Citrus Sinensis ID: 044575


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450----
MVSDDHQQCAQSKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTEVHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISALVNSDANLETYRDSWDDHELLQEALQSPHFTQLNAQAFD
cccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEcccccccccccccEEEEEEEcccccEEEEEEcEEEEEccccccccccccccccccccEEEEEEcccccccccccEEEEEcccccHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccEEEcccccEEEEccEEEEccEEEEEEcEEEEcccccccccEEcccccccccccEEEcccccccEEEEEcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHcHHccccccccccccHHHHHHHHHccccccccccccc
ccccccccccccccEEEEccEHHHHHHHHHHHHccccEEEEccccccEccEEEccccccccccccHHHHEEEccccHHcccccccccccccccccccccHHHHHHHHHHHHHHcccHHEEEEEEEEEEEEEcccccccccccccEEEEEEEEcccccEEEEEEEEEEEEccccccccccccccHccccccEEccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHEHcccccccccccccccccccccccccHcHcccccEEEEEcccEEEEEEEEEEcccEEEccccccccEEEEEcccccccHHccccccccccEEEEEcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccEEEcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHcccccccHHHHHHHHHcccHHHccccccc
mvsddhqqcaqsknvcvigagPSGLVAARELRKEGHRVVVLEqnhdvggqwlydpntdqtevhSSVYASLrltspreimgytdfpfvlkkgrdvrrfpghKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVAtghysyprlpsikgmdkWKRKQMHshiyrvpepfrNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISEGLSKVISKhnnlhlhpqidclredgrvtfvdgcwvtadtilyctgysysfpfldtkgivvvdddrvgplyehtfppslapslsfvgiprkligfpfFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFyhsrdvagipkhnthdianfeycdryadqigfphLEEWRKGLCISALVNSDANLETYRDSWDDHELLQEAlqsphftqlnaqafd
MVSDDHQQCAQsknvcvigagPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTEVHSSVYASLrltspreimgytDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVvatghysyprlpsikgMDKWKRKQMHSHiyrvpepfrNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISALVNSDANLETYRDSWDDHELLQEALQSPHFTQLNAQAFD
MVSDDHQQCAQSKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTEVHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIkwvvkskekkadkvveevfdavvvaTGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISALVNSDANLETYRDSWDDHELLQEALQSPHFTQLNAQAFD
*************NVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTEVHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISALVNSDANLETYRDSWDDHELL******************
***************CVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTEVHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISALVNSDANLETYRDSWDDHELLQEALQSPHFTQLNA****
**********QSKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTEVHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISALVNSDANLETYRDSWDDHELLQEALQSPHFTQLNAQAFD
***********SKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTEVHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISALVNSDANLETYRDSWDDHELLQEALQSPHFTQLNA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSDDHQQCAQSKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTEVHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISALVNSDANLETYRDSWDDHELLQEALQSPHFTQLNAQAFD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query454 2.2.26 [Sep-21-2011]
Q9FF12460 Flavin-containing monooxy yes no 0.960 0.947 0.751 0.0
Q9FLK4461 Flavin-containing monooxy no no 0.964 0.950 0.734 0.0
Q9SXD5450 Flavin-containing monooxy no no 0.933 0.942 0.510 1e-122
Q9C8U0450 Flavin-containing monooxy no no 0.933 0.942 0.507 1e-121
Q9SXE1462 Flavin-containing monooxy no no 0.929 0.913 0.465 1e-112
Q9FWW9465 Flavin-containing monooxy no no 0.947 0.924 0.485 1e-110
Q94BV5452 Flavin-containing monooxy no no 0.931 0.935 0.486 1e-108
Q9SS04459 Flavin-containing monooxy no no 0.931 0.921 0.461 1e-106
Q93Y23461 Flavin-containing monooxy no no 0.944 0.930 0.472 1e-105
A8MRX0459 Flavin-containing monooxy no no 0.918 0.908 0.474 1e-103
>sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 Back     alignment and function desciption
 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/455 (75%), Positives = 393/455 (86%), Gaps = 19/455 (4%)

Query: 10  AQSKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTE-------- 61
           ++SK VCVIGAGP+GLV+ARELRKEGH+VVVLEQN DVGGQW Y PN ++ +        
Sbjct: 11  SRSKKVCVIGAGPAGLVSARELRKEGHKVVVLEQNEDVGGQWFYQPNVEEEDPLGRSSGS 70

Query: 62  ------VHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFG 115
                 VHSS+Y+SLRLTSPREIMGY+DFPF+ KKGRD+RRFPGHKELWLYLKDF + FG
Sbjct: 71  INGELKVHSSIYSSLRLTSPREIMGYSDFPFLAKKGRDMRRFPGHKELWLYLKDFSEAFG 130

Query: 116 LREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATGHYSY 175
           LREMIRFN RVE+VG     E    +D+ KW+V+S+EK + KV+EE+FDAVVVATGHYS+
Sbjct: 131 LREMIRFNVRVEFVG-----EKEEEDDVKKWIVRSREKFSGKVMEEIFDAVVVATGHYSH 185

Query: 176 PRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSA 235
           PRLPSIKGMD WKRKQ+HSH+YRVP+PFRNEVVVVVGNS+SGQDISMELVEVAKEVHLSA
Sbjct: 186 PRLPSIKGMDSWKRKQIHSHVYRVPDPFRNEVVVVVGNSMSGQDISMELVEVAKEVHLSA 245

Query: 236 KSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFL 295
           K+L+IS GLSKVISKH NL +HPQI+ L +DG+V FVDG WV ADTILYCTGYSY FPFL
Sbjct: 246 KTLDISSGLSKVISKHPNLLIHPQIESLEDDGKVIFVDGSWVVADTILYCTGYSYKFPFL 305

Query: 296 DTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRT 355
           ++KG + VDDDRVGPL+EHTFPP L+PSLSFVGIPRKLIGFPFFE+QAKWIAQ+LSGK +
Sbjct: 306 ESKGRIEVDDDRVGPLFEHTFPPCLSPSLSFVGIPRKLIGFPFFEAQAKWIAQVLSGKSS 365

Query: 356 LPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISA 415
           LPS DQM+QSV EFY SRD+AG+PKHNTHDIA+F YCD+YAD +GFPHLE+WRK LC+SA
Sbjct: 366 LPSPDQMLQSVDEFYRSRDLAGVPKHNTHDIADFTYCDKYADYVGFPHLEDWRKLLCLSA 425

Query: 416 LVNSDANLETYRDSWDDHELLQEALQSPHFTQLNA 450
           L NS  NLETYRDSWDDHELLQEALQS HFT  N+
Sbjct: 426 LNNSQENLETYRDSWDDHELLQEALQSSHFTNFNS 460




Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 8EC: .EC: -EC: .EC: -
>sp|Q9FLK4|GSXL8_ARATH Flavin-containing monooxygenase FMO GS-OX-like 8 OS=Arabidopsis thaliana GN=At5g61290 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 Back     alignment and function description
>sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 Back     alignment and function description
>sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWW9|GSXL2_ARATH Flavin-containing monooxygenase FMO GS-OX-like 2 OS=Arabidopsis thaliana GN=At1g12200 PE=2 SV=1 Back     alignment and function description
>sp|Q94BV5|GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4 OS=Arabidopsis thaliana GN=At1g62600 PE=2 SV=1 Back     alignment and function description
>sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 Back     alignment and function description
>sp|Q93Y23|GSOX4_ARATH Flavin-containing monooxygenase FMO GS-OX4 OS=Arabidopsis thaliana GN=FMOGS-OX4 PE=2 SV=1 Back     alignment and function description
>sp|A8MRX0|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5 OS=Arabidopsis thaliana GN=FMOGS-OX5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query454
255547297457 dimethylaniline monooxygenase, putative 0.982 0.975 0.818 0.0
224119038458 predicted protein [Populus trichocarpa] 0.962 0.954 0.808 0.0
225457309454 PREDICTED: flavin-containing monooxygena 0.958 0.958 0.789 0.0
297810881460 flavin-containing monooxygenase family p 0.960 0.947 0.756 0.0
15240866460 flavin-containing monooxygenase-like pro 0.960 0.947 0.751 0.0
225457311464 PREDICTED: flavin-containing monooxygena 0.958 0.937 0.753 0.0
297733921 1100 unnamed protein product [Vitis vinifera] 0.958 0.395 0.753 0.0
359491303 796 PREDICTED: flavin-containing monooxygena 0.955 0.545 0.753 0.0
449439639494 PREDICTED: flavin-containing monooxygena 0.991 0.910 0.712 0.0
449487093494 PREDICTED: flavin-containing monooxygena 0.991 0.910 0.708 0.0
>gi|255547297|ref|XP_002514706.1| dimethylaniline monooxygenase, putative [Ricinus communis] gi|223546310|gb|EEF47812.1| dimethylaniline monooxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/462 (81%), Positives = 408/462 (88%), Gaps = 16/462 (3%)

Query: 1   MVSDDHQQCAQSKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQT 60
           MVSD      +SKNVCVIGAGPSGLVAARELRKEGHRVV+LEQ  DVGGQWLY+ N +  
Sbjct: 1   MVSD----FTRSKNVCVIGAGPSGLVAARELRKEGHRVVLLEQKDDVGGQWLYEANVESE 56

Query: 61  ---------EVHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFC 111
                    EVHSS+YASLRL SPREIMGYTDFPF++KKGRD+RRFPGH+ELWLYLKDFC
Sbjct: 57  HPLGKKKFLEVHSSIYASLRLVSPREIMGYTDFPFLVKKGRDMRRFPGHRELWLYLKDFC 116

Query: 112 QRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATG 171
             FGLREMIRFNTRVEYVGMLD  EL   NDL KWVVKSKEK ++K VEEVFDAVVVATG
Sbjct: 117 DSFGLREMIRFNTRVEYVGMLDYDEL--RNDL-KWVVKSKEKDSEKAVEEVFDAVVVATG 173

Query: 172 HYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEV 231
           HYS+P+LP IKGM+ WKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEV
Sbjct: 174 HYSHPKLPFIKGMETWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEV 233

Query: 232 HLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYS 291
           HLS+KSL+++ GLSKVISKH NLHL PQI+ L EDGRV F DG  V ADTILYCTGY+Y+
Sbjct: 234 HLSSKSLDVTLGLSKVISKHENLHLRPQIESLEEDGRVLFADGSQVIADTILYCTGYTYT 293

Query: 292 FPFLDTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLS 351
           FPFLDTKGIVVV+DDRVGPLYEHTFPPSLAPSLSFVGIPRK+IGFPFFESQAKWIAQLLS
Sbjct: 294 FPFLDTKGIVVVEDDRVGPLYEHTFPPSLAPSLSFVGIPRKIIGFPFFESQAKWIAQLLS 353

Query: 352 GKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGL 411
           GKRTLPSWD MM S+K+FY SRD AGIPKHNTHDIA+FEYCDRYAD IGFPHLEEWRK L
Sbjct: 354 GKRTLPSWDDMMLSIKQFYQSRDTAGIPKHNTHDIADFEYCDRYADHIGFPHLEEWRKQL 413

Query: 412 CISALVNSDANLETYRDSWDDHELLQEALQSPHFTQLNAQAF 453
           C+SALVN++ NLETYRDSWDDH+LLQEALQSPHFTQL  Q F
Sbjct: 414 CLSALVNANDNLETYRDSWDDHDLLQEALQSPHFTQLGVQDF 455




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224119038|ref|XP_002317970.1| predicted protein [Populus trichocarpa] gi|222858643|gb|EEE96190.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225457309|ref|XP_002281467.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 9 [Vitis vinifera] gi|147790550|emb|CAN76525.1| hypothetical protein VITISV_022813 [Vitis vinifera] gi|297733920|emb|CBI15167.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297810881|ref|XP_002873324.1| flavin-containing monooxygenase family protein [Arabidopsis lyrata subsp. lyrata] gi|297319161|gb|EFH49583.1| flavin-containing monooxygenase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15240866|ref|NP_196397.1| flavin-containing monooxygenase-like protein [Arabidopsis thaliana] gi|75170143|sp|Q9FF12.1|GSXL9_ARATH RecName: Full=Flavin-containing monooxygenase FMO GS-OX-like 9; AltName: Full=Flavin-monooxygenase glucosinolate S-oxygenase-like 9 gi|10176714|dbj|BAB09944.1| dimethylaniline monooxygenase-like protein [Arabidopsis thaliana] gi|332003823|gb|AED91206.1| flavin-containing monooxygenase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225457311|ref|XP_002281477.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297733921|emb|CBI15168.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491303|ref|XP_002281491.2| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449439639|ref|XP_004137593.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487093|ref|XP_004157494.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 9-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query454
TAIR|locus:2177813460 AT5G07800 "AT5G07800" [Arabido 0.960 0.947 0.714 1.4e-176
TAIR|locus:2163193461 AT5G61290 "AT5G61290" [Arabido 0.964 0.950 0.697 7.4e-169
TAIR|locus:2203866450 AT1G62620 "AT1G62620" [Arabido 0.931 0.94 0.493 3.1e-106
TAIR|locus:2031336450 AT1G63370 "AT1G63370" [Arabido 0.931 0.94 0.490 1.4e-105
TAIR|locus:2201991465 FMO "AT1G12200" [Arabidopsis t 0.588 0.574 0.503 3.6e-103
TAIR|locus:2203921452 AT1G62600 "AT1G62600" [Arabido 0.592 0.595 0.487 7.5e-101
TAIR|locus:2203901461 FMO GS-OX4 "AT1G62570" [Arabid 0.607 0.598 0.469 9.6e-101
TAIR|locus:2203891462 FMO GS-OX3 "AT1G62560" [Arabid 0.590 0.580 0.479 8.6e-100
TAIR|locus:2203911464 NOGC1 "AT1G62580" [Arabidopsis 0.590 0.577 0.476 1.2e-98
TAIR|locus:2201981470 AT1G12130 "AT1G12130" [Arabido 0.462 0.446 0.518 4.9e-98
TAIR|locus:2177813 AT5G07800 "AT5G07800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1715 (608.8 bits), Expect = 1.4e-176, P = 1.4e-176
 Identities = 325/455 (71%), Positives = 370/455 (81%)

Query:    10 AQSKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTE-------- 61
             ++SK VCVIGAGP+GLV+ARELRKEGH+VVVLEQN DVGGQW Y PN ++ +        
Sbjct:    11 SRSKKVCVIGAGPAGLVSARELRKEGHKVVVLEQNEDVGGQWFYQPNVEEEDPLGRSSGS 70

Query:    62 ------VHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFG 115
                   VHSS+Y+SLRLTSPREIMGY+DFPF+ KKGRD+RRFPGHKELWLYLKDF + FG
Sbjct:    71 INGELKVHSSIYSSLRLTSPREIMGYSDFPFLAKKGRDMRRFPGHKELWLYLKDFSEAFG 130

Query:   116 LREMIRFNTRVEYVGMLDCGELIIGNDLIXXXXXXXXXXXXXXXXXXXXXXXXXTGHYSY 175
             LREMIRFN RVE+VG     E    +D+                          TGHYS+
Sbjct:   131 LREMIRFNVRVEFVG-----EKEEEDDVKKWIVRSREKFSGKVMEEIFDAVVVATGHYSH 185

Query:   176 PRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSA 235
             PRLPSIKGMD WKRKQ+HSH+YRVP+PFRNEVVVVVGNS+SGQDISMELVEVAKEVHLSA
Sbjct:   186 PRLPSIKGMDSWKRKQIHSHVYRVPDPFRNEVVVVVGNSMSGQDISMELVEVAKEVHLSA 245

Query:   236 KSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFL 295
             K+L+IS GLSKVISKH NL +HPQI+ L +DG+V FVDG WV ADTILYCTGYSY FPFL
Sbjct:   246 KTLDISSGLSKVISKHPNLLIHPQIESLEDDGKVIFVDGSWVVADTILYCTGYSYKFPFL 305

Query:   296 DTKGIVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRT 355
             ++KG + VDDDRVGPL+EHTFPP L+PSLSFVGIPRKLIGFPFFE+QAKWIAQ+LSGK +
Sbjct:   306 ESKGRIEVDDDRVGPLFEHTFPPCLSPSLSFVGIPRKLIGFPFFEAQAKWIAQVLSGKSS 365

Query:   356 LPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKGLCISA 415
             LPS DQM+QSV EFY SRD+AG+PKHNTHDIA+F YCD+YAD +GFPHLE+WRK LC+SA
Sbjct:   366 LPSPDQMLQSVDEFYRSRDLAGVPKHNTHDIADFTYCDKYADYVGFPHLEDWRKLLCLSA 425

Query:   416 LVNSDANLETYRDSWDDHELLQEALQSPHFTQLNA 450
             L NS  NLETYRDSWDDHELLQEALQS HFT  N+
Sbjct:   426 LNNSQENLETYRDSWDDHELLQEALQSSHFTNFNS 460




GO:0004497 "monooxygenase activity" evidence=ISS
GO:0004499 "N,N-dimethylaniline monooxygenase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
TAIR|locus:2163193 AT5G61290 "AT5G61290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203866 AT1G62620 "AT1G62620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031336 AT1G63370 "AT1G63370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201991 FMO "AT1G12200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203921 AT1G62600 "AT1G62600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203901 FMO GS-OX4 "AT1G62570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203891 FMO GS-OX3 "AT1G62560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203911 NOGC1 "AT1G62580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201981 AT1G12130 "AT1G12130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FF12GSXL9_ARATH1, ., 8, ., -, ., -0.75160.96030.9478yesno
Q9FLK4GSXL8_ARATH1, ., 8, ., -, ., -0.73490.96470.9501nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query454
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 1e-161
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 8e-45
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 1e-32
pfam13738202 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulp 1e-19
TIGR04018316 TIGR04018, Bthiol_YpdA, putative bacillithiol syst 5e-14
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 2e-12
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 3e-11
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 5e-11
TIGR04046400 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxido 2e-09
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 4e-09
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 5e-09
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisio 6e-09
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 3e-08
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 7e-08
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisio 1e-07
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 1e-07
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 3e-07
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 5e-07
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 1e-06
PRK12814652 PRK12814, PRK12814, putative NADPH-dependent gluta 1e-06
TIGR03997645 TIGR03997, mycofact_OYE_2, mycofactocin system Fad 2e-06
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 2e-06
PLN02976 1713 PLN02976, PLN02976, amine oxidase 2e-06
COG1231450 COG1231, COG1231, Monoamine oxidase [Amino acid tr 2e-06
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 2e-06
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 3e-06
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 4e-06
PRK12834 549 PRK12834, PRK12834, putative FAD-binding dehydroge 8e-06
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 9e-06
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 9e-06
PRK02705459 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-gl 1e-05
TIGR02734502 TIGR02734, crtI_fam, phytoene desaturase 1e-05
COG1148622 COG1148, HdrA, Heterodisulfide reductase, subunit 1e-05
TIGR01317485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 2e-05
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 2e-05
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 2e-05
pfam01946229 pfam01946, Thi4, Thi4 family 2e-05
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 3e-05
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 3e-05
TIGR01372 985 TIGR01372, soxA, sarcosine oxidase, alpha subunit 4e-05
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 4e-05
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 4e-05
COG0562374 COG0562, Glf, UDP-galactopyranose mutase [Cell env 5e-05
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 5e-05
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 5e-05
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 7e-05
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 7e-05
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, Y 7e-05
TIGR00292254 TIGR00292, TIGR00292, thiazole biosynthesis enzyme 8e-05
PRK06183500 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr 1e-04
PLN02328 808 PLN02328, PLN02328, lysine-specific histone demeth 1e-04
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 2e-04
TIGR02733492 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD 2e-04
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 2e-04
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 2e-04
COG0771448 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-gluta 3e-04
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 4e-04
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 4e-04
COG3380331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 4e-04
pfam02254116 pfam02254, TrkA_N, TrkA-N domain 5e-04
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamat 5e-04
PLN02268435 PLN02268, PLN02268, probable polyamine oxidase 5e-04
PLN02576496 PLN02576, PLN02576, protoporphyrinogen oxidase 7e-04
TIGR02023388 TIGR02023, BchP-ChlP, geranylgeranyl reductase 7e-04
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 8e-04
COG3573 552 COG3573, COG3573, Predicted oxidoreductase [Genera 9e-04
PLN03000 881 PLN03000, PLN03000, amine oxidase 0.001
COG0569225 COG0569, TrkA, K+ transport systems, NAD-binding c 0.001
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisio 0.001
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 0.001
pfam13454153 pfam13454, NAD_binding_9, FAD-NAD(P)-binding 0.001
TIGR03996633 TIGR03996, mycofact_OYE_1, mycofactocin system Fad 0.001
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 0.001
COG3349485 COG3349, COG3349, Uncharacterized conserved protei 0.002
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 0.002
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 0.002
PRK04308445 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-gl 0.002
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 0.004
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 0.004
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 0.004
PRK07804541 PRK07804, PRK07804, L-aspartate oxidase; Provision 0.004
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisio 0.004
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
 Score =  463 bits (1192), Expect = e-161
 Identities = 210/442 (47%), Positives = 284/442 (64%), Gaps = 26/442 (5%)

Query: 12  SKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTD---------QTEV 62
           S++V VIGAG +GLVAARELR+EGH VVV E+   VGG W+Y P ++         ++ V
Sbjct: 10  SQHVAVIGAGAAGLVAARELRREGHTVVVFEREKQVGGLWVYTPKSESDPLSLDPTRSIV 69

Query: 63  HSSVYASLRLTSPREIMGYTDFPFVLK---KGRDVRRFPGHKELWLYLKDFCQRFGLREM 119
           HSSVY SLR   PRE MGY DFPFV +   + RD RR+P H+E+  YL+DF + F + EM
Sbjct: 70  HSSVYESLRTNLPRECMGYRDFPFVPRFDDESRDSRRYPSHREVLAYLQDFAREFKIEEM 129

Query: 120 IRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATGHYSYPRLP 179
           +RF T V  V  +D           KW V+SK        +E+FDAVVV  GHY+ P + 
Sbjct: 130 VRFETEVVRVEPVDG----------KWRVQSK-NSGGFSKDEIFDAVVVCNGHYTEPNVA 178

Query: 180 SIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLN 239
            I G+  W  KQ+HSH YRVP+PF+NEVVVV+GN  SG DIS ++ +VAKEVH+++++ +
Sbjct: 179 HIPGIKSWPGKQIHSHNYRVPDPFKNEVVVVIGNFASGADISRDIAKVAKEVHIASRA-S 237

Query: 240 ISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKG 299
            S+   K+    NNL +H +ID   EDG + F +G  V ADTI++CTGY Y FPFL+T G
Sbjct: 238 ESDTYEKLPVPQNNLWMHSEIDTAHEDGSIVFKNGKVVYADTIVHCTGYKYHFPFLETNG 297

Query: 300 IVVVDDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSW 359
            + +D++RV PLY+H FPP+LAP LSF+G+P   I F  FE Q+KW+A +LSG+ TLPS 
Sbjct: 298 YMRIDENRVEPLYKHVFPPALAPGLSFIGLPAMGIQFVMFEIQSKWVAAVLSGRVTLPSE 357

Query: 360 DQMMQSVKEFYHSRDVAGIPKHNTHDIANF--EYCDRYADQIGFPHLEEWRKGLCISALV 417
           D+MM+ +  +Y S +  GIPK  TH +     EY +  A++ G P +E WR         
Sbjct: 358 DKMMEDINAWYASLEALGIPKRYTHKLGKIQSEYLNWIAEECGCPLVEHWRYQEVDRGYQ 417

Query: 418 NSDANLETYRDSWDDHELLQEA 439
              +  ETYRD WDD +L++EA
Sbjct: 418 RLVSQPETYRDEWDDDDLMEEA 439


Length = 461

>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|222355 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|188533 TIGR04018, Bthiol_YpdA, putative bacillithiol system oxidoreductase, YpdA family Back     alignment and domain information
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|234447 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxidoreductase, MSMEG_0569 family Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|215527 PLN02976, PLN02976, amine oxidase Back     alignment and domain information
>gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235059 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|233382 TIGR01372, soxA, sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|223636 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme Back     alignment and domain information
>gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|223842 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216949 pfam02254, TrkA_N, TrkA-N domain Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information
>gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|233689 TIGR02023, BchP-ChlP, geranylgeranyl reductase Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|226103 COG3573, COG3573, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178578 PLN03000, PLN03000, amine oxidase Back     alignment and domain information
>gnl|CDD|223643 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|222141 pfam13454, NAD_binding_9, FAD-NAD(P)-binding Back     alignment and domain information
>gnl|CDD|188511 TIGR03996, mycofact_OYE_1, mycofactocin system FadH/OYE family oxidoreductase 1 Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|167786 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236102 PRK07804, PRK07804, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 454
PLN02172461 flavin-containing monooxygenase FMO GS-OX 100.0
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 100.0
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 100.0
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PLN02507499 glutathione reductase 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
PRK06116450 glutathione reductase; Validated 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
PRK06370463 mercuric reductase; Validated 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PLN02546558 glutathione reductase 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.98
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.98
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.98
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.98
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.98
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.98
PTZ00153659 lipoamide dehydrogenase; Provisional 99.97
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.97
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.97
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.97
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.97
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.97
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.97
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.96
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.96
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 99.96
PRK12831464 putative oxidoreductase; Provisional 99.96
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.96
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.96
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.95
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.95
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.95
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.95
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.95
PRK12814652 putative NADPH-dependent glutamate synthase small 99.94
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.94
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.93
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.93
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.93
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.93
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.93
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.93
PRK13984604 putative oxidoreductase; Provisional 99.93
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.93
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.92
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.91
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.91
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.91
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.91
PLN02852491 ferredoxin-NADP+ reductase 99.9
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.9
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.89
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.86
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.76
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.75
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.75
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.74
PTZ00188506 adrenodoxin reductase; Provisional 99.73
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.71
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.63
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.62
COG2081408 Predicted flavoproteins [General function predicti 99.57
PRK09897534 hypothetical protein; Provisional 99.57
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.57
KOG2755334 consensus Oxidoreductase [General function predict 99.51
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.45
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.44
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 99.37
PRK06847375 hypothetical protein; Provisional 99.28
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.26
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.25
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.22
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.19
PRK10157428 putative oxidoreductase FixC; Provisional 99.17
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.16
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.14
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.13
PRK06834488 hypothetical protein; Provisional 99.12
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.1
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.1
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 99.09
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.09
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.08
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.07
PRK08244493 hypothetical protein; Provisional 99.06
PLN02463447 lycopene beta cyclase 99.05
PRK10015429 oxidoreductase; Provisional 99.05
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.05
PRK06184502 hypothetical protein; Provisional 99.05
PRK07045388 putative monooxygenase; Reviewed 99.04
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.03
PRK06126545 hypothetical protein; Provisional 99.03
PRK06185407 hypothetical protein; Provisional 99.02
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.01
PRK07190487 hypothetical protein; Provisional 99.01
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.01
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.0
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.0
PLN02697529 lycopene epsilon cyclase 98.99
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.99
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.99
PRK08163396 salicylate hydroxylase; Provisional 98.99
PRK07538413 hypothetical protein; Provisional 98.98
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.97
PRK08013400 oxidoreductase; Provisional 98.96
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.95
PRK11445351 putative oxidoreductase; Provisional 98.95
PRK09126392 hypothetical protein; Provisional 98.95
PRK07588391 hypothetical protein; Provisional 98.95
PRK06753373 hypothetical protein; Provisional 98.95
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.94
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.94
PLN02661357 Putative thiazole synthesis 98.92
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.92
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.91
PRK07236386 hypothetical protein; Provisional 98.91
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.91
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.89
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.88
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.88
PRK08274466 tricarballylate dehydrogenase; Validated 98.87
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.86
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.86
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.84
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.84
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.83
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.83
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.83
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.82
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.8
PRK06996398 hypothetical protein; Provisional 98.8
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.8
PRK06475400 salicylate hydroxylase; Provisional 98.8
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.8
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.79
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.79
PRK07121492 hypothetical protein; Validated 98.78
PRK05868372 hypothetical protein; Validated 98.77
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.77
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.77
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.76
PRK08294 634 phenol 2-monooxygenase; Provisional 98.76
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.75
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.75
COG0579429 Predicted dehydrogenase [General function predicti 98.73
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.72
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.71
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.7
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.7
PRK08401466 L-aspartate oxidase; Provisional 98.7
PRK11728393 hydroxyglutarate oxidase; Provisional 98.67
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.67
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.66
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.66
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.66
PRK06116450 glutathione reductase; Validated 98.65
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.64
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.64
PRK06175433 L-aspartate oxidase; Provisional 98.64
PRK07804541 L-aspartate oxidase; Provisional 98.64
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.63
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.63
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.63
PRK12839 572 hypothetical protein; Provisional 98.63
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.62
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.62
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.62
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.62
TIGR02053463 MerA mercuric reductase. This model represents the 98.61
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.61
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.61
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.61
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.6
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.6
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.6
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.6
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.6
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.59
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.59
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.58
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.58
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.57
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.57
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.57
PRK06370463 mercuric reductase; Validated 98.57
PLN02985514 squalene monooxygenase 98.56
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.56
PRK08275554 putative oxidoreductase; Provisional 98.56
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.56
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.55
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.55
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.55
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.55
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.55
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.55
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.55
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.54
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.54
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.53
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 98.53
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 98.52
PLN02507499 glutathione reductase 98.52
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.51
PRK07846451 mycothione reductase; Reviewed 98.51
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.51
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.5
PRK13512438 coenzyme A disulfide reductase; Provisional 98.5
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.49
PRK05257494 malate:quinone oxidoreductase; Validated 98.48
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.48
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.47
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.45
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.45
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.45
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.45
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.45
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.44
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.44
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 98.44
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.44
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.43
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.42
PRK08071510 L-aspartate oxidase; Provisional 98.41
PRK07208479 hypothetical protein; Provisional 98.41
PTZ00058561 glutathione reductase; Provisional 98.4
PRK12842 574 putative succinate dehydrogenase; Reviewed 98.4
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.4
PLN02464 627 glycerol-3-phosphate dehydrogenase 98.4
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.39
PLN02815 594 L-aspartate oxidase 98.39
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.39
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.38
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.38
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.38
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.37
PRK14727479 putative mercuric reductase; Provisional 98.37
PRK07512513 L-aspartate oxidase; Provisional 98.36
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.35
PRK09077536 L-aspartate oxidase; Provisional 98.35
PRK14694468 putative mercuric reductase; Provisional 98.34
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 98.34
PTZ00153659 lipoamide dehydrogenase; Provisional 98.32
PRK07395 553 L-aspartate oxidase; Provisional 98.31
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.31
PTZ00052499 thioredoxin reductase; Provisional 98.3
PLN02546558 glutathione reductase 98.3
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.3
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.3
PRK13748561 putative mercuric reductase; Provisional 98.29
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.29
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.28
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.27
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.27
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 98.26
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.26
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.26
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.26
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.24
PLN02268435 probable polyamine oxidase 98.24
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.24
PLN02568539 polyamine oxidase 98.23
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.21
PRK10262321 thioredoxin reductase; Provisional 98.21
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.21
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 98.2
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.19
PRK07233434 hypothetical protein; Provisional 98.18
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 98.16
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.16
PLN02576496 protoporphyrinogen oxidase 98.16
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.15
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.14
PTZ00367567 squalene epoxidase; Provisional 98.14
COG3349485 Uncharacterized conserved protein [Function unknow 98.13
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.13
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.12
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.11
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.1
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.1
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.1
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.09
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.09
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.08
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 98.07
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.06
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.05
COG2081408 Predicted flavoproteins [General function predicti 98.05
PRK12416463 protoporphyrinogen oxidase; Provisional 98.05
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.04
PLN02676487 polyamine oxidase 98.02
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.0
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.0
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.0
PLN02529 738 lysine-specific histone demethylase 1 97.96
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.91
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.85
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.84
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.83
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.82
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 97.82
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.82
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.79
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.78
PLN02487569 zeta-carotene desaturase 97.77
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.76
PRK06847 375 hypothetical protein; Provisional 97.73
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.7
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.7
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.69
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.69
PRK12831464 putative oxidoreductase; Provisional 97.69
PLN03000 881 amine oxidase 97.68
PLN02612567 phytoene desaturase 97.67
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.65
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.64
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 97.63
PLN02976 1713 amine oxidase 97.61
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.6
PRK05868 372 hypothetical protein; Validated 97.6
PRK07236386 hypothetical protein; Provisional 97.6
PRK06753373 hypothetical protein; Provisional 97.57
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 97.53
PRK07588 391 hypothetical protein; Provisional 97.52
PLN02463 447 lycopene beta cyclase 97.52
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.48
KOG2853509 consensus Possible oxidoreductase [General functio 97.47
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 97.47
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.44
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.44
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 97.44
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 97.43
PRK08163 396 salicylate hydroxylase; Provisional 97.42
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.41
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.4
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.36
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.36
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 97.35
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.35
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.35
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.3
PRK12814652 putative NADPH-dependent glutamate synthase small 97.29
PRK02106 560 choline dehydrogenase; Validated 97.28
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.26
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.24
PLN02852 491 ferredoxin-NADP+ reductase 97.23
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.23
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 97.21
KOG3851 446 consensus Sulfide:quinone oxidoreductase/flavo-bin 97.2
PRK06834 488 hypothetical protein; Provisional 97.19
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 97.17
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.14
PRK09126 392 hypothetical protein; Provisional 97.13
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 97.13
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 97.13
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.13
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.12
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.11
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.1
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.08
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.05
PTZ00188 506 adrenodoxin reductase; Provisional 97.04
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.04
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.03
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.01
PRK07045 388 putative monooxygenase; Reviewed 97.01
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.0
PRK06184 502 hypothetical protein; Provisional 97.0
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.99
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 96.99
COG3573 552 Predicted oxidoreductase [General function predict 96.99
PRK08013 400 oxidoreductase; Provisional 96.97
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 96.96
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 96.96
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 96.96
PLN02697 529 lycopene epsilon cyclase 96.95
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.94
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.92
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 96.92
PRK06567 1028 putative bifunctional glutamate synthase subunit b 96.92
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.91
PRK06475 400 salicylate hydroxylase; Provisional 96.85
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 96.85
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.85
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.84
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.84
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.84
PRK07190 487 hypothetical protein; Provisional 96.83
PRK08244 493 hypothetical protein; Provisional 96.83
PRK13984604 putative oxidoreductase; Provisional 96.82
KOG4254 561 consensus Phytoene desaturase [Coenzyme transport 96.79
PRK09897 534 hypothetical protein; Provisional 96.79
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.78
PRK10157 428 putative oxidoreductase FixC; Provisional 96.78
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 96.71
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 96.71
KOG2755334 consensus Oxidoreductase [General function predict 96.7
KOG4716503 consensus Thioredoxin reductase [Posttranslational 96.68
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 96.64
COG2303542 BetA Choline dehydrogenase and related flavoprotei 96.64
KOG2960328 consensus Protein involved in thiamine biosynthesi 96.6
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.6
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 96.59
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.57
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.56
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.55
PLN02661357 Putative thiazole synthesis 96.55
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.53
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 96.5
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.5
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 96.47
PLN02785587 Protein HOTHEAD 96.47
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.46
PRK11445 351 putative oxidoreductase; Provisional 96.45
PRK10015 429 oxidoreductase; Provisional 96.43
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.4
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 96.36
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 96.36
PRK07538 413 hypothetical protein; Provisional 96.35
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 96.27
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 96.24
PRK06719157 precorrin-2 dehydrogenase; Validated 96.23
PRK08132 547 FAD-dependent oxidoreductase; Provisional 96.22
PRK06185 407 hypothetical protein; Provisional 96.21
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 96.2
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 96.15
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 96.15
TIGR00275 400 flavoprotein, HI0933 family. The model when search 96.14
PRK06996 398 hypothetical protein; Provisional 96.1
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 96.06
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 95.98
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 95.97
PRK06126 545 hypothetical protein; Provisional 95.92
KOG0399 2142 consensus Glutamate synthase [Amino acid transport 95.92
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 95.88
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.87
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 95.83
COG0579 429 Predicted dehydrogenase [General function predicti 95.82
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 95.81
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.79
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 95.78
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.77
KOG2852380 consensus Possible oxidoreductase [General functio 95.77
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 95.66
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.6
PRK06719157 precorrin-2 dehydrogenase; Validated 95.56
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.52
KOG2614 420 consensus Kynurenine 3-monooxygenase and related f 95.44
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.35
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 95.33
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.32
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.3
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 95.23
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 95.21
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.2
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.18
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 95.15
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 95.07
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.02
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 94.97
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 94.93
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.82
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 94.8
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.72
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 94.72
PRK08294 634 phenol 2-monooxygenase; Provisional 94.7
KOG2820 399 consensus FAD-dependent oxidoreductase [General fu 94.65
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 94.64
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.64
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 94.55
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.55
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 94.5
PRK04148134 hypothetical protein; Provisional 94.48
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
Probab=100.00  E-value=1.4e-75  Score=582.87  Aligned_cols=429  Identities=49%  Similarity=0.860  Sum_probs=379.4

Q ss_pred             hccCCCcEEEECcChHHHHHHHHHHHcCCcEEEEeeCCCCCcccccCCCCCCC---------CccccccccceecCCccc
Q 044575            8 QCAQSKNVCVIGAGPSGLVAARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQT---------EVHSSVYASLRLTSPREI   78 (454)
Q Consensus         8 ~~~~~~~VvIIGaG~aGl~aA~~l~~~g~~v~vie~~~~~GG~w~~~~~~~~~---------~~~~~~~~~~~~~~~~~~   78 (454)
                      .+...++|+|||||+|||+||++|++.|++|+|||+++.+||+|++.+....+         ..++++|.++++|+|+..
T Consensus         6 ~~~~~~~VaIIGAG~aGL~aA~~l~~~G~~v~vfE~~~~vGG~W~~~~~~~~d~~~~~~~~~~~~s~~Y~~L~tn~p~~~   85 (461)
T PLN02172          6 NPINSQHVAVIGAGAAGLVAARELRREGHTVVVFEREKQVGGLWVYTPKSESDPLSLDPTRSIVHSSVYESLRTNLPREC   85 (461)
T ss_pred             cCCCCCCEEEECCcHHHHHHHHHHHhcCCeEEEEecCCCCcceeecCCCcCCCccccCCCCcccchhhhhhhhccCCHhh
Confidence            45667999999999999999999999999999999999999999998654321         356889999999999999


Q ss_pred             cccCCCCCCCCC---CCCCCCCCCHHHHHHHHHHHHHHhCCCccEEeCeEEEEEEEcCCCccccCCcCCcEEEEEeecCC
Q 044575           79 MGYTDFPFVLKK---GRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKA  155 (454)
Q Consensus        79 ~~~~~~~~~~~~---~~~~~~~~~~~~~~~yl~~~~~~~~~~~~i~~~~~V~~v~~~~~~~~~~~~~~~~~~v~~~~~~~  155 (454)
                      |+|+|||++...   ..+.+.||++.++.+||++|++++++.++|+|+++|++|++.+.          +|+|++.+++ 
T Consensus        86 m~f~dfp~~~~~~~~~~~~~~fp~~~ev~~YL~~~a~~fgl~~~I~~~t~V~~V~~~~~----------~w~V~~~~~~-  154 (461)
T PLN02172         86 MGYRDFPFVPRFDDESRDSRRYPSHREVLAYLQDFAREFKIEEMVRFETEVVRVEPVDG----------KWRVQSKNSG-  154 (461)
T ss_pred             ccCCCCCCCcccccccCcCCCCCCHHHHHHHHHHHHHHcCCcceEEecCEEEEEeecCC----------eEEEEEEcCC-
Confidence            999999997521   12457899999999999999999999999999999999987532          8999987643 


Q ss_pred             CeEEEEEeCEEEEccCCCCCCCCCCCCCcCCccceeEEeecCCCCCCCCCCeEEEEcCCCCHHHHHHHHhhhcCeEEEec
Q 044575          156 DKVVEEVFDAVVVATGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSA  235 (454)
Q Consensus       156 ~~~~~~~~d~vViAtG~~~~p~~p~i~G~~~~~~~~~~~~~~~~~~~~~~k~vvVVG~G~sg~e~A~~l~~~~~~V~l~~  235 (454)
                      +...+..||+||||||+++.|++|.+||++.|.|..+|++.|+.++.+++|+|+|||+|.||+|+|.+|+..+++|+++.
T Consensus       155 ~~~~~~~~d~VIvAtG~~~~P~~P~ipG~~~f~G~~iHs~~yr~~~~~~gk~VvVVG~G~Sg~diA~~L~~~a~~V~l~~  234 (461)
T PLN02172        155 GFSKDEIFDAVVVCNGHYTEPNVAHIPGIKSWPGKQIHSHNYRVPDPFKNEVVVVIGNFASGADISRDIAKVAKEVHIAS  234 (461)
T ss_pred             CceEEEEcCEEEEeccCCCCCcCCCCCCcccCCceEEEecccCCccccCCCEEEEECCCcCHHHHHHHHHHhCCeEEEEE
Confidence            23345689999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCcCccchhhhccCCCeEEcCceeEEecCCcEEEeCCCEEeeceEEEccCcccCCcCCCCCCceeeCCCCcccccCcc
Q 044575          236 KSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDDRVGPLYEHT  315 (454)
Q Consensus       236 r~~~~~~~~~~~l~~~~~i~~~~~v~~v~~~~~v~~~dG~~i~~D~vI~atG~~~~~~~l~~~g~i~v~~~~~~~~~~~~  315 (454)
                      |+..... ..+......+++.+..|..+.+++.|+|+||+.+++|.||+||||++++|||+..+.+.+|++.+.++|+|+
T Consensus       235 r~~~~~~-~~~~~~~~~~v~~~~~I~~~~~~g~V~f~DG~~~~~D~Ii~~TGy~~~~pfL~~~~~i~v~~~~v~~Ly~~~  313 (461)
T PLN02172        235 RASESDT-YEKLPVPQNNLWMHSEIDTAHEDGSIVFKNGKVVYADTIVHCTGYKYHFPFLETNGYMRIDENRVEPLYKHV  313 (461)
T ss_pred             eeccccc-cccCcCCCCceEECCcccceecCCeEEECCCCCccCCEEEECCcCCccccccCcccceeeCCCcchhhHHhh
Confidence            9765421 122222334677788888877777899999999999999999999999999998788889999888999999


Q ss_pred             cCCCCCCCceEecccccccchhHHHHHHHHHHHHHcCCCCCCCHHHHHHHHHHHHhhhhhcCCCCCcccccc--cHHHHH
Q 044575          316 FPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNTHDIA--NFEYCD  393 (454)
Q Consensus       316 ~~~~~~p~l~~iG~~~~~~~~~~a~~qa~~~a~~i~g~~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~y~~  393 (454)
                      |++...|+|+|+|.+..+.+++++|+||+|+|++++|+..||+.++|++++..+.+.++..+.++++.|.+.  ++.|+|
T Consensus       314 f~~~~~p~LafiG~~~~~~~f~~~E~Qa~~~a~v~sG~~~LPs~~~m~~~~~~~~~~~~~~g~~~r~~h~~~~~~~~y~~  393 (461)
T PLN02172        314 FPPALAPGLSFIGLPAMGIQFVMFEIQSKWVAAVLSGRVTLPSEDKMMEDINAWYASLEALGIPKRYTHKLGKIQSEYLN  393 (461)
T ss_pred             cCCCCCCcEEEEeccccccCchhHHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHHHHHHhcCCCCceeEEcCccHHHHHH
Confidence            998656999999999878889999999999999999999999999999999999888777788888889875  679999


Q ss_pred             HHHHHcCCCCchHHHHHHHHHHhhCCccccccccCCCCChHHHHHHhcCCCCccc
Q 044575          394 RYADQIGFPHLEEWRKGLCISALVNSDANLETYRDSWDDHELLQEALQSPHFTQL  448 (454)
Q Consensus       394 ~l~~~~g~~~~~~~~~~l~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~  448 (454)
                      +|++.+|++++++|++++++....+...++..||+.|++.++++|++++.....|
T Consensus       394 ~la~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~  448 (461)
T PLN02172        394 WIAEECGCPLVEHWRYQEVDRGYQRLVSQPETYRDEWDDDDLMEEAYEDFARKKL  448 (461)
T ss_pred             HHHHHhCCCCCHHHHHHHHHHHHHHHHhCHHhhccccccccceeecccccceEEE
Confidence            9999999999999999999999999999999999999999999999998765443



>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query454
2xlp_A461 Joint-Functions Of Protein Residues And Nadp(H) In 2e-31
2vq7_A461 Bacterial Flavin-Containing Monooxygenase In Comple 2e-31
2xls_A461 Joint-Functions Of Protein Residues And Nadp(H) In 3e-31
2xve_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 3e-31
2xlr_A461 Joint-Functions Of Protein Residues And Nadp(H) In 3e-31
2xvi_A464 Crystal Structure Of The Mutant Bacterial Flavin Co 4e-31
2xvf_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 1e-29
1vqw_A457 Crystal Structure Of A Protein With Similarity To F 3e-26
2gv8_A447 Crystal Structure Of Flavin-Containing Monooxygenas 4e-26
3uov_A 545 Crystal Structure Of Otemo (Fad Bound Form 1) Lengt 4e-10
4a9w_A357 Flavin-Containing Monooxygenase From Stenotrophomon 2e-09
2ylx_A 542 Snapshots Of Enzymatic Baeyer-Villiger Catalysis: O 8e-08
2ylz_A 542 Snapshots Of Enzymatic Baeyer-Villiger Catalysis: O 1e-07
2ylw_A 542 Snapshots Of Enzymatic Baeyer-Villiger Catalysis: O 1e-07
1w4x_A 542 Phenylacetone Monooxygenase, A Baeyer-villiger Mono 1e-07
4ap1_A549 Oxidized Steroid Monooxygenase Bound To Nadp Length 6e-06
4aos_A549 Oxidized Steroid Monooxygenase Bound To Nadp Length 6e-06
4ap3_A549 Oxidized Steroid Monooxygenase Bound To Nadp Length 6e-06
3rha_A482 The Crystal Structure Of Oxidoreductase From Arthro 8e-06
3gf4_A390 Structure Of Udp-Galactopyranose Mutase Bound To Ud 8e-05
2bi7_A384 Udp-Galactopyranose Mutase From Klebsiella Pneumoni 8e-05
1wam_A384 Structure Of Udp-Galactopyranose Mutase From Klebsi 8e-05
2yg3_A453 Structure-Based Redesign Of Cofactor Binding In Put 1e-04
2yg5_A453 Structure-Based Redesign Of Cofactor Binding In Put 1e-04
2yg7_A453 Structure-Based Redesign Of Cofactor Binding In Put 1e-04
4e0v_A497 Structure Of L-Amino Acid Oxidase From The B. Jarar 2e-04
3kve_A486 Structure Of Native L-Amino Acid Oxidase From Viper 4e-04
2jae_A489 The Structure Of L-Amino Acid Oxidase From Rhodococ 5e-04
1reo_A486 L-Amino Acid Oxidase From Agkistrodon Halys Pallas 8e-04
1ps9_A671 The Crystal Structure And Reaction Mechanism Of E. 9e-04
>pdb|2XLP|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen- Activation By Flavin-Containing Monooxygenase: Asn78ser Mutant Length = 461 Back     alignment and structure

Iteration: 1

Score = 134 bits (336), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 99/367 (26%), Positives = 172/367 (46%), Gaps = 32/367 (8%) Query: 10 AQSKNVCVIGAGPSGLV------AARELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTE-- 61 + + + ++GAGPSG+ +A+E E +V E+ D GGQW Y T E Sbjct: 5 SMATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENG 64 Query: 62 --VHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREM 119 VHSS+Y L + P+E + + D+ F G+ + +P + LW Y+K ++ G+R+ Sbjct: 65 EPVHSSMYRYLWSSGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKY 124 Query: 120 IRFNTRVEYVGMLDCGELIIGNDLIXXXXXXXXXXXXXXXXXXXXXXXXXTGHYSYPRLP 179 IRFNT V +V D TGH+S P +P Sbjct: 125 IRFNTAVRHVE--------FNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVP 176 Query: 180 SIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEV-AKEVHLSAKSL 238 +G +K+ + +H+H +R F+++ V++VG+S S +DI + + AK++ ++ Sbjct: 177 EFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTA 236 Query: 239 NISEGLSKVISKHNNLHLHPQIDCLREDGR-VTFVDGCWVTADTILYCTGYSYSFPFLDT 297 + + + NL +R D F DG D I+ CTGY + FPFL+ Sbjct: 237 PMGYKWPENWDERPNL--------VRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLN- 287 Query: 298 KGIVVVDDDRVGP--LYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRT 355 + +V ++R+ P LY+ P ++G+ + F F++QA + ++ G+ Sbjct: 288 DDLRLVTNNRLWPLNLYKGVVWED-NPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLP 346 Query: 356 LPSWDQM 362 LPS ++M Sbjct: 347 LPSKEEM 353
>pdb|2VQ7|A Chain A, Bacterial Flavin-Containing Monooxygenase In Complex With Nadp: Native Data Length = 461 Back     alignment and structure
>pdb|2XLS|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78lys Mutant Length = 461 Back     alignment and structure
>pdb|2XVE|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|2XLR|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78asp Mutant Length = 461 Back     alignment and structure
>pdb|2XVI|A Chain A, Crystal Structure Of The Mutant Bacterial Flavin Containing Monooxygenase (Y207s) Length = 464 Back     alignment and structure
>pdb|2XVF|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|1VQW|A Chain A, Crystal Structure Of A Protein With Similarity To Flavin- Containing Monooxygenases And To Mammalian Dimethylalanine Monooxygenases Length = 457 Back     alignment and structure
>pdb|2GV8|A Chain A, Crystal Structure Of Flavin-Containing Monooxygenase (Fmo) From S.Pombe And Nadph Cofactor Complex Length = 447 Back     alignment and structure
>pdb|3UOV|A Chain A, Crystal Structure Of Otemo (Fad Bound Form 1) Length = 545 Back     alignment and structure
>pdb|4A9W|A Chain A, Flavin-Containing Monooxygenase From Stenotrophomonas Maltophilia Length = 357 Back     alignment and structure
>pdb|2YLX|A Chain A, Snapshots Of Enzymatic Baeyer-Villiger Catalysis: Oxygen Activation And Intermediate Stabilization: Asp66ala Mutant In Complex With Nadp And Mes Length = 542 Back     alignment and structure
>pdb|2YLZ|A Chain A, Snapshots Of Enzymatic Baeyer-Villiger Catalysis: Oxygen Activation And Intermediate Stabilization: Met446gly Mutant Length = 542 Back     alignment and structure
>pdb|2YLW|A Chain A, Snapshots Of Enzymatic Baeyer-Villiger Catalysis: Oxygen Activation And Intermediate Stabilization: Arg337lys Mutant In Complex With Mes Length = 542 Back     alignment and structure
>pdb|1W4X|A Chain A, Phenylacetone Monooxygenase, A Baeyer-villiger Monooxygenase Length = 542 Back     alignment and structure
>pdb|4AP1|A Chain A, Oxidized Steroid Monooxygenase Bound To Nadp Length = 549 Back     alignment and structure
>pdb|4AOS|A Chain A, Oxidized Steroid Monooxygenase Bound To Nadp Length = 549 Back     alignment and structure
>pdb|4AP3|A Chain A, Oxidized Steroid Monooxygenase Bound To Nadp Length = 549 Back     alignment and structure
>pdb|3RHA|A Chain A, The Crystal Structure Of Oxidoreductase From Arthrobacter Aurescens Length = 482 Back     alignment and structure
>pdb|3GF4|A Chain A, Structure Of Udp-Galactopyranose Mutase Bound To Udp-Glucose Length = 390 Back     alignment and structure
>pdb|2BI7|A Chain A, Udp-Galactopyranose Mutase From Klebsiella Pneumoniae Oxidised Fad Length = 384 Back     alignment and structure
>pdb|1WAM|A Chain A, Structure Of Udp-Galactopyranose Mutase From Klebsiella Pneumoniae With Fadh- Length = 384 Back     alignment and structure
>pdb|2YG3|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: Wild Type Enzyme Length = 453 Back     alignment and structure
>pdb|2YG5|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c Mutant Length = 453 Back     alignment and structure
>pdb|2YG7|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c-A396t-Q431g Triple Mutant Length = 453 Back     alignment and structure
>pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 Back     alignment and structure
>pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 Back     alignment and structure
>pdb|2JAE|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus Opacus In The Unbound State Length = 489 Back     alignment and structure
>pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 Back     alignment and structure
>pdb|1PS9|A Chain A, The Crystal Structure And Reaction Mechanism Of E. Coli 2,4- Dienoyl Coa Reductase Length = 671 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query454
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 1e-138
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 1e-134
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 4e-62
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 4e-41
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 3e-26
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 1e-24
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 9e-24
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 1e-23
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 3e-19
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 1e-18
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 8e-18
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 3e-16
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 5e-12
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 8e-12
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 1e-11
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 1e-11
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 3e-11
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 5e-11
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 7e-11
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 7e-11
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 1e-10
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 1e-10
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 2e-10
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 4e-10
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 4e-10
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 1e-09
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 2e-09
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 2e-09
2gqf_A401 Hypothetical protein HI0933; structural genomics, 2e-09
3atr_A453 Conserved archaeal protein; saturating double bond 2e-09
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 2e-09
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 4e-09
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 4e-09
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 6e-09
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 8e-09
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 9e-09
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 2e-08
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 3e-08
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 3e-08
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 3e-08
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 4e-08
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 4e-08
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 4e-08
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 4e-08
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 5e-08
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 7e-08
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 8e-08
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 1e-07
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 2e-07
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 2e-07
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 2e-07
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 2e-07
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 2e-07
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 2e-07
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 2e-07
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 3e-07
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 3e-07
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 3e-07
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 3e-07
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 5e-07
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 6e-07
3dme_A369 Conserved exported protein; structural genomics, P 6e-07
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 8e-07
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 9e-07
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 9e-07
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 2e-06
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 2e-06
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 2e-06
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 5e-06
2bry_A497 NEDD9 interacting protein with calponin homology a 6e-06
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 6e-06
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 7e-06
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 7e-06
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 9e-06
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 1e-05
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 1e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 1e-05
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 2e-05
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 2e-05
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 2e-05
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 3e-05
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 3e-05
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 3e-05
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 4e-05
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 4e-05
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 4e-05
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 4e-05
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 4e-05
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 5e-05
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 5e-05
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 6e-05
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 7e-05
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 8e-05
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 9e-05
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 1e-04
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 1e-04
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 1e-04
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 1e-04
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 2e-04
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 2e-04
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 3e-04
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 3e-04
1fec_A490 Trypanothione reductase; redox-active center, oxid 3e-04
1id1_A153 Putative potassium channel protein; RCK domain, E. 3e-04
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 4e-04
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 4e-04
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 4e-04
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 4e-04
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 8e-04
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
 Score =  403 bits (1037), Expect = e-138
 Identities = 107/431 (24%), Positives = 190/431 (44%), Gaps = 29/431 (6%)

Query: 12  SKNVCVIGAGPSGLVAAR------ELRKEGHRVVVLEQNHDVGGQWLYDPNTDQTE---- 61
           +  + ++GAGPSG+   R      E   E   +V  E+  D GGQW Y   T   E    
Sbjct: 2   ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEP 61

Query: 62  VHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIR 121
           VHSS+Y  L    P+E + + D+ F    G+ +  +P  + LW Y+K   ++ G+R+ IR
Sbjct: 62  VHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIR 121

Query: 122 FNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEVFDAVVVATGHYSYPRLPSI 181
           FNT V +V   +  +         + V  ++   D +  E FD VV  TGH+S P +P  
Sbjct: 122 FNTAVRHVEFNEDSQ--------TFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEF 173

Query: 182 KGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNIS 241
           +G +K+  + +H+H +R    F+++ V++VG+S S +DI  +  +   +  +S       
Sbjct: 174 EGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYR---- 229

Query: 242 EGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIV 301
                      N    P +  +  +    F DG     D I+ CTGY + FPFL+    +
Sbjct: 230 -TAPMGYKWPENWDERPNLVRVDTEN-AYFADGSSEKVDAIILCTGYIHHFPFLNDDLRL 287

Query: 302 VVDDD-RVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWD 360
           V ++      LY+        P   ++G+  +   F  F++QA +   ++ G+  LPS +
Sbjct: 288 VTNNRLWPLNLYKGVVWED-NPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKE 346

Query: 361 QMMQSVKEFYHSRDVAGIPKHNTHDIANFEYCDRYADQIGFPHLEEWRKG-LCISALVNS 419
           +M       +  +++  +     +     +Y     D   +P  +        +    + 
Sbjct: 347 EMKADSMA-WREKELTLVTAEEMYTY-QGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHK 404

Query: 420 DANLETYRDSW 430
             N+ T+RD  
Sbjct: 405 KENIMTFRDHS 415


>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 493 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Length = 549 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Length = 497 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Length = 144 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Length = 141 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Length = 153 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Length = 451 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Length = 439 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query454
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 100.0
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 100.0
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 100.0
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 100.0
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 100.0
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.98
4dna_A463 Probable glutathione reductase; structural genomic 99.98
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.98
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.98
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.98
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.98
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.98
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.97
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.97
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.97
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.97
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.97
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.97
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.97
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.97
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.97
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.96
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.96
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.96
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.96
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.95
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.95
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.95
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.95
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.95
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.94
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.93
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.93
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.92
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.92
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.91
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.61
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.58
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.51
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.45
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.39
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.32
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.28
2cul_A232 Glucose-inhibited division protein A-related PROT 99.25
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.25
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.24
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.24
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.24
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.19
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.19
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.19
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.17
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.16
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.15
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.15
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.14
2bry_A497 NEDD9 interacting protein with calponin homology a 99.14
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.13
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.13
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.12
3dme_A369 Conserved exported protein; structural genomics, P 99.11
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.11
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.11
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.11
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.09
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.09
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.08
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.06
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.05
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.05
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 99.05
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.04
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.04
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.04
3atr_A453 Conserved archaeal protein; saturating double bond 99.03
2cul_A232 Glucose-inhibited division protein A-related PROT 99.03
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.99
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.99
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.99
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.99
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.98
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.96
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.93
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.92
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.92
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.91
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.88
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.87
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.86
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.84
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.83
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.83
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.82
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.81
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.8
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.79
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.79
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.78
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.75
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.75
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.73
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.72
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.72
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.72
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.7
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.7
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.69
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.69
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.68
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.67
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.67
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.66
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.66
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.65
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.65
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.65
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.64
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.64
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.63
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.62
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.62
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.62
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.6
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.59
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.59
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.57
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.56
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.56
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.55
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.55
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.54
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.54
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.54
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.53
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.52
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.52
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.52
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.52
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.52
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.52
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.51
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.51
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.5
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.5
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.49
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.48
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.48
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.48
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.47
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.47
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.47
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.47
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.46
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.46
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.45
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.45
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.45
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.45
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.43
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.43
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.43
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.41
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.41
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.41
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.39
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.39
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.39
4dna_A463 Probable glutathione reductase; structural genomic 98.39
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.38
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.35
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.35
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.35
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.35
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.34
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.33
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.33
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.31
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.29
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.27
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.27
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.27
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.27
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.25
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.25
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.24
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 98.23
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.23
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.23
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 98.23
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.2
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 98.2
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.2
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.2
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.19
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.18
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.18
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.17
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.17
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.16
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.16
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.16
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.16
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.15
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.14
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.12
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 98.1
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.09
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.08
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.07
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.06
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.05
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.05
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.99
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.99
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.99
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.98
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.91
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.88
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.88
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.86
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.84
4hb9_A 412 Similarities with probable monooxygenase; flavin, 97.83
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.82
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.82
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.79
2bry_A 497 NEDD9 interacting protein with calponin homology a 97.77
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.76
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.75
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.74
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.73
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.73
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.7
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.68
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.67
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.66
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 97.64
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 97.6
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.59
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 97.56
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.55
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.47
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.46
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.46
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.45
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.45
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.42
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.36
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 97.36
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.35
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 97.34
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.34
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 97.27
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.24
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.23
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.23
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.22
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 97.14
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.1
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.09
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.09
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.08
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.05
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.03
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.03
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 96.99
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 96.97
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.97
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 96.97
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 96.93
3dme_A 369 Conserved exported protein; structural genomics, P 96.92
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 96.91
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.87
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.85
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 96.8
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.75
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 96.74
3atr_A 453 Conserved archaeal protein; saturating double bond 96.74
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 96.73
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 96.67
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.61
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 96.57
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 96.57
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 96.56
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 96.54
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.53
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 96.51
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 96.49
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 96.48
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.41
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 96.3
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.2
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.08
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.08
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.07
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.03
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 95.99
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.96
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 95.89
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 95.88
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.88
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.74
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.66
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.52
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 95.37
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.32
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.24
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.17
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 95.14
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.09
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.06
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 94.92
3qha_A296 Putative oxidoreductase; seattle structural genomi 94.81
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.69
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 94.6
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 94.57
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 94.57
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.46
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.44
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 94.39
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.19
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 94.16
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 94.12
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 94.12
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 94.09
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 94.06
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.05
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 93.98
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 93.93
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.81
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 93.8
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 93.72
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 93.71
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 93.65
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 93.59
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 93.55
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 93.48
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 93.48
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 93.44
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 93.37
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 93.28
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.27
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 93.27
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 93.27
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 93.26
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 93.26
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 93.25
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.21
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 93.19
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 93.18
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.08
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 93.08
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 93.07
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 93.06
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 93.05
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 93.04
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 92.99
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 92.94
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 92.93
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.92
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 92.89
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 92.71
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.68
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 92.68
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 92.67
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 92.61
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.61
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 92.59
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 92.58
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 92.56
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 92.53
3ius_A286 Uncharacterized conserved protein; APC63810, silic 92.51
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 92.48
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 92.45
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 92.4
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 92.37
1id1_A153 Putative potassium channel protein; RCK domain, E. 92.34
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 92.33
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 92.28
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 92.27
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 92.27
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 92.25
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 92.24
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 92.23
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 92.22
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 92.15
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 92.14
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 92.14
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 92.11
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 92.1
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 92.06
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 92.05
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 92.04
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 92.03
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 92.01
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 91.99
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 91.99
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 91.95
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 91.95
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 91.81
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 91.81
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 91.79
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 91.78
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 91.75
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 91.73
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 91.71
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 91.7
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 91.67
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 91.66
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 91.65
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 91.56
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.5
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 91.49
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 91.48
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 91.46
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 91.44
3l6d_A306 Putative oxidoreductase; structural genomics, prot 91.43
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 91.42
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 91.41
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 91.41
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 91.39
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 91.39
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 91.35
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 91.35
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 91.34
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 91.34
2rir_A300 Dipicolinate synthase, A chain; structural genomic 91.33
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 91.33
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 91.32
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 91.3
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 91.29
1lss_A140 TRK system potassium uptake protein TRKA homolog; 91.28
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 91.27
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 91.26
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 91.26
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 91.25
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 91.25
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 91.25
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 91.21
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 91.14
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.06
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 91.02
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 91.02
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
Probab=100.00  E-value=5.2e-59  Score=469.47  Aligned_cols=398  Identities=26%  Similarity=0.481  Sum_probs=337.5

Q ss_pred             CcEEEECcChHHHHHHHHHHH---cCCc---EEEEeeCCCCCcccccCCCCCCC----CccccccccceecCCccccccC
Q 044575           13 KNVCVIGAGPSGLVAARELRK---EGHR---VVVLEQNHDVGGQWLYDPNTDQT----EVHSSVYASLRLTSPREIMGYT   82 (454)
Q Consensus        13 ~~VvIIGaG~aGl~aA~~l~~---~g~~---v~vie~~~~~GG~w~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~   82 (454)
                      +||+|||||+||++||+.|++   .|.+   |+|||+++.+||+|.+.......    ...+.+|..+..+.++..+.|+
T Consensus         3 ~~V~IIGaG~aGl~aA~~L~~~~~~G~~~~~V~v~E~~~~~GG~w~~~~~~g~~~~g~~~~~~~y~~l~~~~~~~~~~~~   82 (464)
T 2xve_A            3 TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFA   82 (464)
T ss_dssp             CEEEEECCSHHHHHHHHHHHHHHHTTCCCCEEEEECSSSSSCGGGSCCSCCSBCTTSSBCCCCCCTTCBCSSCGGGTCBT
T ss_pred             CcEEEECccHHHHHHHHHHHhhhhcCCCCCcEEEEEcCCCCCCEeecCCCCCccccCCCCcCccccchhhcCChhhcccC
Confidence            689999999999999999999   9999   99999999999999986433211    3456789999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhCCCccEEeCeEEEEEEEcCCCccccCCcCCcEEEEEeecCCCeEEEEE
Q 044575           83 DFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSKEKKADKVVEEV  162 (454)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~yl~~~~~~~~~~~~i~~~~~V~~v~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~  162 (454)
                      +++++...+...+.|+++.++.+|+.++++++++..+++++++|++|+..++.+        .|+|++.++.++...++.
T Consensus        83 ~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~gv~~~i~~~~~V~~v~~~~~~~--------~~~V~~~~~~~g~~~~~~  154 (464)
T 2xve_A           83 DYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQ--------TFTVTVQDHTTDTIYSEE  154 (464)
T ss_dssp             TBCHHHHHSSCCCSSCBHHHHHHHHHHHHHHHTCGGGEECSEEEEEEEEETTTT--------EEEEEEEETTTTEEEEEE
T ss_pred             CCCCCcccCCCCCCCCCHHHHHHHHHHHHHHcCCcceEEeCCEEEEEEEcCCCC--------cEEEEEEEcCCCceEEEE
Confidence            998875322244788999999999999999999988899999999999875432        799998875334445789


Q ss_pred             eCEEEEccCCCCCCCCCCCCCcCCccceeEEeecCCCCCCCCCCeEEEEcCCCCHHHHHHHHhhhcCeEEEecccCCcCc
Q 044575          163 FDAVVVATGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISMELVEVAKEVHLSAKSLNISE  242 (454)
Q Consensus       163 ~d~vViAtG~~~~p~~p~i~G~~~~~~~~~~~~~~~~~~~~~~k~vvVVG~G~sg~e~A~~l~~~~~~V~l~~r~~~~~~  242 (454)
                      ||+||+|||+++.|++|.+||++.|.+.++|++.++.+..+.+|+|+|||+|.||+|+|.+|++.+++|+++.|++.+.+
T Consensus       155 ~d~VVvAtG~~s~p~~p~ipG~~~~~g~~~hs~~~~~~~~~~~k~VvVVG~G~sg~eiA~~l~~~g~~V~li~~~~~~~~  234 (464)
T 2xve_A          155 FDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMG  234 (464)
T ss_dssp             ESEEEECCCSSSSBCCCCCBTTTTCCSEEEEGGGCCCGGGGTTSEEEEECCSTTHHHHHHHHHHTTCSEEEEECSSCCCC
T ss_pred             cCEEEECCCCCCCCccCCCCCcccCCceEEehhhhCCHhHcCCCEEEEEcCCCCHHHHHHHHHHhCCeEEEEEECCCCCC
Confidence            99999999999999999999999999999999999988888999999999999999999999999999999999876533


Q ss_pred             cchhhhccCCCeEEcCceeEEecCCcEEEeCCCEEeeceEEEccCcccCCcCCCCCCceeeCCC-CcccccCcccCCCCC
Q 044575          243 GLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVVDDD-RVGPLYEHTFPPSLA  321 (454)
Q Consensus       243 ~~~~~l~~~~~i~~~~~v~~v~~~~~v~~~dG~~i~~D~vI~atG~~~~~~~l~~~g~i~v~~~-~~~~~~~~~~~~~~~  321 (454)
                      ..   +.  .++...+.|+++.++ .|+|.||+++++|.||+|||++|+++||++...+.+++. .+.++|++++.+. .
T Consensus       235 ~~---~~--~~V~~~~~V~~i~~~-~V~~~dG~~i~~D~Vi~atG~~p~~~~l~~~~gl~~~~~~~v~~~~~~~~~t~-~  307 (464)
T 2xve_A          235 YK---WP--ENWDERPNLVRVDTE-NAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWED-N  307 (464)
T ss_dssp             CC---CC--TTEEECSCEEEECSS-EEEETTSCEEECSEEEECCCBCCCCTTBCTTTCCCCCSSSCCSSEETTTEESS-S
T ss_pred             CC---CC--CceEEcCCeEEEeCC-EEEECCCCEEeCCEEEECCCCCCCCCCcCcccccccCCCcccccccceEecCC-C
Confidence            21   11  245555889999765 599999999999999999999999999986444666665 4457899888864 7


Q ss_pred             CCceEecccccccchhHHHHHHHHHHHHHcCCCCCCCHHHHHHHHHHHHhhhhhcCC--CCCcccccccHHHHHHHHHHc
Q 044575          322 PSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGI--PKHNTHDIANFEYCDRYADQI  399 (454)
Q Consensus       322 p~l~~iG~~~~~~~~~~a~~qa~~~a~~i~g~~~lp~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~y~~~l~~~~  399 (454)
                      |+|||+|++.....++.|+.||+|+|++|+|+..||+.++|++++..+.+.  ..++  +.++.|.  ++.|+|+|++++
T Consensus       308 p~i~aiGd~~~~~~~~~a~~qa~~~a~~l~G~~~lP~~~~m~~~~~~~~~~--~~~~~~~~~~~~~--~~~Y~~~l~~~~  383 (464)
T 2xve_A          308 PKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREK--ELTLVTAEEMYTY--QGDYIQNLIDMT  383 (464)
T ss_dssp             TTEEECSCSCCSSCHHHHHHHHHHHHHHHTTSSCCCCHHHHHHHHHHHHHH--HHTCCSHHHHHHH--HHHHHHHHHTTS
T ss_pred             CCEEEEeCcccccchHHHHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHHHH--hhccCCCCCcccc--HHHHHHHHHHHc
Confidence            999999999887788999999999999999999999999999999887662  3344  2344443  579999999999


Q ss_pred             CCCCc-hHHHHHHHHHHhhCCccccccccCC
Q 044575          400 GFPHL-EEWRKGLCISALVNSDANLETYRDS  429 (454)
Q Consensus       400 g~~~~-~~~~~~l~~~~~~~~~~~~~~~r~~  429 (454)
                      |++++ ++|+++++..+...+..++..||+.
T Consensus       384 g~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~  414 (464)
T 2xve_A          384 DYPSFDIPATNKTFLEWKHHKKENIMTFRDH  414 (464)
T ss_dssp             SSCCCCHHHHHHHHHHHHHHHHHCTTTGGGC
T ss_pred             CCCCCChHHHHHHHHHHHHHHHhchhhhccc
Confidence            99988 7789999999998888999999987



>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 454
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 3e-25
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 7e-16
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 2e-21
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 1e-19
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 2e-16
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-15
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 5e-12
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 5e-12
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 5e-12
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 1e-11
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 4e-11
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 5e-11
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 7e-11
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 4e-10
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 1e-09
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 1e-09
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 2e-09
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 2e-09
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 5e-09
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 5e-09
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 1e-08
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 2e-08
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 3e-08
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 3e-08
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 5e-08
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-07
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 1e-07
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 2e-07
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 2e-07
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 4e-07
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 4e-07
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 4e-07
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 5e-07
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 5e-07
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 6e-07
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 7e-07
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 8e-07
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 1e-06
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 3e-06
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 5e-06
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 5e-06
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 7e-06
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 7e-06
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 7e-06
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 8e-06
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 8e-06
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 1e-05
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 1e-05
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 2e-05
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 2e-05
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 4e-05
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 4e-05
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 6e-05
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 1e-04
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 2e-04
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 2e-04
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 2e-04
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 2e-04
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 3e-04
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 4e-04
d1e5qa1182 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase 5e-04
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 6e-04
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 6e-04
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 8e-04
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 0.001
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 0.001
d2jfga193 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D- 0.001
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 0.003
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 0.004
d2hmva1134 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [T 0.004
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 0.004
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavin-dependent monoxygenase SPBP16F5.08c
species: Schizosaccharomyces pombe [TaxId: 4896]
 Score =  103 bits (257), Expect = 3e-25
 Identities = 61/270 (22%), Positives = 94/270 (34%), Gaps = 61/270 (22%)

Query: 13  KNVCVIGAGPSGLVAARELRKEG--HRVVVLEQNHDVGGQWLYDPNT------------- 57
           + + +IGAGPSGLV A+ L  E    +V + E+    GG W Y                 
Sbjct: 5   RKIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSNKLPVPSTNPIL 64

Query: 58  ---------DQTEVHSSVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLK 108
                          S +Y  L+  +P E+MGY D  F         +FP    +  Y +
Sbjct: 65  TTEPIVGPAALPVYPSPLYRDLQTNTPIELMGYCDQSF----KPQTLQFPHRHTIQEYQR 120

Query: 109 DFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLIKWVVKSK-EKKADKVVEEVFDAVV 167
            + Q   L   I+  T V  +   D            WVV  K  K    + +++FDAV 
Sbjct: 121 IYAQP--LLPFIKLATDVLDIEKKDG----------SWVVTYKGTKAGSPISKDIFDAVS 168

Query: 168 VATGHYSYPRLPSIKG-----------------MDKWKRKQMHSHIYRVPEP---FRNEV 207
           +  GHY  P    +                    D      ++ HI+ +P+P   F    
Sbjct: 169 ICNGHYEVPYTGYLYSVPFPSLAKLKSPETKLIDDGSHVHNVYQHIFYIPDPTLAFVGLA 228

Query: 208 VVVVGNSLSGQDISMELVEVAKEVHLSAKS 237
           + VV    S    +      +  + L +K 
Sbjct: 229 LHVVPFPTSQAQAAFLARVWSGRLKLPSKE 258


>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Length = 93 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Length = 134 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query454
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 100.0
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.91
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.78
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.77
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.72
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.72
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.7
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.68
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.65
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 99.64
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.64
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.64
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.63
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.62
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.62
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.61
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.57
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.57
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.56
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.53
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.53
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.52
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.51
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.5
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.49
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.49
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.47
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.47
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.47
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.47
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.44
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.43
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.42
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.4
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.38
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.35
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.35
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.34
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.33
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.33
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.31
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.31
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.3
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.3
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.29
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.29
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.29
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.28
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.28
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.28
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.26
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.26
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.25
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.24
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.24
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.24
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.24
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.24
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.24
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.23
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.23
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.23
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.22
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.22
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.22
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.21
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 99.2
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.2
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.18
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.16
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.15
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.15
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.14
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.13
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.13
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.11
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.11
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.11
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.1
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 99.1
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.08
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.08
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.05
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.04
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.04
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.04
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.03
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.0
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.99
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.99
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.98
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.97
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.96
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.9
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.9
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.89
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.87
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.84
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.78
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.76
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.75
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.74
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.72
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.72
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.71
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.67
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.67
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.67
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.59
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.55
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.55
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.53
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.51
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.46
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.46
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.43
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.43
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.35
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.33
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.31
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.29
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.25
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.24
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.21
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.18
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.15
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.15
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.15
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.1
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.08
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.05
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.03
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.02
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.99
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.96
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.86
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.84
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.83
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.82
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.79
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.77
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.74
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.69
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.63
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 97.62
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.54
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.51
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 97.47
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.44
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.44
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.41
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.39
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.35
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.33
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.31
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.3
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.12
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.09
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.07
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.0
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 96.98
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.74
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 96.72
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.68
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 96.65
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.64
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.61
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.6
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.58
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.51
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.41
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.36
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.33
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 96.29
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.25
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 96.21
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.18
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.15
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.15
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.12
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 96.11
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.08
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.0
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.92
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 95.92
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 95.91
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.91
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.75
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.65
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.65
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 95.55
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.46
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.38
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 95.24
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 95.17
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.1
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.99
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.98
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.97
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.8
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 94.78
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.78
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 94.67
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.63
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 94.52
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 94.52
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.49
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.36
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.28
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.26
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 94.2
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.19
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.18
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 94.16
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.15
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.13
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 93.93
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.85
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 93.84
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.81
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 93.79
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.78
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.69
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.68
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.56
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.51
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 93.35
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.32
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.17
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 93.16
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.14
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.08
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 93.05
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 93.01
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 92.96
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 92.92
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 92.89
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 92.88
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.79
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 92.69
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 92.69
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 92.66
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.57
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.56
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.48
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 92.46
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 92.45
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.41
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.38
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.34
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 92.31
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 92.27
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 92.17
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.16
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.13
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.12
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 92.07
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 92.03
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 91.95
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 91.87
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 91.64
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 91.55
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 91.54
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 91.54
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 91.34
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.3
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 91.29
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 91.28
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.14
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.06
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 91.0
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.83
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 90.49
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 90.48
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 90.48
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 90.21
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 90.09
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 90.01
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 89.89
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.87
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 89.86
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 89.83
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 89.68
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 89.55
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 89.52
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.29
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 89.29
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 89.15
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 89.07
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 88.98
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 88.88
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 88.75
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 88.49
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 88.47
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 88.44
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 88.31
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 88.07
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 88.04
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 88.03
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 87.97
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 87.88
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 87.87
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.82
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 87.73
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 87.42
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 87.18
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 87.11
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 87.08
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 86.65
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 86.64
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 86.58
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 86.57
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 86.44
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 86.41
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 86.39
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 86.34
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.29
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 86.24
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 86.23
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 86.16
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.13
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 86.08
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 86.05
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 86.01
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 85.79
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 85.79
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 85.76
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 85.66
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 85.44
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 85.27
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 85.25
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 85.12
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 85.12
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 85.09
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 85.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 84.93
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 84.89
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 84.8
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 84.76
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 84.45
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 84.3
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 84.29
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 84.25
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 84.23
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 84.06
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 83.89
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 83.8
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 83.78
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 83.74
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 83.71
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 83.64
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 83.58
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 83.55
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 83.49
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 83.28
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 83.24
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 83.17
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 83.15
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 83.1
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 82.94
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 82.69
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 82.68
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 82.62
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 82.62
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 82.57
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 82.52
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 82.37
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 82.37
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 82.35
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 82.3
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 82.24
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 81.95
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 81.84
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 81.81
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 81.79
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 81.72
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 81.57
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 81.42
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 81.24
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 81.24
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 81.05
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 81.03
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 80.98
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 80.96
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 80.94
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 80.93
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 80.79
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 80.69
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 80.65
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 80.63
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 80.57
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 80.57
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 80.31
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 80.2
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 80.14
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 80.12
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 80.09
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 80.06
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavin-dependent monoxygenase SPBP16F5.08c
species: Schizosaccharomyces pombe [TaxId: 4896]
Probab=100.00  E-value=1.7e-34  Score=276.82  Aligned_cols=269  Identities=28%  Similarity=0.482  Sum_probs=207.8

Q ss_pred             ccCCCcEEEECcChHHHHHHHHHHHcC--CcEEEEeeCCCCCcccccCCCCCCC----------------------Cccc
Q 044575            9 CAQSKNVCVIGAGPSGLVAARELRKEG--HRVVVLEQNHDVGGQWLYDPNTDQT----------------------EVHS   64 (454)
Q Consensus         9 ~~~~~~VvIIGaG~aGl~aA~~l~~~g--~~v~vie~~~~~GG~w~~~~~~~~~----------------------~~~~   64 (454)
                      |+..++|+|||||+|||+||+.|++.+  .+|+||||++.+||+|.+....+..                      ...+
T Consensus         1 m~~~KrVaIIGaG~sGl~~A~~L~~~~~~~~v~vfEk~~~iGG~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s   80 (335)
T d2gv8a1           1 LPTIRKIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSNKLPVPSTNPILTTEPIVGPAALPVYPS   80 (335)
T ss_dssp             CCSCCEEEEECCSHHHHHHHHHHHTTTCCSEEEEECSSSSSSTTCSCCSCCCSCCCSSBCCTTCCCCCBCCSSSCCBCCC
T ss_pred             CCCCCeEEEECcCHHHHHHHHHHHHhCCCCCEEEEECCCCCCCcccccCCCCcccCCccccccccccccccccccccccc
Confidence            344589999999999999999998876  5999999999999999886533210                      2356


Q ss_pred             cccccceecCCccccccCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhCCCccEEeCeEEEEEEEcCCCccccCCcCC
Q 044575           65 SVYASLRLTSPREIMGYTDFPFVLKKGRDVRRFPGHKELWLYLKDFCQRFGLREMIRFNTRVEYVGMLDCGELIIGNDLI  144 (454)
Q Consensus        65 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yl~~~~~~~~~~~~i~~~~~V~~v~~~~~~~~~~~~~~~  144 (454)
                      .+|..+..+.+..++.+++++++.    ..+.|+++.++.+|+..+++.++.  +|+++++|++|+..++          
T Consensus        81 ~~y~~l~~~~~~~~~~~~~~~~~~----~~~~f~~~~~~~~yl~~~~~~~~~--~I~~~t~V~~v~~~~~----------  144 (335)
T d2gv8a1          81 PLYRDLQTNTPIELMGYCDQSFKP----QTLQFPHRHTIQEYQRIYAQPLLP--FIKLATDVLDIEKKDG----------  144 (335)
T ss_dssp             CCCTTCBCSSCHHHHSCTTCCCCT----TCCSSCBHHHHHHHHHHHHGGGGG--GEECSEEEEEEEEETT----------
T ss_pred             ccchhhhcCCcHhhhhhhhhcCCc----ccccCCchHHHHHHHHHHHHHhhh--cccCceEEEEEEecCC----------
Confidence            789999999999999999999988    888999999999999999987654  5999999999998754          


Q ss_pred             cEEEEEeecCCC-eEEEEEeCEEEEccCCCCCCCCCCCCCcCCccceeEEeecCCCCCCCCCCeEEEEcCCCCHHHHHHH
Q 044575          145 KWVVKSKEKKAD-KVVEEVFDAVVVATGHYSYPRLPSIKGMDKWKRKQMHSHIYRVPEPFRNEVVVVVGNSLSGQDISME  223 (454)
Q Consensus       145 ~~~v~~~~~~~~-~~~~~~~d~vViAtG~~~~p~~p~i~G~~~~~~~~~~~~~~~~~~~~~~k~vvVVG~G~sg~e~A~~  223 (454)
                      +|+|++++...+ +.....||+||+|||+++.|++|.+++...           .....+++++                
T Consensus       145 ~w~Vt~~~~~~~~~~~~~~~d~VI~AtG~~s~p~~~~~~~~~~-----------p~~~~f~~~~----------------  197 (335)
T d2gv8a1         145 SWVVTYKGTKAGSPISKDIFDAVSICNGHYEVPYTGYLYSVPF-----------PSLAKLKSPE----------------  197 (335)
T ss_dssp             EEEEEEEESSTTCCEEEEEESEEEECCCSSSSBCCCBCCCCCC-----------HHHHSCCSTT----------------
T ss_pred             EEEEEEEecCCCCeEEEEEeeEEEEcccccccceecccccCCC-----------CcchhcccCc----------------
Confidence            899999886543 445678999999999999999986643210           0000011110                


Q ss_pred             HhhhcCeEEEecccCCcCccchhhhccCCCeEEcCceeEEecCCcEEEeCCCEEeeceEEEccCcccCCcCCCCCCceee
Q 044575          224 LVEVAKEVHLSAKSLNISEGLSKVISKHNNLHLHPQIDCLREDGRVTFVDGCWVTADTILYCTGYSYSFPFLDTKGIVVV  303 (454)
Q Consensus       224 l~~~~~~V~l~~r~~~~~~~~~~~l~~~~~i~~~~~v~~v~~~~~v~~~dG~~i~~D~vI~atG~~~~~~~l~~~g~i~v  303 (454)
                                                                                                 ..+..
T Consensus       198 ---------------------------------------------------------------------------~~~~~  202 (335)
T d2gv8a1         198 ---------------------------------------------------------------------------TKLID  202 (335)
T ss_dssp             ---------------------------------------------------------------------------TCCCS
T ss_pred             ---------------------------------------------------------------------------cceec
Confidence                                                                                       11111


Q ss_pred             CCCCcccccCcccCCCCCCCceEecccccccchhHHHHHHHHHHHHHcCCCCCCCHHHHHHHHHHHHhhhhhcCCCCCcc
Q 044575          304 DDDRVGPLYEHTFPPSLAPSLSFVGIPRKLIGFPFFESQAKWIAQLLSGKRTLPSWDQMMQSVKEFYHSRDVAGIPKHNT  383 (454)
Q Consensus       304 ~~~~~~~~~~~~~~~~~~p~l~~iG~~~~~~~~~~a~~qa~~~a~~i~g~~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~  383 (454)
                      +.....++|+|+|... .|+++|+|.+..+.+++.++.||.++++.++|+..||+.++|.++..+.....+.  .. ...
T Consensus       203 ~~~~~~~ly~~~~~~~-~p~l~f~G~~~~v~~~~~~e~Qa~~~a~~~~g~~~Lps~~~m~~~~~~~~~~~~~--~~-~~~  278 (335)
T d2gv8a1         203 DGSHVHNVYQHIFYIP-DPTLAFVGLALHVVPFPTSQAQAAFLARVWSGRLKLPSKEEQLKWQDELMFSLSG--AN-NMY  278 (335)
T ss_dssp             SSSSCCSEETTTEETT-CTTEEESSCCBSSCHHHHHHHHHHHHHHHHTTSSCCCCHHHHHHHHHHHHHHHTT--CG-GGT
T ss_pred             cccceeeeecccccCC-CCceEEeeeEEEEecCCchHHHHHHHHHHHcCCccCCCcchhhhhhHHHHHhhcc--cC-ccc
Confidence            2334457999999974 6999999999988889999999999999999999999999999987765543322  22 222


Q ss_pred             ccc---ccHHHHHHHHHHc
Q 044575          384 HDI---ANFEYCDRYADQI  399 (454)
Q Consensus       384 ~~~---~~~~y~~~l~~~~  399 (454)
                      |.+   .+..|+++|...+
T Consensus       279 ~~~~~~~~~~y~~~L~~~~  297 (335)
T d2gv8a1         279 HSLDYPKDATYINKLHDWC  297 (335)
T ss_dssp             TBCTTTHHHHHHHHHHHHH
T ss_pred             eecCCchHHHHHHHHHHHH
Confidence            333   3578999987744



>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure