEPCR+AHMAA+K AKDAGVLLSYDPNVRLPLWPS 
Sbjct: 119 KESELNKDLIKKAKIFHYGSISLISEPCRTAHMAAMKTAKDAGVLLSYDPNVRLPLWPST 178

Query: 122 DAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCG 181
           +AA +GIKSIWN AD+IKVSDDEV FLT+ GDAEKDDVV+SL HD LKLL+VT G KGC 
Sbjct: 179 EAAIEGIKSIWNEADIIKVSDDEVTFLTR-GDAEKDDVVLSLMHDKLKLLIVTDGEKGCR 237

Query: 182 YFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNVKFRL 229
           Y+TKKFKGRVPG++VK +DTTGAGD+FVG+FLVS+ KD +I + + +L
Sbjct: 238 YYTKKFKGRVPGYAVKAVDTTGAGDSFVGAFLVSLGKDGSILDDEGKL 285
May play an important role in maintaining the flux of carbon towards starch formation.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4
>sp|Q0J8G4|SCRK2_ORYSJ Fructokinase-2 OS=Oryza sativa subsp. japonica GN=FRK2 PE=1 SV=1 Back     alignment and function description
>sp|A2YQL4|SCRK2_ORYSI Fructokinase-2 OS=Oryza sativa subsp. indica GN=FRK2 PE=1 SV=2 Back     alignment and function description
>sp|Q6XZ78|SCRK2_MAIZE Fructokinase-2 OS=Zea mays GN=FRK2 PE=1 SV=1 Back     alignment and function description
>sp|Q42896|SCRK2_SOLLC Fructokinase-2 OS=Solanum lycopersicum GN=FRK2 PE=2 SV=2 Back     alignment and function description
>sp|Q7XJ81|SCRK2_SOLHA Fructokinase-2 OS=Solanum habrochaites GN=FRK2 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1B9|SCRK4_ARATH Probable fructokinase-4 OS=Arabidopsis thaliana GN=At3g59480 PE=2 SV=1 Back     alignment and function description
>sp|Q9LNE4|SCRK3_ARATH Probable fructokinase-3 OS=Arabidopsis thaliana GN=At1g06020 PE=2 SV=1 Back     alignment and function description
>sp|Q9LNE3|SCRK2_ARATH Probable fructokinase-2 OS=Arabidopsis thaliana GN=At1g06030 PE=2 SV=1 Back     alignment and function description
>sp|Q9SID0|SCRK1_ARATH Probable fructokinase-1 OS=Arabidopsis thaliana GN=At2g31390 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
21693593204 fructokinase 2 [Citrus unshiu] 0.886 1.0 0.985 1e-115
224127993327 predicted protein [Populus trichocarpa] 0.986 0.694 0.790 1e-104
116831345325 unknown [Arabidopsis thaliana] 0.986 0.698 0.789 1e-102
15234986324 fructokinase [Arabidopsis thaliana] gi|7 0.986 0.700 0.789 1e-102
297813461324 predicted protein [Arabidopsis lyrata su 0.986 0.700 0.789 1e-102
225459906328 PREDICTED: putative fructokinase-5-like 0.986 0.692 0.820 3e-99
297734728313 unnamed protein product [Vitis vinifera] 0.986 0.725 0.820 4e-99
356533723327 PREDICTED: putative fructokinase-5-like 0.986 0.694 0.75 7e-99
356574803327 PREDICTED: putative fructokinase-5-like 0.965 0.678 0.762 8e-98
255560153329 fructokinase, putative [Ricinus communis 0.986 0.689 0.802 2e-96
>gi|21693593|gb|AAM75359.1|AF521003_1 fructokinase 2 [Citrus unshiu] Back     alignment and taxonomy information
 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/204 (98%), Positives = 203/204 (99%)

Query: 2   QFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLL 61
           + GDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLL
Sbjct: 1   KLGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLL 60

Query: 62  KDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQ 121
           KDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQ
Sbjct: 61  KDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQ 120

Query: 122 DAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCG 181
           DAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCG
Sbjct: 121 DAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCG 180

Query: 182 YFTKKFKGRVPGFSVKTIDTTGAG 205
           YFTKKFKGRVPGFSVKT+DTTGAG
Sbjct: 181 YFTKKFKGRVPGFSVKTVDTTGAG 204

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127993|ref|XP_002329228.1| predicted protein [Populus trichocarpa] gi|222871009|gb|EEF08140.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|116831345|gb|ABK28625.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15234986|ref|NP_192764.1| fructokinase [Arabidopsis thaliana] gi|75220282|sp|O82616.1|SCRK5_ARATH RecName: Full=Putative fructokinase-5 gi|3695403|gb|AAC62803.1| contains similarity to the pfkB family of carbohydrate kinases (Pfam: PF00294, E=1.6e-75) [Arabidopsis thaliana] gi|4538955|emb|CAB39779.1| fructokinase-like protein [Arabidopsis thaliana] gi|7267722|emb|CAB78149.1| fructokinase-like protein [Arabidopsis thaliana] gi|91806652|gb|ABE66053.1| pfkB-type carbohydrate kinase family protein [Arabidopsis thaliana] gi|332657460|gb|AEE82860.1| fructokinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297813461|ref|XP_002874614.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297320451|gb|EFH50873.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225459906|ref|XP_002263733.1| PREDICTED: putative fructokinase-5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734728|emb|CBI16962.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356533723|ref|XP_003535409.1| PREDICTED: putative fructokinase-5-like [Glycine max] Back     alignment and taxonomy information
>gi|356574803|ref|XP_003555534.1| PREDICTED: putative fructokinase-5-like [Glycine max] Back     alignment and taxonomy information
>gi|255560153|ref|XP_002521094.1| fructokinase, putative [Ricinus communis] gi|223539663|gb|EEF41245.1| fructokinase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
TAIR|locus:2122789324 AT4G10260 [Arabidopsis thalian 0.986 0.700 0.745 3.6e-89
TAIR|locus:2097553326 AT3G59480 [Arabidopsis thalian 0.986 0.696 0.600 7.7e-71
TAIR|locus:2028987384 AT1G66430 [Arabidopsis thalian 0.982 0.588 0.615 1.3e-70
TAIR|locus:2198821345 AT1G06020 [Arabidopsis thalian 0.986 0.657 0.596 3e-69
TAIR|locus:2165361343 AT5G51830 [Arabidopsis thalian 0.982 0.658 0.603 4.9e-69
TAIR|locus:2198831329 AT1G06030 [Arabidopsis thalian 0.986 0.689 0.592 1.3e-68
TAIR|locus:2061320325 AT2G31390 [Arabidopsis thalian 0.986 0.698 0.578 5.6e-68
TAIR|locus:2080270471 FLN1 "AT3G54090" [Arabidopsis 0.626 0.305 0.376 2.6e-29
UNIPROTKB|Q481A7336 CPS_2648 "Carbohydrate kinase, 0.926 0.633 0.314 9.4e-27
TIGR_CMR|CPS_2648336 CPS_2648 "carbohydrate kinase, 0.926 0.633 0.314 9.4e-27
TAIR|locus:2122789 AT4G10260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 890 (318.4 bits), Expect = 3.6e-89, P = 3.6e-89
 Identities = 170/228 (74%), Positives = 195/228 (85%)

Query:     2 QFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLL 61
             +FGDDEFGHMLVNILK+N V +EGVCFD +ARTALAFVTLKK+GEREFMFYRNPSADMLL
Sbjct:    59 KFGDDEFGHMLVNILKKNGVNSEGVCFDTNARTALAFVTLKKDGEREFMFYRNPSADMLL 118

Query:    62 KDSELNMGLIKQAKIFHYGSISLISEPCRSXXXXXXXXXXXXGVLLSYDPNVRLPLWPSQ 121
             K+SELN  LIK+AKIFHYGSISLISEPCR+            GVLLSYDPNVRLPLWPS 
Sbjct:   119 KESELNKDLIKKAKIFHYGSISLISEPCRTAHMAAMKTAKDAGVLLSYDPNVRLPLWPST 178

Query:   122 DAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCG 181
             +AA +GIKSIWN AD+IKVSDDEV FLT+G DAEKDDVV+SL HD LKLL+VT G KGC 
Sbjct:   179 EAAIEGIKSIWNEADIIKVSDDEVTFLTRG-DAEKDDVVLSLMHDKLKLLIVTDGEKGCR 237

Query:   182 YFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNVKFRL 229
             Y+TKKFKGRVPG++VK +DTTGAGD+FVG+FLVS+ KD +I + + +L
Sbjct:   238 YYTKKFKGRVPGYAVKAVDTTGAGDSFVGAFLVSLGKDGSILDDEGKL 285
GO:0004747 "ribokinase activity" evidence=IEA
GO:0006014 "D-ribose metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016301 "kinase activity" evidence=ISS
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
TAIR|locus:2097553 AT3G59480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028987 AT1G66430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198821 AT1G06020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165361 AT5G51830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198831 AT1G06030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061320 AT2G31390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080270 FLN1 "AT3G54090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q481A7 CPS_2648 "Carbohydrate kinase, PfkB family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2648 CPS_2648 "carbohydrate kinase, PfkB family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6XZ78SCRK2_MAIZE2, ., 7, ., 1, ., 40.750.98690.6776N/Ano
Q0J8G4SCRK2_ORYSJ2, ., 7, ., 1, ., 40.74560.98690.6755yesno
A2YQL4SCRK2_ORYSI2, ., 7, ., 1, ., 40.74560.98690.6755N/Ano
O82616SCRK5_ARATH2, ., 7, ., 1, ., 40.78940.98690.7006yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.1.40.946
3rd Layer2.7.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
PLN02323330 PLN02323, PLN02323, probable fructokinase 1e-158
cd01167295 cd01167, bac_FRK, Fructokinases (FRKs) mainly from 3e-96
cd01166294 cd01166, KdgK, 2-keto-3-deoxygluconate kinase (Kdg 3e-53
PRK09434304 PRK09434, PRK09434, aminoimidazole riboside kinase 3e-48
COG0524311 COG0524, RbsK, Sugar kinases, ribokinase family [C 9e-48
PLN02543496 PLN02543, PLN02543, pfkB-type carbohydrate kinase 4e-43
pfam00294298 pfam00294, PfkB, pfkB family carbohydrate kinase 5e-43
PLN02967581 PLN02967, PLN02967, kinase 1e-39
cd01174292 cd01174, ribokinase, Ribokinase catalyses the phos 1e-28
TIGR02152293 TIGR02152, D_ribokin_bact, ribokinase 2e-25
cd00287196 cd00287, ribokinase_pfkB_like, ribokinase/pfkB sup 1e-16
cd01942279 cd01942, ribokinase_group_A, Ribokinase-like subgr 2e-16
cd01168312 cd01168, adenosine_kinase, Adenosine kinase (AK) c 4e-14
cd01945284 cd01945, ribokinase_group_B, Ribokinase-like subgr 6e-14
PTZ00292326 PTZ00292, PTZ00292, ribokinase; Provisional 3e-13
cd01940264 cd01940, Fructoselysine_kinase_like, Fructoselysin 2e-10
cd01947265 cd01947, Guanosine_kinase_like, Guanosine kinase-l 5e-10
cd01944289 cd01944, YegV_kinase_like, YegV-like sugar kinase 8e-10
PRK11142306 PRK11142, PRK11142, ribokinase; Provisional 1e-09
PLN02341470 PLN02341, PLN02341, pfkB-type carbohydrate kinase 3e-09
cd01172304 cd01172, RfaE_like, RfaE encodes a bifunctional AD 4e-09
TIGR03168303 TIGR03168, 1-PFK, hexose kinase, 1-phosphofructoki 1e-06
cd01164289 cd01164, FruK_PfkB_like, 1-phosphofructokinase (Fr 3e-06
PRK09813260 PRK09813, PRK09813, fructoselysine 6-kinase; Provi 3e-06
COG1105310 COG1105, FruK, Fructose-1-phosphate kinase and rel 6e-06
cd01937254 cd01937, ribokinase_group_D, Ribokinase-like subgr 1e-05
PLN02630335 PLN02630, PLN02630, pfkB-type carbohydrate kinase 1e-05
cd01941288 cd01941, YeiC_kinase_like, YeiC-like sugar kinase 1e-05
PLN02379367 PLN02379, PLN02379, pfkB-type carbohydrate kinase 3e-05
PTZ00247345 PTZ00247, PTZ00247, adenosine kinase; Provisional 6e-05
TIGR03828304 TIGR03828, pfkB, 1-phosphofructokinase 0.001
PLN02548332 PLN02548, PLN02548, adenosine kinase 0.004
>gnl|CDD|215183 PLN02323, PLN02323, probable fructokinase Back     alignment and domain information 
 Score =  440 bits (1134), Expect = e-158
 Identities = 160/228 (70%), Positives = 189/228 (82%), Gaps = 1/228 (0%)

Query: 2   QFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLL 61
           + GDDEFGHML +ILK+N V  EGV FD  ARTALAFVTL+ +GEREFMFYRNPSADMLL
Sbjct: 65  KVGDDEFGHMLADILKKNGVNNEGVRFDPGARTALAFVTLRSDGEREFMFYRNPSADMLL 124

Query: 62  KDSELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQ 121
           ++SEL++ LI++AKIFHYGSISLI+EPCRSAH+AA+K AK+AG LLSYDPN+RLPLWPS 
Sbjct: 125 RESELDLDLIRKAKIFHYGSISLITEPCRSAHLAAMKIAKEAGALLSYDPNLRLPLWPSA 184

Query: 122 DAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCG 181
           +AAR+GI SIW+ AD+IKVSD+EV FLT GGD   DD V+ LWH NLKLLLVT G +GC 
Sbjct: 185 EAAREGIMSIWDEADIIKVSDEEVEFLT-GGDDPDDDTVVKLWHPNLKLLLVTEGEEGCR 243

Query: 182 YFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNVKFRL 229
           Y+TK FKGRV GF VK +DTTGAGDAFVG  L  +AKD ++   + RL
Sbjct: 244 YYTKDFKGRVEGFKVKAVDTTGAGDAFVGGLLSQLAKDLSLLEDEERL 291

Length = 330
>gnl|CDD|238572 cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate Back     alignment and domain information
>gnl|CDD|238571 cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) Back     alignment and domain information
>gnl|CDD|236514 PRK09434, PRK09434, aminoimidazole riboside kinase; Provisional Back     alignment and domain information
>gnl|CDD|223598 COG0524, RbsK, Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215299 PLN02543, PLN02543, pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>gnl|CDD|215842 pfam00294, PfkB, pfkB family carbohydrate kinase Back     alignment and domain information
>gnl|CDD|215521 PLN02967, PLN02967, kinase Back     alignment and domain information
>gnl|CDD|238579 cd01174, ribokinase, Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP Back     alignment and domain information
>gnl|CDD|233751 TIGR02152, D_ribokin_bact, ribokinase Back     alignment and domain information
>gnl|CDD|238177 cd00287, ribokinase_pfkB_like, ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>gnl|CDD|238917 cd01942, ribokinase_group_A, Ribokinase-like subgroup A Back     alignment and domain information
>gnl|CDD|238573 cd01168, adenosine_kinase, Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor Back     alignment and domain information
>gnl|CDD|238920 cd01945, ribokinase_group_B, Ribokinase-like subgroup B Back     alignment and domain information
>gnl|CDD|185541 PTZ00292, PTZ00292, ribokinase; Provisional Back     alignment and domain information
>gnl|CDD|238915 cd01940, Fructoselysine_kinase_like, Fructoselysine kinase-like Back     alignment and domain information
>gnl|CDD|238922 cd01947, Guanosine_kinase_like, Guanosine kinase-like sugar kinases Back     alignment and domain information
>gnl|CDD|238919 cd01944, YegV_kinase_like, YegV-like sugar kinase Back     alignment and domain information
>gnl|CDD|236858 PRK11142, PRK11142, ribokinase; Provisional Back     alignment and domain information
>gnl|CDD|215195 PLN02341, PLN02341, pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>gnl|CDD|238577 cd01172, RfaE_like, RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose Back     alignment and domain information
>gnl|CDD|234133 TIGR03168, 1-PFK, hexose kinase, 1-phosphofructokinase family Back     alignment and domain information
>gnl|CDD|238570 cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases Back     alignment and domain information
>gnl|CDD|182090 PRK09813, PRK09813, fructoselysine 6-kinase; Provisional Back     alignment and domain information
>gnl|CDD|224030 COG1105, FruK, Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|238912 cd01937, ribokinase_group_D, Ribokinase-like subgroup D Back     alignment and domain information
>gnl|CDD|178237 PLN02630, PLN02630, pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>gnl|CDD|238916 cd01941, YeiC_kinase_like, YeiC-like sugar kinase Back     alignment and domain information
>gnl|CDD|178005 PLN02379, PLN02379, pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>gnl|CDD|240328 PTZ00247, PTZ00247, adenosine kinase; Provisional Back     alignment and domain information
>gnl|CDD|234367 TIGR03828, pfkB, 1-phosphofructokinase Back     alignment and domain information
>gnl|CDD|178163 PLN02548, PLN02548, adenosine kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
PLN02323330 probable fructokinase 100.0
PLN02967581 kinase 100.0
cd01167295 bac_FRK Fructokinases (FRKs) mainly from bacteria 100.0
PRK09434304 aminoimidazole riboside kinase; Provisional 100.0
cd01166294 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phospho 100.0
cd01168312 adenosine_kinase Adenosine kinase (AK) catalyzes t 100.0
PLN02543496 pfkB-type carbohydrate kinase family protein 100.0
cd01944289 YegV_kinase_like YegV-like sugar kinase. Found onl 100.0
COG0524311 RbsK Sugar kinases, ribokinase family [Carbohydrat 100.0
PLN02813426 pfkB-type carbohydrate kinase family protein 100.0
PLN02341470 pfkB-type carbohydrate kinase family protein 100.0
PRK11142306 ribokinase; Provisional 100.0
PTZ00247345 adenosine kinase; Provisional 100.0
PLN02379367 pfkB-type carbohydrate kinase family protein 100.0
cd01174292 ribokinase Ribokinase catalyses the phosphorylatio 100.0
PTZ00292326 ribokinase; Provisional 100.0
PRK15074434 inosine/guanosine kinase; Provisional 100.0
cd01942279 ribokinase_group_A Ribokinase-like subgroup A. Fou 100.0
PF00294301 PfkB: pfkB family carbohydrate kinase; InterPro: I 100.0
TIGR02152293 D_ribokin_bact ribokinase. This model describes ri 100.0
cd01945284 ribokinase_group_B Ribokinase-like subgroup B. Fou 100.0
cd01940264 Fructoselysine_kinase_like Fructoselysine kinase-l 100.0
KOG2855330 consensus Ribokinase [Carbohydrate transport and m 100.0
PLN02548332 adenosine kinase 100.0
PRK09850313 pseudouridine kinase; Provisional 100.0
cd01943328 MAK32 MAK32 kinase. MAK32 is a protein found prima 100.0
cd01172304 RfaE_like RfaE encodes a bifunctional ADP-heptose 100.0
PRK09954362 putative kinase; Provisional 100.0
cd01939290 Ketohexokinase Ketohexokinase (fructokinase, KHK) 100.0
cd01947265 Guanosine_kinase_like Guanosine kinase-like sugar 99.98
TIGR03828304 pfkB 1-phosphofructokinase. This enzyme acts in co 99.98
PRK10294309 6-phosphofructokinase 2; Provisional 99.97
TIGR02198315 rfaE_dom_I rfaE bifunctional protein, domain I. Rf 99.97
TIGR01231309 lacC tagatose-6-phosphate kinase. This enzyme is p 99.97
PRK13508309 tagatose-6-phosphate kinase; Provisional 99.97
cd01164289 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 99.97
cd01941288 YeiC_kinase_like YeiC-like sugar kinase. Found in 99.97
TIGR03168303 1-PFK hexose kinase, 1-phosphofructokinase family. 99.97
PRK09813260 fructoselysine 6-kinase; Provisional 99.97
PRK09513312 fruK 1-phosphofructokinase; Provisional 99.97
COG1105310 FruK Fructose-1-phosphate kinase and related fruct 99.97
KOG2854343 consensus Possible pfkB family carbohydrate kinase 99.96
PRK11316 473 bifunctional heptose 7-phosphate kinase/heptose 1- 99.96
cd01946277 ribokinase_group_C Ribokinase-like subgroup C. Fou 99.96
cd01937254 ribokinase_group_D Ribokinase-like subgroup D. Fou 99.96
PLN02630335 pfkB-type carbohydrate kinase family protein 99.94
cd00287196 ribokinase_pfkB_like ribokinase/pfkB superfamily: 99.9
COG2870 467 RfaE ADP-heptose synthase, bifunctional sugar kina 99.88
cd01173254 pyridoxal_pyridoxamine_kinase Pyridoxal kinase pla 99.87
PRK05756286 pyridoxamine kinase; Validated 99.85
PRK12413253 phosphomethylpyrimidine kinase; Provisional 99.84
PRK08176281 pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpy 99.84
PRK07105284 pyridoxamine kinase; Validated 99.83
TIGR00687286 pyridox_kin pyridoxal kinase. ThiD and related pro 99.83
cd01169242 HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrim 99.83
PRK12412268 pyridoxal kinase; Reviewed 99.83
TIGR00097254 HMP-P_kinase phosphomethylpyrimidine kinase. This 99.83
PRK06427266 bifunctional hydroxy-methylpyrimidine kinase/ hydr 99.82
KOG2947308 consensus Carbohydrate kinase [Carbohydrate transp 99.8
PRK12616270 pyridoxal kinase; Reviewed 99.8
PRK08573 448 phosphomethylpyrimidine kinase; Provisional 99.79
PTZ00344296 pyridoxal kinase; Provisional 99.7
PLN02898 502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 99.69
PTZ00347504 phosphomethylpyrimidine kinase; Provisional 99.69
PF08543246 Phos_pyr_kin: Phosphomethylpyrimidine kinase; Inte 99.65
COG0351263 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidi 99.64
PRK14713 530 multifunctional hydroxymethylpyrimidine phosphokin 99.64
PLN02978308 pyridoxal kinase 99.63
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 99.6
cd01170242 THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (T 99.59
cd01171254 YXKO-related B.subtilis YXKO protein of unknown fu 99.56
COG2240281 PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coe 99.5
TIGR00196272 yjeF_cterm yjeF C-terminal region, hydroxyethylthi 99.42
PTZ00493321 phosphomethylpyrimidine kinase; Provisional 99.4
PRK09355263 hydroxyethylthiazole kinase; Validated 99.36
TIGR00694249 thiM hydroxyethylthiazole kinase. This model repre 99.33
KOG2599308 consensus Pyridoxal/pyridoxine/pyridoxamine kinase 99.07
KOG2598 523 consensus Phosphomethylpyrimidine kinase [Coenzyme 98.93
PF02110246 HK: Hydroxyethylthiazole kinase family; InterPro: 98.63
KOG3009614 consensus Predicted carbohydrate kinase, contains 98.62
PRK10565508 putative carbohydrate kinase; Provisional 98.25
COG2145265 ThiM Hydroxyethylthiazole kinase, sugar kinase fam 98.19
PF01256242 Carb_kinase: Carbohydrate kinase; InterPro: IPR000 97.98
KOG3974306 consensus Predicted sugar kinase [Carbohydrate tra 97.55
PRK03979463 ADP-specific phosphofructokinase; Provisional 97.38
COG0063284 Predicted sugar kinase [Carbohydrate transport and 97.32
PF04587444 ADP_PFK_GK: ADP-specific Phosphofructokinase/Gluco 97.3
TIGR02045446 P_fruct_ADP ADP-specific phosphofructokinase. Phos 97.15
PRK14039453 ADP-dependent glucokinase; Provisional 97.01
PRK14038453 ADP-dependent glucokinase; Provisional 96.41
PRK10076213 pyruvate formate lyase II activase; Provisional 93.6
cd01938445 ADPGK_ADPPFK ADP-dependent glucokinase (ADPGK) and 89.41
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Pos 84.97
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 81.24
>PLN02323 probable fructokinase Back     alignment and domain information 
Probab=100.00  E-value=4.3e-38  Score=255.58  Aligned_cols=226  Identities=69%  Similarity=1.144  Sum_probs=192.5

Q ss_pred             CCCCCChhHHHHHHHHHHCCCCccceEecCCCcceEEEEEEecCCeeeEEEecCCCccccccccccCccccccccEEEEc
Q 044512            1 MQFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYG   80 (230)
Q Consensus         1 t~vG~D~~g~~i~~~l~~~gi~~~~i~~~~~~~t~~~~v~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~v~~~   80 (230)
                      ++||+|.+|+.+++.|++.||+++++.+..+.+|+.+++.++++|++++..++..+++..++.++++...+++++++|++
T Consensus        64 ~~vG~D~~g~~i~~~L~~~GI~~~~v~~~~~~~t~~~~i~~~~~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  143 (330)
T PLN02323         64 GKVGDDEFGHMLADILKKNGVNNEGVRFDPGARTALAFVTLRSDGEREFMFYRNPSADMLLRESELDLDLIRKAKIFHYG  143 (330)
T ss_pred             EEecCChhHHHHHHHHHHcCCCCcceEEcCCCCceEEEEEECCCCceeEEeecCCchhccCChHHCChHHHccCCEEEEe
Confidence            47999999999999999999999999888888999999998888999888775456666677777776678899999998


Q ss_pred             cccccCchHHHHHHHHHHHHHHCCCeEEEeCCCCCCCCCCHHHHHHHHHHHhhhCcEEeeCHHHHhhhcCCCCcchHHHH
Q 044512           81 SISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVV  160 (230)
Q Consensus        81 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~l~~~dil~~n~~E~~~l~~~~~~~~~~~~  160 (230)
                      ++.+..+........+++.+++.|.++++||+++...|.+.....+.+.++++++|++++|+.|+..++|....+.++++
T Consensus       144 ~~~~~~~~~~~~~~~~~~~a~~~g~~v~~D~~~~~~~~~~~~~~~~~~~~~l~~~dil~~n~~E~~~l~g~~~~~~~~~~  223 (330)
T PLN02323        144 SISLITEPCRSAHLAAMKIAKEAGALLSYDPNLRLPLWPSAEAAREGIMSIWDEADIIKVSDEEVEFLTGGDDPDDDTVV  223 (330)
T ss_pred             chhccCchHHHHHHHHHHHHHHcCCEEEEcCCCChhhccCHHHHHHHHHHHHHhCCEEEcCHHHHHHHhCCCCccHHHHH
Confidence            87665555556778889999999999999999888888766667788889999999999999999999987654433344


Q ss_pred             HHHHhcCccEEEEEecCCceEEEecCceeeecCccccccCCCCcchHHHHHHHHHHHcCCC-------cccccc
Q 044512          161 MSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDAN-------IFNVKF  227 (230)
Q Consensus       161 ~~l~~~g~~~vvvt~g~~g~~~~~~~~~~~~~~~~~~~~dt~GaGDaf~ag~~~~l~~g~~-------~~~a~~  227 (230)
                       .+...|++.||||+|++|++++.++..+++++++++++||+||||+|+|||++++++|++       +++|.+
T Consensus       224 -~~~~~g~~~vvvt~G~~G~~~~~~~~~~~~~~~~v~vvDttGAGDaf~Agfl~~l~~g~~~~~~~~~l~~al~  296 (330)
T PLN02323        224 -KLWHPNLKLLLVTEGEEGCRYYTKDFKGRVEGFKVKAVDTTGAGDAFVGGLLSQLAKDLSLLEDEERLREALR  296 (330)
T ss_pred             -HHHhcCCCEEEEecCCCceEEEeCCCceEeCCccCCCCCCCCcHHHHHHHHHHHHHcCCccccchHHHHHHHH
Confidence             444579999999999999999988877789988899999999999999999999999987       676654

>PLN02967 kinase Back     alignment and domain information
>cd01167 bac_FRK Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate Back     alignment and domain information
>PRK09434 aminoimidazole riboside kinase; Provisional Back     alignment and domain information
>cd01166 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) Back     alignment and domain information
>cd01168 adenosine_kinase Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor Back     alignment and domain information
>PLN02543 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>cd01944 YegV_kinase_like YegV-like sugar kinase Back     alignment and domain information
>COG0524 RbsK Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02813 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PLN02341 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PRK11142 ribokinase; Provisional Back     alignment and domain information
>PTZ00247 adenosine kinase; Provisional Back     alignment and domain information
>PLN02379 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>cd01174 ribokinase Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP Back     alignment and domain information
>PTZ00292 ribokinase; Provisional Back     alignment and domain information
>PRK15074 inosine/guanosine kinase; Provisional Back     alignment and domain information
>cd01942 ribokinase_group_A Ribokinase-like subgroup A Back     alignment and domain information
>PF00294 PfkB: pfkB family carbohydrate kinase; InterPro: IPR011611 This entry includes a variety of carbohydrate and pyrimidine kinases Back     alignment and domain information
>TIGR02152 D_ribokin_bact ribokinase Back     alignment and domain information
>cd01945 ribokinase_group_B Ribokinase-like subgroup B Back     alignment and domain information
>cd01940 Fructoselysine_kinase_like Fructoselysine kinase-like Back     alignment and domain information
>KOG2855 consensus Ribokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02548 adenosine kinase Back     alignment and domain information
>PRK09850 pseudouridine kinase; Provisional Back     alignment and domain information
>cd01943 MAK32 MAK32 kinase Back     alignment and domain information
>cd01172 RfaE_like RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>cd01939 Ketohexokinase Ketohexokinase (fructokinase, KHK) catalyzes the phosphorylation of fructose to fructose-1-phosphate (F1P), the first step in the metabolism of dietary fructose Back     alignment and domain information
>cd01947 Guanosine_kinase_like Guanosine kinase-like sugar kinases Back     alignment and domain information
>TIGR03828 pfkB 1-phosphofructokinase Back     alignment and domain information
>PRK10294 6-phosphofructokinase 2; Provisional Back     alignment and domain information
>TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I Back     alignment and domain information
>TIGR01231 lacC tagatose-6-phosphate kinase Back     alignment and domain information
>PRK13508 tagatose-6-phosphate kinase; Provisional Back     alignment and domain information
>cd01164 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases Back     alignment and domain information
>cd01941 YeiC_kinase_like YeiC-like sugar kinase Back     alignment and domain information
>TIGR03168 1-PFK hexose kinase, 1-phosphofructokinase family Back     alignment and domain information
>PRK09813 fructoselysine 6-kinase; Provisional Back     alignment and domain information
>PRK09513 fruK 1-phosphofructokinase; Provisional Back     alignment and domain information
>COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2854 consensus Possible pfkB family carbohydrate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>cd01946 ribokinase_group_C Ribokinase-like subgroup C Back     alignment and domain information
>cd01937 ribokinase_group_D Ribokinase-like subgroup D Back     alignment and domain information
>PLN02630 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01173 pyridoxal_pyridoxamine_kinase Pyridoxal kinase plays a key role in the synthesis of the active coenzyme pyridoxal-5'-phosphate (PLP), by catalyzing the phosphorylation of the precursor vitamin B6 in the presence of Zn2+ and ATP Back     alignment and domain information
>PRK05756 pyridoxamine kinase; Validated Back     alignment and domain information
>PRK12413 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK08176 pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine kinase; Reviewed Back     alignment and domain information
>PRK07105 pyridoxamine kinase; Validated Back     alignment and domain information
>TIGR00687 pyridox_kin pyridoxal kinase Back     alignment and domain information
>cd01169 HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate kinase (HMPP-kinase) catalyzes two consecutive phosphorylation steps in the thiamine phosphate biosynthesis pathway, leading to the synthesis of vitamin B1 Back     alignment and domain information
>PRK12412 pyridoxal kinase; Reviewed Back     alignment and domain information
>TIGR00097 HMP-P_kinase phosphomethylpyrimidine kinase Back     alignment and domain information
>PRK06427 bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed Back     alignment and domain information
>KOG2947 consensus Carbohydrate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12616 pyridoxal kinase; Reviewed Back     alignment and domain information
>PRK08573 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PTZ00344 pyridoxal kinase; Provisional Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PTZ00347 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PF08543 Phos_pyr_kin: Phosphomethylpyrimidine kinase; InterPro: IPR013749 This enzyme 2 Back     alignment and domain information
>COG0351 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK14713 multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional Back     alignment and domain information
>PLN02978 pyridoxal kinase Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>cd01170 THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (Thz) kinase catalyzes the phosphorylation of the hydroxylgroup of Thz Back     alignment and domain information
>cd01171 YXKO-related B Back     alignment and domain information
>COG2240 PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00196 yjeF_cterm yjeF C-terminal region, hydroxyethylthiazole kinase-related Back     alignment and domain information
>PTZ00493 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK09355 hydroxyethylthiazole kinase; Validated Back     alignment and domain information
>TIGR00694 thiM hydroxyethylthiazole kinase Back     alignment and domain information
>KOG2599 consensus Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG2598 consensus Phosphomethylpyrimidine kinase [Coenzyme transport and metabolism; Transcription] Back     alignment and domain information
>PF02110 HK: Hydroxyethylthiazole kinase family; InterPro: IPR000417 Thiamine pyrophosphate (TPP), a required cofactor for many enzymes in the cell, is synthesised de novo in Salmonella typhimurium [] Back     alignment and domain information
>KOG3009 consensus Predicted carbohydrate kinase, contains PfkB domain [General function prediction only] Back     alignment and domain information
>PRK10565 putative carbohydrate kinase; Provisional Back     alignment and domain information
>COG2145 ThiM Hydroxyethylthiazole kinase, sugar kinase family [Coenzyme metabolism] Back     alignment and domain information
>PF01256 Carb_kinase: Carbohydrate kinase; InterPro: IPR000631 This family is related to Hydroxyethylthiazole kinase IPR000417 from INTERPRO and PfkB carbohydrate kinase IPR011611 from INTERPRO implying that it also a carbohydrate kinase Back     alignment and domain information
>KOG3974 consensus Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03979 ADP-specific phosphofructokinase; Provisional Back     alignment and domain information
>COG0063 Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04587 ADP_PFK_GK: ADP-specific Phosphofructokinase/Glucokinase conserved region; InterPro: IPR007666 Although ATP is the most common phosphoryl group donor for kinases, certain hyperthermophilic archaea, such as Thermococcus litoralis and Pyrococcus furiosus, utilise unusual ADP-dependent glucokinases (ADPGKs) and phosphofructokinases (ADPPKKs) in their glycolytic pathways [, , ] Back     alignment and domain information
>TIGR02045 P_fruct_ADP ADP-specific phosphofructokinase Back     alignment and domain information
>PRK14039 ADP-dependent glucokinase; Provisional Back     alignment and domain information
>PRK14038 ADP-dependent glucokinase; Provisional Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>cd01938 ADPGK_ADPPFK ADP-dependent glucokinase (ADPGK) and phosphofructokinase (ADPPFK) Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
3ljs_A338 Crystal Structure Of Fructokinase From Xylella Fast 1e-30
3hj6_A327 Structure Of Halothermothrix Orenii Fructokinase (F 2e-21
3ewm_A313 Crystal Structure Of An Uncharacterized Sugar Kinas 6e-21
3gbu_A313 Crystal Structure Of An Uncharacterized Sugar Kinas 2e-19
1tz6_A339 Crystal Structure Of Aminoimidazole Riboside Kinase 2e-18
1tyy_A339 Crystal Structure Of Aminoimidazole Riboside Kinase 6e-18
3iq0_A330 Crystal Structure Of A Putative Ribokinase Ii In Co 2e-14
2v78_A313 Crystal Structure Of Sulfolobus Solfataricus 2-Keto 5e-13
2dcn_A311 Crystal Structure Of 2-Keto-3-Deoxygluconate Kinase 9e-13
2qcv_A332 Crystal Structure Of A Putative 5-Dehydro-2-Deoxygl 2e-12
4du5_A336 Crystal Structure Of Pfkb Protein From Polaromonas 4e-12
3pl2_A319 Crystal Structure Of A 5-Keto-2-Deoxygluconokinase 2e-11
1v19_A309 2-Keto-3-Deoxygluconate Kinase From Thermus Thermop 3e-10
2fv7_A331 Crystal Structure Of Human Ribokinase Length = 331 1e-09
3lhx_A319 Crystal Structure Of A Ketodeoxygluconokinase (Kdgk 2e-08
1rk2_A309 E. Coli Ribokinase Complexed With Ribose And Adp, S 2e-05
2c49_A302 Crystal Structure Of Methanocaldococcus Jannaschii 5e-05
4e69_A328 Crystal Structure Of A Sugar Kinase (Target Efi-502 5e-05
2qhp_A296 Crystal Structure Of Fructokinase (Np_810670.1) Fro 6e-05
3ry7_A304 Crystal Sructure Of Sa239 Length = 304 8e-05
1vm7_A311 Crystal Structure Of Ribokinase (Tm0960) From Therm 8e-05
3kd6_A313 Crystal Structure Of Nucleoside Kinase From Chlorob 6e-04
3h49_A325 Crystal Structure Of A Putative Ribokinase (Apo For 7e-04
>pdb|3LJS|A Chain A, Crystal Structure Of Fructokinase From Xylella Fastidiosa Length = 338 Back     alignment and structure 
Iteration: 1

 Score =  129 bits (324), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 109/216 (50%)
Query: 3   FGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLK 62
            G D FG  L +   +  V T+G+   + A+TALAFV L  +GER F FYR P+AD+L +
Sbjct: 59  LGSDXFGDFLFDSFAEAGVVTDGIVRTSTAKTALAFVALDAHGERSFSFYRPPAADLLFR 118
Query: 63  DSELNMGLIKQAKIFHYGSISLISEPCRSXXXXXXXXXXXXGVLLSYDPNVRLPLWPSQD 122
                      A IFH  S S                    G ++S+D N R  LWP+ +
Sbjct: 119 VEHFQDASFSDALIFHACSNSXTDADIAEVTFEGXRRAQAAGAIVSFDLNFRPXLWPNGE 178
Query: 123 AARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGY 182
                +    + AD++K+S +E+++L     A+ + V+  LW    +LLLVT  A    +
Sbjct: 179 NPASRLWKGLSLADVVKLSSEELDYLANTLAADANAVIQQLWQGRAQLLLVTDAAGPVHW 238
Query: 183 FTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAK 218
           +T+   G VP F V+  D+  AGDAFVG  L + A+
Sbjct: 239 YTRTAGGEVPTFRVQVQDSNAAGDAFVGGXLYTFAQ 274
>pdb|3HJ6|A Chain A, Structure Of Halothermothrix Orenii Fructokinase (Frk) Length = 327 Back     alignment and structure
>pdb|3EWM|A Chain A, Crystal Structure Of An Uncharacterized Sugar Kinase Ph1459 From Pyrococcus Horikoshii Length = 313 Back     alignment and structure
>pdb|3GBU|A Chain A, Crystal Structure Of An Uncharacterized Sugar Kinase Ph1459 From Pyrococcus Horikoshii In Complex With Atp Length = 313 Back     alignment and structure
>pdb|1TZ6|A Chain A, Crystal Structure Of Aminoimidazole Riboside Kinase From Salmonella Enterica Complexed With Aminoimidazole Riboside And Atp Analog Length = 339 Back     alignment and structure
>pdb|1TYY|A Chain A, Crystal Structure Of Aminoimidazole Riboside Kinase From Salmonella Enterica Length = 339 Back     alignment and structure
>pdb|3IQ0|A Chain A, Crystal Structure Of A Putative Ribokinase Ii In Complex With Atp And Mg+2 From E.Coli Length = 330 Back     alignment and structure
>pdb|2V78|A Chain A, Crystal Structure Of Sulfolobus Solfataricus 2-Keto-3- Deoxygluconate Kinase Length = 313 Back     alignment and structure
>pdb|2DCN|A Chain A, Crystal Structure Of 2-Keto-3-Deoxygluconate Kinase From Sulfolobus Tokodaii Complexed With 2-Keto-6-Phosphogluconate (Alpha-Furanose Form) Length = 311 Back     alignment and structure
>pdb|2QCV|A Chain A, Crystal Structure Of A Putative 5-Dehydro-2-Deoxygluconokinase (Iolc) From Bacillus Halodurans C-125 At 1.90 A Resolution Length = 332 Back     alignment and structure
>pdb|4DU5|A Chain A, Crystal Structure Of Pfkb Protein From Polaromonas Sp. Js666 Length = 336 Back     alignment and structure
>pdb|3PL2|A Chain A, Crystal Structure Of A 5-Keto-2-Deoxygluconokinase (Ncgl0155, Cgl0158) From Corynebacterium Glutamicum Atcc 13032 Kitasato At 1.89 A Resolution Length = 319 Back     alignment and structure
>pdb|1V19|A Chain A, 2-Keto-3-Deoxygluconate Kinase From Thermus Thermophilus Length = 309 Back     alignment and structure
>pdb|2FV7|A Chain A, Crystal Structure Of Human Ribokinase Length = 331 Back     alignment and structure
>pdb|3LHX|A Chain A, Crystal Structure Of A Ketodeoxygluconokinase (Kdgk) From Shigella Flexneri Length = 319 Back     alignment and structure
>pdb|1RK2|A Chain A, E. Coli Ribokinase Complexed With Ribose And Adp, Solved In Space Group P212121 Length = 309 Back     alignment and structure
>pdb|2C49|A Chain A, Crystal Structure Of Methanocaldococcus Jannaschii Nucleoside Kinase - An Archaeal Member Of The Ribokinase Family Length = 302 Back     alignment and structure
>pdb|4E69|A Chain A, Crystal Structure Of A Sugar Kinase (Target Efi-502132) From Oceanicola Granulosus, Unliganded Structure Length = 328 Back     alignment and structure
>pdb|2QHP|A Chain A, Crystal Structure Of Fructokinase (Np_810670.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.80 A Resolution Length = 296 Back     alignment and structure
>pdb|3RY7|A Chain A, Crystal Sructure Of Sa239 Length = 304 Back     alignment and structure
>pdb|1VM7|A Chain A, Crystal Structure Of Ribokinase (Tm0960) From Thermotoga Maritima At 2.15 A Resolution Length = 311 Back     alignment and structure
>pdb|3KD6|A Chain A, Crystal Structure Of Nucleoside Kinase From Chlorobium Tepidum In Complex With Amp Length = 313 Back     alignment and structure
>pdb|3H49|A Chain A, Crystal Structure Of A Putative Ribokinase (Apo Form) From E.Coli At 1.8a Resolution Length = 325 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
3ljs_A338 Fructokinase; fructokianse, PSI2, NYSGXRC, structu 1e-104
3iq0_A330 Putative ribokinase II; transferase,kinase,SAD,rib 1e-98
1tyy_A339 Putative sugar kinase; ribokinase fold, alpha/beta 5e-97
3pl2_A319 Sugar kinase, ribokinase family; PFKB PFAM motif, 9e-97
2qcv_A332 Putative 5-dehydro-2-deoxygluconokinase; structura 9e-95
3hj6_A327 Fructokinase, FRK; fructose, transferase, carbohyd 2e-94
4du5_A336 PFKB; structural genomics, PSI-biology, NEW YORK s 4e-90
2qhp_A296 Fructokinase; NP_810670.1, PFKB family carbohydrat 2e-88
4e69_A328 2-dehydro-3-deoxygluconokinase; putative sugar kin 4e-88
3ewm_A313 Uncharacterized sugar kinase PH1459; carbohydrate 4e-88
2v78_A313 Fructokinase; transferase, PFKB family carbohydrat 2e-86
3lhx_A319 Ketodeoxygluconokinase; structural genomics, PSI-2 1e-85
2dcn_A311 Hypothetical fructokinase; 2-keto-3-deoxygluconate 3e-83
1v1a_A309 2-keto-3-deoxygluconate kinase; ATP, structural ge 2e-81
3h49_A325 Ribokinase; transferase,PFKB family,sugar kinase Y 5e-76
2afb_A351 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- 4e-59
3ktn_A346 Carbohydrate kinase, PFKB family; PFKB family,ribo 1e-53
2c4e_A302 Sugar kinase MJ0406; transferase, nucleoside kinas 1e-35
2hlz_A312 Ketohexokinase; non-protein kinase, creatine kinas 2e-32
3kd6_A313 Carbohydrate kinase, PFKB family; nucleoside kinas 6e-31
2rbc_A343 Sugar kinase, AGR_C_4560P; ribokinase family, ATP- 9e-31
3b1n_A326 Ribokinase, putative; rossmann fold, ATP binding, 1e-28
1vk4_A298 PFKB carbohydrate kinase TM0415; structural genomi 7e-28
3kzh_A328 Probable sugar kinase; NYSGXRC, PSI-II, protein st 1e-27
3ry7_A304 Ribokinase; transferase; 2.15A {Staphylococcus aur 1e-27
1rkd_A309 Ribokinase; carbohydrate kinase, ribose, nucleotid 2e-27
1vm7_A311 Ribokinase; TM0960, structural genomics, JCSG, pro 3e-26
2pkf_A334 Adenosine kinase; transferase, S genomics, TB stru 2e-25
3bf5_A306 Ribokinase related protein; 10640157, putative rib 6e-25
2fv7_A331 Ribokinase; structural genomics, structural genomi 1e-24
2nwh_A317 AGR_C_3442P, carbohydrate kinase; structural genom 3e-24
3go6_A310 Ribokinase RBSK; phosphofructokinase, carbohydrate 2e-23
3ikh_A299 Carbohydrate kinase; transferase,kinase,SAD,ribose 2e-23
4e3a_A352 Sugar kinase protein; structural genomics, protein 5e-16
3loo_A365 Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad 3e-15
3otx_A347 Adenosine kinase, putative; AP5A, transferase-tran 4e-14
2abs_A383 Adenosine kinase, AK; ribokinase fold, alpha/beta, 5e-14
1bx4_A345 Protein (adenosine kinase); human adenosine kinase 6e-14
3ie7_A320 LIN2199 protein; phosphofructokinases, transferase 3e-06
2jg5_A306 Fructose 1-phosphate kinase; 1-phosphofructokinase 2e-05
2f02_A323 Tagatose-6-phosphate kinase; LACC, structural geno 2e-05
2abq_A306 Fructose 1-phosphate kinase; dimer, structural gen 2e-05
2jg1_A330 Tagatose-6-phosphate kinase; phosphoryl transfer, 2e-05
3cqd_A309 6-phosphofructokinase isozyme 2; phosphofructokina 5e-04
>3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} PDB: 3lki_A* Length = 338 Back     alignment and structure
 Score =  304 bits (781), Expect = e-104
 Identities = 75/216 (34%), Positives = 114/216 (52%)

Query: 4   GDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKD 63
           G D FG  L +   +  V T+G+   + A+TALAFV L  +GER F FYR P+AD+L + 
Sbjct: 60  GSDMFGDFLFDSFAEAGVVTDGIVRTSTAKTALAFVALDAHGERSFSFYRPPAADLLFRV 119

Query: 64  SELNMGLIKQAKIFHYGSISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDA 123
                     A IFH  S S+            ++ A+ AG ++S+D N R  LWP+ + 
Sbjct: 120 EHFQDASFSDALIFHACSNSMTDADIAEVTFEGMRRAQAAGAIVSFDLNFRPMLWPNGEN 179

Query: 124 ARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLLVTYGAKGCGYF 183
               +    + AD++K+S +E+++L     A+ + V+  LW    +LLLVT  A    ++
Sbjct: 180 PASRLWKGLSLADVVKLSSEELDYLANTLAADANAVIQQLWQGRAQLLLVTDAAGPVHWY 239

Query: 184 TKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKD 219
           T+   G VP F V+  D+  AGDAFVG  L + A+ 
Sbjct: 240 TRTAGGEVPTFRVQVQDSNAAGDAFVGGMLYTFAQQ 275
>3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} PDB: 3k9e_A Length = 330 Back     alignment and structure
>1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Length = 339 Back     alignment and structure
>3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} Length = 319 Back     alignment and structure
>2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Length = 332 Back     alignment and structure
>3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Length = 327 Back     alignment and structure
>4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Length = 336 Back     alignment and structure
>2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Length = 296 Back     alignment and structure
>4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Length = 328 Back     alignment and structure
>3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Length = 313 Back     alignment and structure
>2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Length = 313 Back     alignment and structure
>3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Length = 319 Back     alignment and structure
>2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Length = 311 Back     alignment and structure
>1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Length = 309 Back     alignment and structure
>3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Length = 325 Back     alignment and structure
>2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Length = 351 Back     alignment and structure
>3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Length = 346 Back     alignment and structure
>2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Length = 302 Back     alignment and structure
>2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Length = 312 Back     alignment and structure
>3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Length = 313 Back     alignment and structure
>2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Length = 343 Back     alignment and structure
>3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Length = 326 Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Length = 298 Back     alignment and structure
>3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Length = 328 Back     alignment and structure
>3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Length = 304 Back     alignment and structure
>1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Length = 309 Back     alignment and structure
>1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Length = 311 Back     alignment and structure
>2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Length = 334 Back     alignment and structure
>3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Length = 306 Back     alignment and structure
>2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Length = 331 Back     alignment and structure
>2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Length = 317 Back     alignment and structure
>3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* Length = 310 Back     alignment and structure
>3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* Length = 299 Back     alignment and structure
>4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Length = 352 Back     alignment and structure
>3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Length = 365 Back     alignment and structure
>3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Length = 347 Back     alignment and structure
>2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Length = 383 Back     alignment and structure
>1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Length = 345 Back     alignment and structure
>3ie7_A LIN2199 protein; phosphofructokinases, transferase, glycero ION, PSI-II, NYSGXRC, kinase, structural genomics, structure initiative; HET: ATP; 1.60A {Listeria innocua} PDB: 3hic_A* 3jul_A* 3q1y_A Length = 320 Back     alignment and structure
>2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} Length = 306 Back     alignment and structure
>2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* Length = 323 Back     alignment and structure
>2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 Length = 306 Back     alignment and structure
>2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* Length = 330 Back     alignment and structure
>3cqd_A 6-phosphofructokinase isozyme 2; phosphofructokinases, PFK-2, glycolysis, transferase; HET: ATP; 1.98A {Escherichia coli} PDB: 3n1c_A* Length = 309 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
3ljs_A338 Fructokinase; fructokianse, PSI2, NYSGXRC, structu 100.0
3iq0_A330 Putative ribokinase II; transferase,kinase,SAD,rib 100.0
3pl2_A319 Sugar kinase, ribokinase family; PFKB PFAM motif, 100.0
2qcv_A332 Putative 5-dehydro-2-deoxygluconokinase; structura 100.0
4du5_A336 PFKB; structural genomics, PSI-biology, NEW YORK s 100.0
4e69_A328 2-dehydro-3-deoxygluconokinase; putative sugar kin 100.0
3lhx_A319 Ketodeoxygluconokinase; structural genomics, PSI-2 100.0
3hj6_A327 Fructokinase, FRK; fructose, transferase, carbohyd 100.0
1v1a_A309 2-keto-3-deoxygluconate kinase; ATP, structural ge 100.0
2v78_A313 Fructokinase; transferase, PFKB family carbohydrat 100.0
1tyy_A339 Putative sugar kinase; ribokinase fold, alpha/beta 100.0
3ktn_A346 Carbohydrate kinase, PFKB family; PFKB family,ribo 100.0
4e3a_A352 Sugar kinase protein; structural genomics, protein 100.0
2dcn_A311 Hypothetical fructokinase; 2-keto-3-deoxygluconate 100.0
3h49_A325 Ribokinase; transferase,PFKB family,sugar kinase Y 100.0
3loo_A365 Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad 100.0
3vas_A370 Putative adenosine kinase; ribokinase, enzyme, tra 100.0
3otx_A347 Adenosine kinase, putative; AP5A, transferase-tran 100.0
2rbc_A343 Sugar kinase, AGR_C_4560P; ribokinase family, ATP- 100.0
2qhp_A296 Fructokinase; NP_810670.1, PFKB family carbohydrat 100.0
3ry7_A304 Ribokinase; transferase; 2.15A {Staphylococcus aur 100.0
3ewm_A313 Uncharacterized sugar kinase PH1459; carbohydrate 100.0
2afb_A351 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- 100.0
1rkd_A309 Ribokinase; carbohydrate kinase, ribose, nucleotid 100.0
2fv7_A331 Ribokinase; structural genomics, structural genomi 100.0
4gm6_A351 PFKB family carbohydrate kinase; enzyme function i 100.0
2c4e_A302 Sugar kinase MJ0406; transferase, nucleoside kinas 100.0
1bx4_A345 Protein (adenosine kinase); human adenosine kinase 100.0
3kzh_A328 Probable sugar kinase; NYSGXRC, PSI-II, protein st 100.0
2nwh_A317 AGR_C_3442P, carbohydrate kinase; structural genom 100.0
3uq6_A372 Adenosine kinase, putative; ribokinase, transferas 100.0
2abs_A383 Adenosine kinase, AK; ribokinase fold, alpha/beta, 100.0
3ikh_A299 Carbohydrate kinase; transferase,kinase,SAD,ribose 100.0
3ie7_A320 LIN2199 protein; phosphofructokinases, transferase 100.0
3go6_A310 Ribokinase RBSK; phosphofructokinase, carbohydrate 100.0
1vm7_A311 Ribokinase; TM0960, structural genomics, JCSG, pro 100.0
3b1n_A326 Ribokinase, putative; rossmann fold, ATP binding, 100.0
2pkf_A334 Adenosine kinase; transferase, S genomics, TB stru 100.0
4e84_A352 D-beta-D-heptose 7-phosphate kinase; LPS-heptose b 100.0
3umo_A309 6-phosphofructokinase isozyme 2; glycolysis, trans 100.0
2jg1_A330 Tagatose-6-phosphate kinase; phosphoryl transfer, 100.0
2hlz_A312 Ketohexokinase; non-protein kinase, creatine kinas 100.0
3cqd_A309 6-phosphofructokinase isozyme 2; phosphofructokina 100.0
2abq_A306 Fructose 1-phosphate kinase; dimer, structural gen 100.0
2ajr_A331 Sugar kinase, PFKB family; TM0828, possible 1-phos 99.98
2f02_A323 Tagatose-6-phosphate kinase; LACC, structural geno 99.98
2jg5_A306 Fructose 1-phosphate kinase; 1-phosphofructokinase 99.97
3bf5_A306 Ribokinase related protein; 10640157, putative rib 99.97
3kd6_A313 Carbohydrate kinase, PFKB family; nucleoside kinas 99.97
1vk4_A298 PFKB carbohydrate kinase TM0415; structural genomi 99.97
2yxt_A312 Pyridoxal kinase; beta sheet with alpha helix, met 99.93
2ddm_A283 Pyridoxine kinase; pyridoxal kinase, ribokinase, p 99.93
1ub0_A258 THID, phosphomethylpyrimidine kinase; thiamin bios 99.88
1jxh_A288 Phosphomethylpyrimidine kinase; THID, ribokinase f 99.88
3mbh_A291 Putative phosphomethylpyrimidine kinase; structura 99.86
3pzs_A289 PM kinase, pyridoxamine kinase; structural genomic 99.86
2i5b_A271 Phosphomethylpyrimidine kinase; ADP complex, PDXK, 99.86
3h74_A282 Pyridoxal kinase; PSI-II, structural genomics, pro 99.85
3zs7_A300 Pyridoxal kinase; transferase, sleeping sickness; 99.84
3rm5_A 550 Hydroxymethylpyrimidine/phosphomethylpyrimidine K 99.71
1ekq_A272 Hydroxyethylthiazole kinase; alpha-beta, transfera 99.7
1v8a_A265 Hydroxyethylthiazole kinase; alpha-beta, ATP bindi 99.51
3dzv_A273 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_ 99.36
3bgk_A311 SMU.573, putative uncharacterized protein; alpha/b 99.2
2r3b_A310 YJEF-related protein; putative kinase in the ribok 99.16
3rpz_A279 ADP/ATP-dependent NAD(P)H-hydrate dehydratase; str 98.94
3nl6_A540 Thiamine biosynthetic bifunctional enzyme; thiamin 98.89
3rss_A502 Putative uncharacterized protein; unknown function 98.88
3hpd_A265 Hydroxyethylthiazole kinase; alpha-beta, ATP bindi 98.84
3drw_A474 ADP-specific phosphofructokinase; AMP, GLYC kinase 98.28
1ua4_A455 Glucokinase, ADP-dependent glucokinase; transferas 97.9
3k5w_A475 Carbohydrate kinase; 11206B,helicobacter pylori,PS 97.78
1l2l_A457 ADP-dependent glucokinase; ADP glucokinase APO, tr 97.37
1gc5_A467 ADP-dependent glucokinase; ALFA/beta sandwichs, in 97.19
>3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} SCOP: c.72.1.0 PDB: 3lki_A* Back     alignment and structure
Probab=100.00  E-value=3.6e-41  Score=273.45  Aligned_cols=227  Identities=33%  Similarity=0.568  Sum_probs=191.9

Q ss_pred             CCCCCChhHHHHHHHHHHCCCCccceEecCCCcceEEEEEEecCCeeeEEEecCCCccccccccccCccccccccEEEEc
Q 044512            1 MQFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYG   80 (230)
Q Consensus         1 t~vG~D~~g~~i~~~l~~~gi~~~~i~~~~~~~t~~~~v~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~v~~~   80 (230)
                      ++||+|.+|+.+++.|+++||+++++.+.++.+|+.+++.++++|++++.+++..+++..++++++....+++++++|++
T Consensus        57 g~vG~D~~g~~l~~~l~~~gV~~~~v~~~~~~~T~~~~v~~~~~g~r~~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~  136 (338)
T 3ljs_A           57 GMLGSDMFGDFLFDSFAEAGVVTDGIVRTSTAKTALAFVALDAHGERSFSFYRPPAADLLFRVEHFQDASFSDALIFHAC  136 (338)
T ss_dssp             SEEESSHHHHHHHHHHHHHTCBCTTCEEESSSCCCEEEEECCSTTCCEEEEECSSCGGGGCCGGGCCHHHHHTEEEEEEE
T ss_pred             eeccCCHHHHHHHHHHHHcCCCceeEEEcCCCCceEEEEEECCCCCeEEEEeCCCChhHhCCHhhcCHhHhcCCCEEEEC
Confidence            57999999999999999999999999887888999999999888999988877667777788888876678899999999


Q ss_pred             cccccCchHHHHHHHHHHHHHHCCCeEEEeCCCCCCCCCCHHHHHHHHHHHhhhCcEEeeCHHHHhhhcCCCCcchHHHH
Q 044512           81 SISLISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVV  160 (230)
Q Consensus        81 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~l~~~dil~~n~~E~~~l~~~~~~~~~~~~  160 (230)
                      ++.+..+.+.+.+.++++.+++.+.++++||+.+..+|.+.....+.+.++++++|++++|++|+..|+|....+.++++
T Consensus       137 ~~~l~~~~~~~~~~~~~~~a~~~g~~v~~Dp~~~~~~~~~~~~~~~~~~~ll~~~dil~~N~~E~~~l~g~~~~~~~~~~  216 (338)
T 3ljs_A          137 SNSMTDADIAEVTFEGMRRAQAAGAIVSFDLNFRPMLWPNGENPASRLWKGLSLADVVKLSSEELDYLANTLAADANAVI  216 (338)
T ss_dssp             GGGGSSHHHHHHHHHHHHHHHHTTCEEEEECCCCGGGSCTTCCTHHHHHHHHHTCSEEEEEHHHHHHHHHHHTSCHHHHH
T ss_pred             ChHhcCchHHHHHHHHHHHHHHcCCEEEEECCCChhhcCCHHHHHHHHHHHHhhCCEEEecHHHHHHHhCCCChhHHHHH
Confidence            98888888889999999999999999999999888888655556778889999999999999999999986554434478


Q ss_pred             HHHHhcCccEEEEEecCCceEEEecCceeeecCccccccCCCCcchHHHHHHHHHHHcC--------------CCccccc
Q 044512          161 MSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKD--------------ANIFNVK  226 (230)
Q Consensus       161 ~~l~~~g~~~vvvt~g~~g~~~~~~~~~~~~~~~~~~~~dt~GaGDaf~ag~~~~l~~g--------------~~~~~a~  226 (230)
                      +.|++.|++.||||+|++|+++++++..+++++++++++||+||||+|+|||+++|++|              +++++|.
T Consensus       217 ~~l~~~g~~~vvvT~G~~G~~~~~~~~~~~~~~~~v~vvDttGAGDaF~a~~~~~l~~g~~~~~~~~~~~~~~~~l~~al  296 (338)
T 3ljs_A          217 QQLWQGRAQLLLVTDAAGPVHWYTRTAGGEVPTFRVQVQDSNAAGDAFVGGMLYTFAQQFDDAAALIDFCHDPESIVSTL  296 (338)
T ss_dssp             HHHTTTTCCEEEEEETTEEEEEEESSCEEEECC-----------CHHHHHHHHHHHHHHCSSTHHHHHHHTCHHHHHHHH
T ss_pred             HHHHhcCCCEEEEeeCCCceEEEECCceEEeCCCCCccCCCCCccHHHHHHHHHHHHhCCCcccchhccccChHHHHHHH
Confidence            88988999999999999999999999999999999999999999999999999999999              7888876


Q ss_pred             c
Q 044512          227 F  227 (230)
Q Consensus       227 ~  227 (230)
                      +
T Consensus       297 ~  297 (338)
T 3ljs_A          297 R  297 (338)
T ss_dssp             H
T ss_pred             H
Confidence            4
>3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} SCOP: c.72.1.0 PDB: 3k9e_A Back     alignment and structure
>3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} SCOP: c.72.1.0 Back     alignment and structure
>2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Back     alignment and structure
>4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Back     alignment and structure
>3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Back     alignment and structure
>3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Back     alignment and structure
>1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Back     alignment and structure
>2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Back     alignment and structure
>1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Back     alignment and structure
>3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Back     alignment and structure
>4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Back     alignment and structure
>2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Back     alignment and structure
>3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Back     alignment and structure
>3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Back     alignment and structure
>3vas_A Putative adenosine kinase; ribokinase, enzyme, transferase; HET: ADN; 2.26A {Schistosoma mansoni} PDB: 4dc3_A* 3vaq_A* 3uq6_A* 3uq9_A* Back     alignment and structure
>3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Back     alignment and structure
>2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Back     alignment and structure
>3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Back     alignment and structure
>2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Back     alignment and structure
>2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Back     alignment and structure
>4gm6_A PFKB family carbohydrate kinase; enzyme function initiative, transferase; 2.00A {Listeria grayi dsm 20601} Back     alignment and structure
>2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Back     alignment and structure
>1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Back     alignment and structure
>3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Back     alignment and structure
>2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Back     alignment and structure
>3uq6_A Adenosine kinase, putative; ribokinase, transferase; HET: ADN AMP; 2.30A {Schistosoma mansoni} PDB: 3uq9_A* Back     alignment and structure
>2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Back     alignment and structure
>3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* Back     alignment and structure
>3ie7_A LIN2199 protein; phosphofructokinases, transferase, glycero ION, PSI-II, NYSGXRC, kinase, structural genomics, structure initiative; HET: ATP; 1.60A {Listeria innocua} PDB: 3hic_A* 3jul_A* 3q1y_A Back     alignment and structure
>3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* Back     alignment and structure
>1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Back     alignment and structure
>2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Back     alignment and structure
>4e84_A D-beta-D-heptose 7-phosphate kinase; LPS-heptose biosynthesis, beta-clAsp dimerization region, PF carbohydrate kinase, phosphorylation; HET: MSE ANP M7B GMZ; 2.60A {Burkholderia cenocepacia} PDB: 4e8w_A* 4e8y_A* 4e8z_A* Back     alignment and structure
>3umo_A 6-phosphofructokinase isozyme 2; glycolysis, transferase, PFK, enzyme; HET: ATP; 1.70A {Escherichia coli} PDB: 3n1c_A* 3cqd_A* 3ump_A* 3uqd_A* 3uqe_A* Back     alignment and structure
>2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* Back     alignment and structure
>2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Back     alignment and structure
>3cqd_A 6-phosphofructokinase isozyme 2; phosphofructokinases, PFK-2, glycolysis, transferase; HET: ATP; 1.98A {Escherichia coli} PDB: 3n1c_A* Back     alignment and structure
>2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 Back     alignment and structure
>2ajr_A Sugar kinase, PFKB family; TM0828, possible 1-phosphofructokinase (EC 2.7.1.56), struct genomics, joint center for structural genomics, JCSG; HET: MSE; 2.46A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* Back     alignment and structure
>2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} Back     alignment and structure
>3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>2yxt_A Pyridoxal kinase; beta sheet with alpha helix, metal ION, transferase; 2.00A {Homo sapiens} PDB: 2yxu_A* 3kbi_A* 3keu_A* 4en4_A* 4eoh_A* 2f7k_A 3fhy_A* 3fhx_A* 2ajp_A* 1lhp_A 1lhr_A* 1rft_A* 1rfu_A* 1rfv_A* 1ygj_A* 1ygk_A* 1yhj_A* Back     alignment and structure
>2ddm_A Pyridoxine kinase; pyridoxal kinase, ribokinase, pyridoxal 5'-phosphate, vitamin B6, phosphorylation, transferase; 2.10A {Escherichia coli} PDB: 2ddo_A* 2ddw_A* Back     alignment and structure
>1ub0_A THID, phosphomethylpyrimidine kinase; thiamin biosynthesis, ribokinase family, phosphorylati structural genomics; 2.05A {Thermus thermophilus} SCOP: c.72.1.2 Back     alignment and structure
>1jxh_A Phosphomethylpyrimidine kinase; THID, ribokinase family, phophorylation, transferase; 2.30A {Salmonella typhimurium} SCOP: c.72.1.2 PDB: 1jxi_A* Back     alignment and structure
>3mbh_A Putative phosphomethylpyrimidine kinase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE PXL; 2.00A {Bacteroides thetaiotaomicron} PDB: 3mbj_A* Back     alignment and structure
>3pzs_A PM kinase, pyridoxamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; HET: MSE; 1.89A {Yersinia pestis} SCOP: c.72.1.5 PDB: 1td2_A* 1vi9_A* Back     alignment and structure
>2i5b_A Phosphomethylpyrimidine kinase; ADP complex, PDXK, THID, ribokinase superfamily, transferase; HET: ADP; 2.80A {Bacillus subtilis} Back     alignment and structure
>3h74_A Pyridoxal kinase; PSI-II, structural genomics, prote structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.30A {Lactobacillus plantarum} PDB: 3hyo_A* 3ibq_A* Back     alignment and structure
>3zs7_A Pyridoxal kinase; transferase, sleeping sickness; HET: ATP; 2.00A {Trypanosoma brucei} Back     alignment and structure
>3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Back     alignment and structure
>1ekq_A Hydroxyethylthiazole kinase; alpha-beta, transferase; 1.50A {Bacillus subtilis} SCOP: c.72.1.2 PDB: 1ekk_A 1c3q_A 1esj_A 1esq_A* Back     alignment and structure
>1v8a_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, structural genomics, riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} PDB: 3hpd_A Back     alignment and structure
>3dzv_A 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_816404.1, structural genomics, joint center for structural genomics, JCSG; HET: ADP; 2.57A {Enterococcus faecalis} Back     alignment and structure
>3bgk_A SMU.573, putative uncharacterized protein; alpha/beta three layer sandwich, unknown function; 2.50A {Streptococcus mutans} Back     alignment and structure
>2r3b_A YJEF-related protein; putative kinase in the ribokinase-like superfamily, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Enterococcus faecalis} PDB: 2r3e_A Back     alignment and structure
>3rpz_A ADP/ATP-dependent NAD(P)H-hydrate dehydratase; structural genomics, PSI-biology; HET: AMP NPW; 1.51A {Bacillus subtilis} PDB: 3rph_A* 3rq2_A* 3rq5_A* 3rq6_A* 3rq8_A* 3rqh_A* 3rqq_A* 3rqx_A* 1kyh_A Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>3rss_A Putative uncharacterized protein; unknown function, ADP/ATP-dependent NAD(P)H-hydrate dehydrat lyase; HET: NAP; 1.95A {Thermotoga maritima} PDB: 3rrb_A* 2ax3_A* 3rre_A* 3rrj_A* 3rs8_A* 3rs9_A* 3rsf_A* 3rsg_A* 3rrf_A* 3rsq_A* 3rt7_A* 3rt9_A* 3rta_A* 3rtb_A* 3rtc_A* 3rtd_A* 3rte_A* 3rtg_A* 3ru2_A* 3ru3_A* Back     alignment and structure
>3hpd_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, ATP-binding, M metal-binding, nucleotide-binding, thiamine biosynthesis; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3drw_A ADP-specific phosphofructokinase; AMP, GLYC kinase, magnesium, metal-binding, transferase, structural G PSI-2, protein structure initiative; HET: AMP; 1.90A {Pyrococcus horikoshii} PDB: 1u2x_A Back     alignment and structure
>1ua4_A Glucokinase, ADP-dependent glucokinase; transferase; HET: GLC BGC AMP; 1.90A {Pyrococcus furiosus} SCOP: c.72.1.3 Back     alignment and structure
>3k5w_A Carbohydrate kinase; 11206B,helicobacter pylori,PSI-II, NYSGXRC, , structural genomics, protein structure initiative; 2.60A {Helicobacter pylori} Back     alignment and structure
>1l2l_A ADP-dependent glucokinase; ADP glucokinase APO, transferase; 2.00A {Pyrococcus horikoshii} SCOP: c.72.1.3 Back     alignment and structure
>1gc5_A ADP-dependent glucokinase; ALFA/beta sandwichs, induced-fitting, transferase; HET: ADP; 2.30A {Thermococcus litoralis} SCOP: c.72.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d2afba1333 c.72.1.1 (A:-2-330) 2-keto-3-deoxygluconate kinase 9e-20
d1vk4a_288 c.72.1.1 (A:) Hypothetical protein TM0415 {Thermot 1e-18
d1tyya_304 c.72.1.1 (A:) Aminoimidazole riboside kinase {Salm 3e-15
d1v19a_302 c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Ther 9e-14
d1rkda_306 c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 3e-13
d2absa1350 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma g 2e-10
d2dcna1308 c.72.1.1 (A:2-309) Hypothetical fructokinase ST247 2e-10
d1vm7a_299 c.72.1.1 (A:) Ribokinase {Thermotoga maritima [Tax 2e-10
d1bx4a_342 c.72.1.1 (A:) Adenosine kinase {Human (Homo sapien 4e-10
d2ajra1319 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {T 2e-09
d2abqa1306 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase Fru 2e-09
d2fv7a1308 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapien 4e-09
d2f02a1313 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase Lac 7e-08
d1vi9a_288 c.72.1.5 (A:) Pyridoxamine kinase {Escherichia col 0.002
>d2afba1 c.72.1.1 (A:-2-330) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067 [TaxId: 2336]} Length = 333 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Ribokinase-like
domain: 2-keto-3-deoxygluconate kinase
species: Thermotoga maritima, TM0067 [TaxId: 2336]

 Score = 84.0 bits (206), Expect = 9e-20
 Identities = 36/243 (14%), Positives = 79/243 (32%), Gaps = 24/243 (9%)

Query: 3   FGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLK 62
             ++  G      L++  VKT+ +    +                + ++ R  SA    K
Sbjct: 58  LPNNPLGDAAAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAK 117

Query: 63  DSEL-NMGLIKQAKIFHYGSISL-ISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPS 120
             +     ++  A+ FH+  I+  + +        ALK A + GV +S D N R     +
Sbjct: 118 REDFDWEKILDGARWFHFSGITPPLGKELPLILEDALKVANEKGVTVSCDLNYRAR-LWT 176

Query: 121 QDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDVVMSLWHDNLKLLL-------- 172
           ++ A+  +     + D++  +++++  +        D     L  +    +         
Sbjct: 177 KEEAQKVMIPFMEYVDVLIANEEDIEKVLGISVEGLDLKTGKLNREAYAKIAEEVTRKYN 236

Query: 173 -------------VTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKD 219
                         T        F          + +  +D  GAGD+F G+ +      
Sbjct: 237 FKTVGITLRESISATVNYWSVMVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYGSLMG 296

Query: 220 ANI 222
            + 
Sbjct: 297 FDS 299
>d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Length = 288 Back     information, alignment and structure
>d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} Length = 304 Back     information, alignment and structure
>d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Length = 306 Back     information, alignment and structure
>d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} Length = 350 Back     information, alignment and structure
>d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} Length = 308 Back     information, alignment and structure
>d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Length = 299 Back     information, alignment and structure
>d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Length = 319 Back     information, alignment and structure
>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Length = 306 Back     information, alignment and structure
>d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Length = 313 Back     information, alignment and structure
>d1vi9a_ c.72.1.5 (A:) Pyridoxamine kinase {Escherichia coli [TaxId: 562]} Length = 288 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d1v19a_302 2-keto-3-deoxygluconate kinase {Thermus thermophil 99.98
d2afba1333 2-keto-3-deoxygluconate kinase {Thermotoga maritim 99.97
d1tyya_304 Aminoimidazole riboside kinase {Salmonella typhimu 99.97
d2f02a1313 Tagatose-6-phosphate kinase LacC {Enterococcus fae 99.97
d1bx4a_342 Adenosine kinase {Human (Homo sapiens) [TaxId: 960 99.96
d2abqa1306 Fructose 1-phosphate kinase FruB {Bacillus halodur 99.96
d2dcna1308 Hypothetical fructokinase ST2478 {Sulfolobus tokod 99.96
d2absa1350 Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} 99.96
d1vm7a_299 Ribokinase {Thermotoga maritima [TaxId: 2336]} 99.95
d2ajra1319 Putative sugar kinase TM0828 {Thermotoga maritima 99.95
d1rkda_306 Ribokinase {Escherichia coli [TaxId: 562]} 99.95
d2fv7a1308 Ribokinase {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1vk4a_288 Hypothetical protein TM0415 {Thermotoga maritima [ 99.88
d1vi9a_288 Pyridoxamine kinase {Escherichia coli [TaxId: 562] 99.77
d1ub0a_258 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha 99.63
d1lhpa_309 Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940] 99.59
d1jxha_266 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha 99.58
d1ekqa_269 Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ba 99.18
d1v8aa_264 Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ar 98.95
d1kyha_275 Hypothetical protein YxkO {Bacillus subtilis [TaxI 98.45
d1ua4a_454 ADP-dependent glucokinase {Archaeon Pyrococcus fur 97.75
d1u2xa_450 ADP-specific phosphofructokinase {Pyrococcus horik 97.73
d2ax3a1278 Hypothetical protein TM0922, C-terminal domain {Th 97.73
d1gc5a_467 ADP-dependent glucokinase {Archaeon Thermococcus l 97.53
d1l2la_451 ADP-dependent glucokinase {Archaeon Thermococcus l 97.42
>d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Ribokinase-like
domain: 2-keto-3-deoxygluconate kinase
species: Thermus thermophilus [TaxId: 274]

Probab=99.98  E-value=5.3e-31  Score=208.18  Aligned_cols=219  Identities=24%  Similarity=0.333  Sum_probs=181.0

Q ss_pred             CCCCCChhHHHHHHHHHHCCCCccceEecCCCcceEEEEEEecCCeeeEEEecCCCccccccccccCccccccccEEEEc
Q 044512            1 MQFGDDEFGHMLVNILKQNNVKTEGVCFDNHARTALAFVTLKKNGEREFMFYRNPSADMLLKDSELNMGLIKQAKIFHYG   80 (230)
Q Consensus         1 t~vG~D~~g~~i~~~l~~~gi~~~~i~~~~~~~t~~~~v~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~v~~~   80 (230)
                      |+||+|.+|+.+++.|++.||++.++...+. +++.+++.+.++|++++...........+...+.....+++.++++.+
T Consensus        54 ~~iG~D~~g~~i~~~l~~~gi~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  132 (302)
T d1v19a_          54 GRVGEDELGAMVEERLRAEGVDLTHFRRAPG-FTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLEGVRFLHLS  132 (302)
T ss_dssp             EEEESSHHHHHHHHHHHHHTCBCTTEEEESS-CCCEEEEEECTTSCEEEEEECTTCSGGGCCTTSSCGGGGTTCSEEEEE
T ss_pred             EEEcCCcccccchhhhhhcccccchhccccc-cccccchhhccccccccccccccccchhhccccccHHHHhcccEEeee
Confidence            5799999999999999999999999877665 667777777888888887765555555566666666788999999998


Q ss_pred             cccc-cCchHHHHHHHHHHHHHHCCCeEEEeCCCCCCCCCCHHHHHHHHHHHhhhCcEEeeCHHHHhhhcCCCCcchHHH
Q 044512           81 SISL-ISEPCRSAHMAALKAAKDAGVLLSYDPNVRLPLWPSQDAARDGIKSIWNHADLIKVSDDEVNFLTKGGDAEKDDV  159 (230)
Q Consensus        81 ~~~~-~~~~~~~~~~~~l~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~l~~~dil~~n~~E~~~l~~~~~~~~~~~  159 (230)
                      .+.. ..+...+....+++..++.+.++++|++.+...+. .......+...++.+|++++|++|+..+.+...      
T Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~-~~~~~~~~~~~~~~~d~~~~~~~e~~~~~~~~~------  205 (302)
T d1v19a_         133 GITPALSPEARAFSLWAMEEAKRRGVRVSLDVNYRQTLWS-PEEARGFLERALPGVDLLFLSEEEAELLFGRVE------  205 (302)
T ss_dssp             THHHHHCHHHHHHHHHHHHHHHTTTCEEEEECCCCTTTCC-HHHHHHHHHHHGGGCSEEEEEHHHHHHHHSSTT------
T ss_pred             ccccccchhHHHHHHHHHHHHHhcCCccccccchhhhccc-hhhhHHHHHhhhhhccchhhhhhhhhhhhhhhh------
Confidence            7654 24445577788899999999999999987765554 455666778889999999999999988765432      


Q ss_pred             HHHHHhcCccEEEEEecCCceEEEecCceeeecCccccccCCCCcchHHHHHHHHHHHcCCCccccccc
Q 044512          160 VMSLWHDNLKLLLVTYGAKGCGYFTKKFKGRVPGFSVKTIDTTGAGDAFVGSFLVSVAKDANIFNVKFR  228 (230)
Q Consensus       160 ~~~l~~~g~~~vvvt~g~~g~~~~~~~~~~~~~~~~~~~~dt~GaGDaf~ag~~~~l~~g~~~~~a~~~  228 (230)
                       +.+...+.+.+|||+|++|++++.+++.+++|+++++++||+||||+|+|||+|++++|+++++|.++
T Consensus       206 -~~~~~~~~~~viit~G~~G~~~~~~~~~~~~p~~~v~vvDttGAGDaf~a~~~~~~~~g~~~~~a~~~  273 (302)
T d1v19a_         206 -EALRALSAPEVVLKRGAKGAWAFVDGRRVEGSAFAVEAVDPVGAGDAFAAGYLAGAVWGLPVEERLRL  273 (302)
T ss_dssp             -HHHHHTCCSEEEEECTTSCEEEEETTEEEECCCCCCCCSCCTTHHHHHHHHHHHHHHTTCCHHHHHHH
T ss_pred             -hhhhhccceEEEEecCCCCCccccccccccccccccccCCCCChhHHHHHHHHHHHHcCCCHHHHHHH
Confidence             23445688999999999999999999999999999999999999999999999999999999998653
>d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vi9a_ c.72.1.5 (A:) Pyridoxamine kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub0a_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lhpa_ c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1jxha_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ekqa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v8aa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kyha_ c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ua4a_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u2xa_ c.72.1.3 (A:) ADP-specific phosphofructokinase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ax3a1 c.72.1.4 (A:212-489) Hypothetical protein TM0922, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gc5a_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2la_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure