Citrus Sinensis ID: 044601

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
METETEKWSNHYSSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYDNKRAQGYLSDAPFHIGDSSTYKFRLFPQNGK
ccccccccccccccccEEEEEccccHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccccccccEEEEcccccccccccccHHHHHcHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHccEEEEEEEccccccccccccccccccccccccccccEEEEEEEcccccc
cccccEEEEEEcccccEEEEEccccHHHHHHHHHHccccccEEEEccccHHHHHHHcHHHHHHHHHHHHcccEEEEEEEcHHHHHccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHcccEEEEEEEccHHHcccccccccccccccccccccccEEEEEEEcccccc
metetekwsnhysSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLrthkfdrviynfphvgfifreNSYCQIQLNKELVKGFLRNAKLLLkeengeihvthkegdpynkwELVKKAEKIGLTLQEVvpfckqdypgydnkraqgylsdapfhigdsstykfrlfpqngk
metetekwsnhyssKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKeengeihvthkegdpynkWELVKKAEKIGLTLQEVVPFCKQDYPGYDNKRAQGYLsdapfhigdsstykfrlfpqngk
METETEKWSNHYSSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYDNKRAQGYLSDAPFHIGDSSTYKFRLFPQNGK
***************QRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYDNKRAQGYLSDAPFHIGDSSTYKFRL******
***********YSSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYDNK************IGDSSTYKFRLFPQ***
************SSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYDNKRAQGYLSDAPFHIGDSSTYKFRLFPQNGK
***ETEKWSNHYSSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYDNKRAQGYLSDAPFHIGDSSTYKFRLFPQ***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METETEKWSNHYSSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTxxxxxxxxxxxxxxxxxxxxxGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYDNKRAQGYLSDAPFHIGDSSTYKFRLFPQNGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query213 2.2.26 [Sep-21-2011]
P0C8L4209 Uncharacterized protein A no no 0.938 0.956 0.480 2e-44
Q3UY23 622 Ferredoxin-fold anticodon yes no 0.840 0.287 0.336 3e-20
O94480282 UPF0617 protein C1919.13c yes no 0.849 0.641 0.321 6e-20
Q9BRP7 624 Ferredoxin-fold anticodon yes no 0.882 0.301 0.334 3e-19
P40493336 UPF0617 protein YIL096C O yes no 0.793 0.502 0.245 9e-08
>sp|P0C8L4|Y4648_ARATH Uncharacterized protein At4g26485 OS=Arabidopsis thaliana GN=At4g26485 PE=4 SV=1 Back     alignment and function desciption
 Score =  179 bits (453), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 130/204 (63%), Gaps = 4/204 (1%)

Query: 5   TEKWSNHYSSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNV 64
           +EKW  HYSS  +ILLVGEG+FSFSLCLA  FG A N+ AT LD+++ ++ KY +AVDN+
Sbjct: 4   SEKWIRHYSSTHKILLVGEGNFSFSLCLASAFGSAMNITATSLDSEDELSIKYMDAVDNI 63

Query: 65  RELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVG--FIFRENSYCQIQLNKEL 122
             L+  GC + + VD   MS    L   ++DR+++NFPH G  F  RE S   I+ +KEL
Sbjct: 64  NILKRYGCDIQHEVDVHTMSFDNSLSLQRYDRIVFNFPHAGSRFFGRELSSRAIESHKEL 123

Query: 123 VKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYD 182
           V+GFL NAK +L EE+GEIH+THK   P++ W + K  +  GL L +   F    YPGY 
Sbjct: 124 VRGFLENAKEML-EEDGEIHITHKTTYPFSDWGIKKLGKGEGLKLLKKSKFELSHYPGYI 182

Query: 183 NKRAQ-GYLSDAPFHIGDSSTYKF 205
            KR   G  SD  F +G+ STY F
Sbjct: 183 TKRGSGGRRSDDYFPVGECSTYMF 206

Arabidopsis thaliana (taxid: 3702)
>sp|Q3UY23|FDXA1_MOUSE Ferredoxin-fold anticodon-binding domain-containing protein 1 homolog OS=Mus musculus GN=Fdxacb1 PE=2 SV=2 Back     alignment and function description
>sp|O94480|YC6D_SCHPO UPF0617 protein C1919.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1919.13c PE=3 SV=1 Back     alignment and function description
>sp|Q9BRP7|FDXA1_HUMAN Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens GN=FDXACB1 PE=2 SV=3 Back     alignment and function description
>sp|P40493|YIJ6_YEAST UPF0617 protein YIL096C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL096C PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
356532867233 PREDICTED: uncharacterized protein At4g2 0.962 0.879 0.731 2e-88
255645648233 unknown [Glycine max] 0.962 0.879 0.721 1e-86
357448137249 hypothetical protein MTR_2g027540 [Medic 0.953 0.815 0.709 2e-83
449491229231 PREDICTED: uncharacterized protein At4g2 0.938 0.865 0.7 5e-83
359495632209 PREDICTED: uncharacterized protein At4g2 0.859 0.875 0.628 3e-68
297736693171 unnamed protein product [Vitis vinifera] 0.802 1.0 0.660 2e-62
449434416213 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.840 0.840 0.566 1e-59
357494689 525 hypothetical protein MTR_5g093740 [Medic 0.934 0.379 0.525 2e-53
356499404263 PREDICTED: uncharacterized protein At4g2 0.934 0.756 0.522 3e-53
224117576223 predicted protein [Populus trichocarpa] 0.934 0.892 0.525 6e-53
>gi|356532867|ref|XP_003534991.1| PREDICTED: uncharacterized protein At4g26485-like [Glycine max] Back     alignment and taxonomy information
 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 176/205 (85%)

Query: 3   TETEKWSNHYSSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVD 62
            + EKW NHYSS  RILLVG+GDFSFSLCLAR FG AHN+VAT LD+ ++I  KYSN + 
Sbjct: 28  AKAEKWKNHYSSNHRILLVGDGDFSFSLCLARAFGSAHNLVATSLDSYDSIGKKYSNGLS 87

Query: 63  NVRELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKEL 122
           NV EL+ERGCLVF+GVDA +MSQHFFL+T +FDR++YNFPHVGFI+ ENS+CQIQLNK L
Sbjct: 88  NVMELQERGCLVFHGVDAKEMSQHFFLKTQRFDRIVYNFPHVGFIYPENSHCQIQLNKRL 147

Query: 123 VKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYD 182
           +KGFL NAK L+K+E GEIHVTHKEGDPYNKW+LVKK EK GL LQ+VVPF K DYPGYD
Sbjct: 148 LKGFLANAKALIKKEGGEIHVTHKEGDPYNKWDLVKKPEKRGLVLQQVVPFFKDDYPGYD 207

Query: 183 NKRAQGYLSDAPFHIGDSSTYKFRL 207
           NKRA G LSDAPF +G++STYKF++
Sbjct: 208 NKRAHGKLSDAPFPVGEASTYKFKV 232

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255645648|gb|ACU23318.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357448137|ref|XP_003594344.1| hypothetical protein MTR_2g027540 [Medicago truncatula] gi|124360901|gb|ABN08873.1| nucleic acid binding , related [Medicago truncatula] gi|355483392|gb|AES64595.1| hypothetical protein MTR_2g027540 [Medicago truncatula] gi|388520621|gb|AFK48372.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449491229|ref|XP_004158835.1| PREDICTED: uncharacterized protein At4g26485-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359495632|ref|XP_002272008.2| PREDICTED: uncharacterized protein At4g26485-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736693|emb|CBI25729.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449434416|ref|XP_004134992.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g26485-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357494689|ref|XP_003617633.1| hypothetical protein MTR_5g093740 [Medicago truncatula] gi|355518968|gb|AET00592.1| hypothetical protein MTR_5g093740 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356499404|ref|XP_003518531.1| PREDICTED: uncharacterized protein At4g26485-like [Glycine max] Back     alignment and taxonomy information
>gi|224117576|ref|XP_002317613.1| predicted protein [Populus trichocarpa] gi|222860678|gb|EEE98225.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
TAIR|locus:2161745220 AT5G56060 [Arabidopsis thalian 0.910 0.881 0.464 2e-40
TAIR|locus:504954949256 AT5G56075 [Arabidopsis thalian 0.887 0.738 0.461 1.8e-39
TAIR|locus:2012115314 AT1G55800 "AT1G55800" [Arabido 0.464 0.315 0.384 5.6e-36
TAIR|locus:2179265193 AT5G25030 [Arabidopsis thalian 0.901 0.994 0.398 5.2e-33
ZFIN|ZDB-GENE-030131-8403 582 si:dkey-71l1.3 "si:dkey-71l1.3 0.849 0.310 0.375 1.2e-23
POMBASE|SPCC1919.13c282 SPCC1919.13c "ribosome biogene 0.863 0.652 0.320 9e-22
UNIPROTKB|J9PAV7 809 ALG9 "Uncharacterized protein" 0.859 0.226 0.342 2e-20
UNIPROTKB|F1MB48 624 LOC100847683 "Uncharacterized 0.854 0.291 0.346 4e-19
MGI|MGI:3584513 622 Fdxacb1 "ferredoxin-fold antic 0.835 0.286 0.349 5.1e-19
UNIPROTKB|Q9BRP7 624 FDXACB1 "Ferredoxin-fold antic 0.873 0.298 0.338 5.1e-19
TAIR|locus:2161745 AT5G56060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 430 (156.4 bits), Expect = 2.0e-40, P = 2.0e-40
 Identities = 97/209 (46%), Positives = 131/209 (62%)

Query:    12 YSSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERG 71
             YS+KQ+ILLVGEGDFSFSL LAR FG A N+ AT LDT+E +  KY++   NV  LE  G
Sbjct:    12 YSNKQKILLVGEGDFSFSLSLARVFGSATNITATSLDTREELGIKYTDGKANVEGLELFG 71

Query:    72 CLVFYGVDAMQMSQHFFLRTHKFDRVIYNFPHVGFIF-RENSYCQIQLNKELVKGFLRNA 130
             C V +GV+   MS  +  R  ++DR+I+NFPH G  F  E+    I L++ LV+GFL +A
Sbjct:    72 CTVVHGVNVHSMSSDY--RLGRYDRIIFNFPHSGLGFGSEHDIFFIMLHQGLVRGFLESA 129

Query:   131 KLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYDNKRAQG-- 188
             + +LK+E+GEIHVTHK  DP+N+W +   A + GL L   + F K  +PGY NK+  G  
Sbjct:   130 RKMLKDEDGEIHVTHKTTDPFNRWGIETLAGEKGLRLIGEIEFHKWAFPGYSNKKGGGSN 189

Query:   189 ---------YLSDAPFHIGDSSTYKFRLF 208
                       LS   +H+  SS Y FR++
Sbjct:   190 CNSTFLLRRILSLLDYHVY-SSVYSFRIY 217
GO:0000049 "tRNA binding" evidence=IEA
GO:0004812 "aminoacyl-tRNA ligase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=IEA
GO:0043039 "tRNA aminoacylation" evidence=IEA
TAIR|locus:504954949 AT5G56075 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012115 AT1G55800 "AT1G55800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179265 AT5G25030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8403 si:dkey-71l1.3 "si:dkey-71l1.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPCC1919.13c SPCC1919.13c "ribosome biogenesis protein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|J9PAV7 ALG9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MB48 LOC100847683 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:3584513 Fdxacb1 "ferredoxin-fold anticodon binding domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BRP7 FDXACB1 "Ferredoxin-fold anticodon-binding domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
pfam10354166 pfam10354, DUF2431, Domain of unknown function (DU 2e-76
>gnl|CDD|220711 pfam10354, DUF2431, Domain of unknown function (DUF2431) Back     alignment and domain information 
 Score =  226 bits (579), Expect = 2e-76
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 2/168 (1%)

Query: 19  LLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGV 78
           LLVGEGDFSFSL LA  FG   N+VAT LD++E +  KY +A +N++ELEE G  V +GV
Sbjct: 1   LLVGEGDFSFSLALATHFGSPTNLVATSLDSREELEEKYGDAEENLQELEENGVTVLHGV 60

Query: 79  DAMQMSQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEEN 138
           DA ++ +HF L+ + FDR+I+NFPHVG    ++S   I+LN+EL++GF +NA  LLK   
Sbjct: 61  DATKLKKHFRLKKNSFDRIIFNFPHVGG-KIKDSDRNIRLNRELLRGFFKNASELLK-PG 118

Query: 139 GEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDYPGYDNKRA 186
           GEIHVT K+G+PYN W +   A + GL L+E V F   DYPGY ++R 
Sbjct: 119 GEIHVTLKDGEPYNSWNIEALAAEAGLILEESVKFDISDYPGYKHRRT 166

This is the N-terminal domain of a family of proteins found from plants to humans. The function is not known. Length = 166

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 100.0
KOG4174282 consensus Uncharacterized conserved protein [Funct 100.0
KOG4174 282 consensus Uncharacterized conserved protein [Funct 97.98
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.86
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.5
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 97.47
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.42
PRK14968188 putative methyltransferase; Provisional 97.27
PRK03612521 spermidine synthase; Provisional 97.04
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.01
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 96.99
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 96.97
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 96.97
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 96.96
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 96.88
PRK14902444 16S rRNA methyltransferase B; Provisional 96.86
PRK14901434 16S rRNA methyltransferase B; Provisional 96.86
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 96.84
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.8
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 96.77
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 96.76
PRK14967223 putative methyltransferase; Provisional 96.76
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 96.72
PRK04457262 spermidine synthase; Provisional 96.7
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 96.7
PRK01581374 speE spermidine synthase; Validated 96.67
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 96.63
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 96.63
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 96.57
PRK14903431 16S rRNA methyltransferase B; Provisional 96.56
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 96.54
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 96.47
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 96.44
PRK10901427 16S rRNA methyltransferase B; Provisional 96.42
TIGR00438188 rrmJ cell division protein FtsJ. 96.34
PRK14904445 16S rRNA methyltransferase B; Provisional 96.32
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.3
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 96.25
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 96.24
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 96.18
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.12
PRK00811283 spermidine synthase; Provisional 96.09
COG4123248 Predicted O-methyltransferase [General function pr 96.08
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 96.03
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 95.86
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 95.81
PLN02366308 spermidine synthase 95.81
PLN02233261 ubiquinone biosynthesis methyltransferase 95.71
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 95.69
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 95.69
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 95.66
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 95.58
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 95.58
PLN02244340 tocopherol O-methyltransferase 95.47
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 95.38
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 95.2
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 95.18
COG1041347 Predicted DNA modification methylase [DNA replicat 95.16
PLN02490340 MPBQ/MSBQ methyltransferase 95.15
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 95.12
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 95.06
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 94.96
PRK08317241 hypothetical protein; Provisional 94.81
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 94.78
PRK04266226 fibrillarin; Provisional 94.73
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 94.7
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 94.64
PRK06922677 hypothetical protein; Provisional 94.55
TIGR00536284 hemK_fam HemK family putative methylases. The gene 94.52
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 94.48
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 94.25
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 94.09
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 93.98
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 93.94
PRK11207197 tellurite resistance protein TehB; Provisional 93.79
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 93.65
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 93.05
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 93.04
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 93.02
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 92.38
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 92.17
TIGR00740239 methyltransferase, putative. A simple BLAST search 92.16
PLN02336475 phosphoethanolamine N-methyltransferase 92.09
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 92.0
PLN02823336 spermine synthase 91.91
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 91.91
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 91.25
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 91.15
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 91.08
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 90.88
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 90.65
PTZ00146293 fibrillarin; Provisional 90.34
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 90.3
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 89.98
KOG2904328 consensus Predicted methyltransferase [General fun 89.96
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 89.54
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 89.49
PHA03411279 putative methyltransferase; Provisional 89.41
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 89.14
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 89.08
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 88.79
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 88.78
PRK12335287 tellurite resistance protein TehB; Provisional 88.1
PRK00536262 speE spermidine synthase; Provisional 87.95
COG2890280 HemK Methylase of polypeptide chain release factor 87.14
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 87.08
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 86.99
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 86.82
COG0421282 SpeE Spermidine synthase [Amino acid transport and 86.74
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 86.6
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 86.45
PRK06940275 short chain dehydrogenase; Provisional 86.37
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 85.98
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 85.76
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 85.67
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 84.15
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 83.86
COG1092393 Predicted SAM-dependent methyltransferases [Genera 83.71
COG4262508 Predicted spermidine synthase with an N-terminal m 83.68
TIGR00452314 methyltransferase, putative. Known examples to dat 83.58
COG2520341 Predicted methyltransferase [General function pred 82.99
PLN02336 475 phosphoethanolamine N-methyltransferase 82.58
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 82.39
PRK13699227 putative methylase; Provisional 82.13
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 82.07
PRK09880343 L-idonate 5-dehydrogenase; Provisional 81.83
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 81.82
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 81.42
PRK07402196 precorrin-6B methylase; Provisional 81.35
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 81.05
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information 
Probab=100.00  E-value=9.1e-68  Score=436.97  Aligned_cols=166  Identities=52%  Similarity=0.913  Sum_probs=161.6

Q ss_pred             EEEecCChhHHHHHHHHhCCCCeEEEeccCCHHHHHhhcchHHHHHHHHHhCCCEEEEeeeccccCCCccccCCcccEEE
Q 044601           19 LLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLRTHKFDRVI   98 (213)
Q Consensus        19 LlVGEGnFSFS~aLa~~~~~~~~l~ATs~ds~~~l~~kY~~a~~ni~~L~~~g~~V~~gVDAt~L~~~~~l~~~~FDrIi   98 (213)
                      |||||||||||+|||++++++.+||||||||++++.+|||++.+||++|++.||+|+||||||+|++++.++.++|||||
T Consensus         1 LlvGeGdfSFs~sL~~~~~~~~~l~ATs~ds~~~l~~kY~~~~~nl~~L~~~g~~V~~~VDat~l~~~~~~~~~~FDrIi   80 (166)
T PF10354_consen    1 LLVGEGDFSFSLSLARAFGSATNLVATSYDSEEELLQKYPDAEENLEELRELGVTVLHGVDATKLHKHFRLKNQRFDRII   80 (166)
T ss_pred             CeeeccchHHHHHHHHHcCCCCeEEEeecCchHHHHHhcccHHHHHHHHhhcCCccccCCCCCcccccccccCCcCCEEE
Confidence            89999999999999999988999999999999999999999999999999999999999999999999988899999999


Q ss_pred             EcCCcCCCcccccchHHHHhhHHHHHHHHHHHHhhcccCCCeEEEEeccCCCCCcccHHhHHHHhCcEEEEEeecCCCCC
Q 044601           99 YNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKIGLTLQEVVPFCKQDY  178 (213)
Q Consensus        99 FNFPH~G~~~~e~~~~~i~~n~~Ll~~Ff~Sa~~~L~~~~G~ihvTl~~~~py~~W~i~~lA~~~gl~l~~~~~F~~~~y  178 (213)
                      |||||+| .+.+++.++|++||+||.+||+||+++|+ ++|+|||||++|+||++|||+++|+++||+|.+++||++++|
T Consensus        81 FNFPH~G-~~~~~~~~~i~~nr~Ll~~Ff~Sa~~~L~-~~G~IhVTl~~~~py~~W~i~~lA~~~gl~l~~~~~F~~~~y  158 (166)
T PF10354_consen   81 FNFPHVG-GGSEDGKRNIRLNRELLRGFFKSASQLLK-PDGEIHVTLKDGQPYDSWNIEELAAEAGLVLVRKVPFDPSDY  158 (166)
T ss_pred             EeCCCCC-CCccchhHHHHHHHHHHHHHHHHHHHhcC-CCCEEEEEeCCCCCCccccHHHHHHhcCCEEEEEecCCHHHC
Confidence            9999999 46778899999999999999999999998 999999999999999999999999999999999999999999


Q ss_pred             CCCccccC
Q 044601          179 PGYDNKRA  186 (213)
Q Consensus       179 PgY~~krt  186 (213)
                      |||+|+||
T Consensus       159 pgY~~~rT  166 (166)
T PF10354_consen  159 PGYEHKRT  166 (166)
T ss_pred             CCcccCCC
Confidence            99999997

>KOG4174 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4174 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.07
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 97.92
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.78
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.72
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 97.71
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 97.69
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 97.67
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 97.62
3lpm_A259 Putative methyltransferase; structural genomics, p 97.56
3dh0_A219 SAM dependent methyltransferase; cystal structure, 97.55
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.44
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.42
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.4
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.38
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 97.37
3f4k_A257 Putative methyltransferase; structural genomics, P 97.37
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.32
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.31
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.3
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 97.29
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.25
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 97.2
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 97.19
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.19
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 97.16
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.15
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 97.14
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 97.14
2kw5_A202 SLR1183 protein; structural genomics, northeast st 97.12
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.12
1yb2_A275 Hypothetical protein TA0852; structural genomics, 97.11
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 97.08
3k6r_A278 Putative transferase PH0793; structural genomics, 97.03
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 97.02
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 97.0
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 96.98
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 96.97
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 96.95
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 96.94
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.94
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 96.94
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 96.9
2esr_A177 Methyltransferase; structural genomics, hypothetic 96.89
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 96.88
3ocj_A305 Putative exported protein; structural genomics, PS 96.88
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 96.88
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 96.83
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 96.82
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.81
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 96.81
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.78
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 96.77
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.76
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 96.75
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 96.73
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 96.7
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 96.67
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 96.66
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 96.66
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.66
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 96.63
2b78_A385 Hypothetical protein SMU.776; structure genomics, 96.62
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 96.62
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 96.62
3cc8_A230 Putative methyltransferase; structural genomics, j 96.62
2pt6_A321 Spermidine synthase; transferase, structural genom 96.6
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 96.57
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 96.56
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 96.54
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 96.54
1xxl_A239 YCGJ protein; structural genomics, protein structu 96.53
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 96.52
2p7i_A250 Hypothetical protein; putative methyltransferase, 96.51
2i7c_A283 Spermidine synthase; transferase, structural genom 96.51
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 96.5
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 96.47
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 96.46
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.45
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 96.43
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.42
3dtn_A234 Putative methyltransferase MM_2633; structural gen 96.41
1vl5_A260 Unknown conserved protein BH2331; putative methylt 96.41
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 96.35
2b25_A336 Hypothetical protein; structural genomics, methyl 96.34
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 96.32
1xj5_A334 Spermidine synthase 1; structural genomics, protei 96.32
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 96.29
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 96.29
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 96.29
3gjy_A317 Spermidine synthase; APC62791, structural genomics 96.28
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.27
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 96.23
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 96.23
2o07_A304 Spermidine synthase; structural genomics, structur 96.21
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 96.2
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 96.2
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.15
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 96.13
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.13
1jsx_A207 Glucose-inhibited division protein B; methyltransf 96.11
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 96.11
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 96.07
2r3s_A335 Uncharacterized protein; methyltransferase domain, 95.99
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 95.99
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 95.98
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 95.95
1vlm_A219 SAM-dependent methyltransferase; possible histamin 95.94
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 95.93
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 95.9
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 95.89
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 95.87
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 95.84
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 95.83
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 95.82
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 95.8
3lcc_A235 Putative methyl chloride transferase; halide methy 95.8
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 95.77
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 95.66
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 95.65
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 95.64
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 95.62
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 95.61
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 95.59
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 95.58
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 95.57
3hnr_A220 Probable methyltransferase BT9727_4108; structural 95.53
3duw_A223 OMT, O-methyltransferase, putative; alternating of 95.51
1wzn_A252 SAM-dependent methyltransferase; structural genomi 95.49
3i9f_A170 Putative type 11 methyltransferase; structural gen 95.46
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 95.44
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 95.43
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 95.33
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 95.3
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 95.28
2cmg_A262 Spermidine synthase; transferase, putrescine amino 95.14
1ws6_A171 Methyltransferase; structural genomics, riken stru 95.12
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 95.05
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 95.03
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 95.03
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 94.9
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 94.89
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 94.87
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 94.85
3gu3_A284 Methyltransferase; alpha-beta protein, structural 94.83
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 94.83
2i62_A265 Nicotinamide N-methyltransferase; structural genom 94.82
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 94.77
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 94.77
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 94.74
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 94.73
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 94.72
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 94.68
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 94.63
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 94.62
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 94.59
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 94.57
3m70_A286 Tellurite resistance protein TEHB homolog; structu 94.5
2avd_A229 Catechol-O-methyltransferase; structural genomics, 94.44
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 94.44
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 94.43
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 94.35
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 94.32
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 94.31
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 94.29
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 94.27
2fpo_A202 Methylase YHHF; structural genomics, putative meth 94.22
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 93.98
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 93.88
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 93.84
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 93.81
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 93.79
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 93.76
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 93.69
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 93.63
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 93.63
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 93.58
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 93.55
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 93.52
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 93.48
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 93.41
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 93.39
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 93.35
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 93.32
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 93.3
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 93.19
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 93.19
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 92.98
1ne2_A200 Hypothetical protein TA1320; structural genomics, 92.96
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 92.87
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 92.79
3m33_A226 Uncharacterized protein; structural genomics, PSI- 92.77
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 92.71
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 92.69
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 92.67
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 92.6
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 92.57
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 92.49
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 92.37
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 92.33
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 92.32
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 92.24
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 92.2
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 92.12
2h00_A254 Methyltransferase 10 domain containing protein; st 92.06
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 91.69
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 91.62
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 91.6
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 91.47
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 90.86
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 90.28
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 90.23
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 90.2
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 90.15
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 89.9
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 89.88
3dp7_A363 SAM-dependent methyltransferase; structural genomi 89.58
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 89.42
3ege_A261 Putative methyltransferase from antibiotic biosyn 89.34
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 88.66
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 88.06
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 86.94
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 86.86
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 86.71
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 86.62
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 86.03
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 85.58
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 84.51
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 84.37
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 84.1
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 83.85
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 83.53
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 81.82
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 81.78
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 80.41
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 80.33
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 80.23
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 80.02
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
Probab=98.07  E-value=0.00011  Score=58.45  Aligned_cols=158  Identities=15%  Similarity=0.047  Sum_probs=99.0

Q ss_pred             CCCCCeEEEEecCChhHHHHHHHHhCCCCeEEEeccCCHHHHHhhcchHHHHHHHHHhCCCEEEEeeeccccCCCccccC
Q 044601           12 YSSKQRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQMSQHFFLRT   91 (213)
Q Consensus        12 y~~~~~ILlVGEGnFSFS~aLa~~~~~~~~l~ATs~ds~~~l~~kY~~a~~ni~~L~~~g~~V~~gVDAt~L~~~~~l~~   91 (213)
                      ..++.+||=+|=|.=.++..|++.+++...++|.-.+  ++..+   .+..|++...-....-+..-|+..+....   .
T Consensus        20 ~~~~~~vLDlGcG~G~~~~~l~~~~~~~~~v~~vD~s--~~~~~---~a~~~~~~~~~~~~v~~~~~d~~~~~~~~---~   91 (197)
T 3eey_A           20 VKEGDTVVDATCGNGNDTAFLASLVGENGRVFGFDIQ--DKAIA---NTTKKLTDLNLIDRVTLIKDGHQNMDKYI---D   91 (197)
T ss_dssp             CCTTCEEEESCCTTSHHHHHHHHHHCTTCEEEEECSC--HHHHH---HHHHHHHHTTCGGGEEEECSCGGGGGGTC---C
T ss_pred             CCCCCEEEEcCCCCCHHHHHHHHHhCCCCEEEEEECC--HHHHH---HHHHHHHHcCCCCCeEEEECCHHHHhhhc---c
Confidence            3567899999999989999999998645577665544  33333   24555544311112345667887775432   3


Q ss_pred             CcccEEEEcCCcCCCcccccchHHHHhhHHHHHHHHHHHHhhcccCCCeEEEEeccCCCCCcccHHh---HHH---HhCc
Q 044601           92 HKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVK---KAE---KIGL  165 (213)
Q Consensus        92 ~~FDrIiFNFPH~G~~~~e~~~~~i~~n~~Ll~~Ff~Sa~~~L~~~~G~ihvTl~~~~py~~W~i~~---lA~---~~gl  165 (213)
                      ..||.|++|+|.......     .+..+......+++.+..+|+ ++|.+.+....+.+........   ..+   ..++
T Consensus        92 ~~fD~v~~~~~~~~~~~~-----~~~~~~~~~~~~l~~~~~~Lk-~gG~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  165 (197)
T 3eey_A           92 CPVKAVMFNLGYLPSGDH-----SISTRPETTIQALSKAMELLV-TGGIITVVIYYGGDTGFEEKEKVLEFLKGVDQKKF  165 (197)
T ss_dssp             SCEEEEEEEESBCTTSCT-----TCBCCHHHHHHHHHHHHHHEE-EEEEEEEEECCBTTTBSHHHHHHHHHHTTSCTTTE
T ss_pred             CCceEEEEcCCcccCccc-----ccccCcccHHHHHHHHHHhCc-CCCEEEEEEccCCCCcHHHHHHHHHHHHhCCCCcE
Confidence            789999999977442111     122333445569999999998 9999999886654433222222   222   3467


Q ss_pred             EEEEEeecCCCCCCCCcc
Q 044601          166 TLQEVVPFCKQDYPGYDN  183 (213)
Q Consensus       166 ~l~~~~~F~~~~yPgY~~  183 (213)
                      .+.....+....-|+|-.
T Consensus       166 ~v~~~~~~~~~~~pp~~~  183 (197)
T 3eey_A          166 IVQRTDFINQANCPPILV  183 (197)
T ss_dssp             EEEEEEETTCCSCCCEEE
T ss_pred             EEEEEEeccCccCCCeEE
Confidence            777766666656666653
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.06
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.04
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 97.55
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.54
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 97.38
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.21
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.0
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 96.86
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 96.83
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 96.64
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 96.59
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.56
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 96.51
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 96.36
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 96.26
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 96.23
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.06
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 95.89
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 95.88
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 95.59
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 95.59
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 95.5
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 95.43
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 95.42
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 95.37
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 95.34
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 95.28
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 95.22
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 95.03
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 94.79
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 94.66
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 94.64
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 94.56
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 94.41
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 94.39
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 94.26
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 94.22
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 94.1
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 93.97
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 93.93
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 93.81
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 93.64
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 93.23
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 93.21
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 93.01
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 92.92
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 92.84
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 92.75
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 92.49
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 92.06
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 91.93
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 91.9
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 91.76
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 91.0
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 90.89
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 90.46
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.0
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 89.8
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.53
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 89.4
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 89.32
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 89.14
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 89.09
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 88.55
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 87.16
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 86.51
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 86.24
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 86.17
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 85.82
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 84.56
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 82.77
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 82.76
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 82.65
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 82.01
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 81.92
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 81.75
d2h00a1250 Methyltransferase 10 domain containing protein MET 81.69
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: TrmB-like
domain: tRNA (guanine-N(7)-)-methyltransferase TrmB
species: Streptococcus pneumoniae [TaxId: 1313]

Probab=98.06  E-value=2e-05  Score=63.73  Aligned_cols=158  Identities=24%  Similarity=0.368  Sum_probs=103.5

Q ss_pred             ccccccCCCCC-CeEEEEecCChhHHHHHHHHhCCCCeEEEeccCCHHHHHhhcchHHHHHHHHHhCCCEEEEeeecccc
Q 044601            5 TEKWSNHYSSK-QRILLVGEGDFSFSLCLAREFGFAHNMVATCLDTQETIANKYSNAVDNVRELEERGCLVFYGVDAMQM   83 (213)
Q Consensus         5 ~~k~~~~y~~~-~~ILlVGEGnFSFS~aLa~~~~~~~~l~ATs~ds~~~l~~kY~~a~~ni~~L~~~g~~V~~gVDAt~L   83 (213)
                      .-+|-..|.+. ..||=||=|+=.|...||+.+ +..++++--.. ...+..    +...+..+.-.++.++ ..||..|
T Consensus        21 ~~~w~~~f~~~~plvLdIGcG~G~~~~~lA~~~-p~~~~iGid~~-~~~v~~----a~~~~~~~~l~Ni~~~-~~da~~l   93 (204)
T d1yzha1          21 KAKWRDLFGNDNPIHVEVGSGKGAFVSGMAKQN-PDINYIGIDIQ-KSVLSY----ALDKVLEVGVPNIKLL-WVDGSDL   93 (204)
T ss_dssp             TTTHHHHHTSCCCEEEEESCTTSHHHHHHHHHC-TTSEEEEEESC-HHHHHH----HHHHHHHHCCSSEEEE-ECCSSCG
T ss_pred             hccHHHHcCCCCCeEEEEeccCCHHHHHHHHHC-CCCceEEEecc-HHHHHH----HHHhhhhhccccceee-ecCHHHH
Confidence            45788888654 457888888888899999887 47788885544 332222    3444444433345444 5699998


Q ss_pred             CCCccccCCcccEEEEcCCcCCCcccccchHHHHhhHHHHHHHHHHHHhhcccCCCeEEEEeccCCCCCcccHHhHHHHh
Q 044601           84 SQHFFLRTHKFDRVIYNFPHVGFIFRENSYCQIQLNKELVKGFLRNAKLLLKEENGEIHVTHKEGDPYNKWELVKKAEKI  163 (213)
Q Consensus        84 ~~~~~l~~~~FDrIiFNFPH~G~~~~e~~~~~i~~n~~Ll~~Ff~Sa~~~L~~~~G~ihvTl~~~~py~~W~i~~lA~~~  163 (213)
                      ...+  ....+|.|+.|||..-.+.+.      ++.|.+-..|+.....+|+ ++|.++|+- +.+.|-.|-++.+.+ .
T Consensus        94 ~~~~--~~~~~~~i~i~fPdPw~K~~h------~krRl~~~~~l~~~~~~Lk-pgG~l~i~T-D~~~Y~~~~le~~~~-~  162 (204)
T d1yzha1          94 TDYF--EDGEIDRLYLNFSDPWPKKRH------EKRRLTYKTFLDTFKRILP-ENGEIHFKT-DNRGLFEYSLVSFSQ-Y  162 (204)
T ss_dssp             GGTS--CTTCCSEEEEESCCCCCSGGG------GGGSTTSHHHHHHHHHHSC-TTCEEEEEE-SCHHHHHHHHHHHHH-H
T ss_pred             hhhc--cCCceehhcccccccccchhh------hhhhhhHHHHHHHHHHhCC-CCcEEEEEE-CCccHHHHHHHHHHH-C
Confidence            7554  467899999999998865321      1223334789999999998 999999865 344577777766654 4


Q ss_pred             CcEEEEE-eecCCCCCCC
Q 044601          164 GLTLQEV-VPFCKQDYPG  180 (213)
Q Consensus       164 gl~l~~~-~~F~~~~yPg  180 (213)
                      ++.+... .....+++++
T Consensus       163 ~~~~~~~~~~~~~~~~~~  180 (204)
T d1yzha1         163 GMKLNGVWLDLHASDFEG  180 (204)
T ss_dssp             TCEEEEEESSGGGSCCCC
T ss_pred             CcccccccccccccccCC
Confidence            6554432 2233444544
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure