Citrus Sinensis ID: 044609


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MEMVEEDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYSPPK
ccccccEEEEEcccHHHHHHHHHHHHccccEEEEccccccccccEEEEccHHHHHHHHHccccHHHHcccccccEEEEEEccccEEEEEEcccccccccccEEEEEHHHHHHHHHHHcccccEEEccEEEEEEcccccccccEEEEEccccEEEccEEEEcccccHHHHccccccccccccEEEEEEEEEccccccccccEEEEEEcccEEEEEEccccEEEEEEEEccccc
cccccccEEEEEcHHHHHHHHHHHHHccccEEEEEccHHHHHccccEEccHHHHHHHHHcccHHHHHHHccccccEEEEccccccEEccccHHHHHHccccEEEEEHHHHHHHHHHHcccccEEEccEEEEEEccccccccEEEEEEccccEEEEEEEEEcccHHHHHHHHHcccccccccEEEEEEEEEccccccccccEEEEEcccEEEEEEEcccccEEEEEEEccccc
MEMVEEDVVIIGAGIAGLATAVALRRLGIKALVLEKsdglratgaaltlspNAWLALDALGvshkltsvyapakrvfvtnlgtgatqelsyagksgrigsglrSVHRQSLLEALadelpddtiqfsSKIAaidsqtlngsSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSesinsgrssvrglavfphghglnqDIRQFVGvgfragfiplndrdVYWFLNRYSPPK
MEMVEEDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGfiplndrdvyWFLNRYSPPK
MEMVEEDvviigagiaglatavalRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSllealadelpddTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYSPPK
******DVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTGATQELSYAGK**RIG**L**V***SLLEALADELPDDTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRY****
****EED**IIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYSPP*
MEMVEEDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYSPPK
*****EDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYS***
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMVEEDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYSPPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
B6D1N4 384 FAD-dependent urate hydro yes no 0.922 0.557 0.262 2e-13
A6T923 384 FAD-dependent urate hydro yes no 0.922 0.557 0.262 2e-13
Q9F131 394 3-hydroxybenzoate 6-hydro N/A no 0.706 0.416 0.286 5e-10
Q53552 435 Salicylate hydroxylase OS no no 0.646 0.344 0.309 2e-07
B5B0J6 384 FAD-dependent urate hydro yes no 0.896 0.541 0.241 3e-06
Q1RLY6 474 Kynurenine 3-monooxygenas yes no 0.767 0.375 0.247 4e-06
Q5EXK1 397 3-hydroxybenzoate 6-hydro no no 0.620 0.362 0.289 7e-06
P23262 434 Salicylate hydroxylase OS no no 0.711 0.380 0.268 2e-05
Q8TQQ6 407 Digeranylgeranylglyceroph yes no 0.672 0.383 0.270 2e-05
Q1B5E2 573 3-(3-hydroxy-phenyl)propi no no 0.715 0.289 0.265 3e-05
>sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 Back     alignment and function desciption
 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 97/221 (43%), Gaps = 7/221 (3%)

Query: 9   VIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTS 68
           ++IGAGI GL+ AVAL++ GI   V E    ++  GAA+++ PN    +  LG+   + +
Sbjct: 4   IVIGAGIGGLSAAVALKQSGIDCDVYEAVKEIKPVGAAISVWPNGVKCMAHLGMGDIMET 63

Query: 69  VYAPAKRVFVTNLGTGATQ-ELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQFSS 127
              P +R+   +  +G    + S A    R GS    V R  L   + D    D++QF  
Sbjct: 64  FGGPLRRMAYRDFRSGENMTQFSLAPLIERTGSRPCPVSRAELQREMLDYWGRDSVQFGK 123

Query: 128 KIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQW-LGLS-ESINSGRSSV 185
           ++   +      +    +   D +     +LI  DG HS +  W LG + +   +G  + 
Sbjct: 124 RVTRCEED----ADGVTVWFTDGSSASGDLLIAADGSHSALRPWVLGFTPQRRYAGYVNW 179

Query: 186 RGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLN 226
            GL               FVG G R   +P++    Y+F +
Sbjct: 180 NGLVEIDEALAPGDQWTTFVGEGKRVSLMPVSAGRFYFFFD 220




Catalyzes the hydroxylation of uric acid to 5-hydroxyisourate.
Klebsiella pneumoniae (taxid: 573)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 1EC: 3
>sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 Back     alignment and function description
>sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 Back     alignment and function description
>sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 Back     alignment and function description
>sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 Back     alignment and function description
>sp|Q1RLY6|KMO_DANRE Kynurenine 3-monooxygenase OS=Danio rerio GN=kmo PE=2 SV=1 Back     alignment and function description
>sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 Back     alignment and function description
>sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 Back     alignment and function description
>sp|Q8TQQ6|GGR_METAC Digeranylgeranylglycerophospholipid reductase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1484 PE=3 SV=1 Back     alignment and function description
>sp|Q1B5E2|MHPA_MYCSS 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain MCS) GN=mhpA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
255578424 462 monoxygenase, putative [Ricinus communis 0.952 0.478 0.663 3e-79
255578420 408 monoxygenase, putative [Ricinus communis 0.931 0.529 0.669 6e-79
224126917 417 predicted protein [Populus trichocarpa] 0.969 0.539 0.643 1e-72
224105743 414 predicted protein [Populus trichocarpa] 0.952 0.533 0.644 6e-72
359477074 413 PREDICTED: 3-hydroxybenzoate 6-hydroxyla 0.961 0.539 0.612 1e-70
296088642 356 unnamed protein product [Vitis vinifera] 0.952 0.620 0.597 3e-70
359477076 408 PREDICTED: 3-hydroxybenzoate 6-hydroxyla 0.952 0.541 0.597 1e-69
224056051 404 predicted protein [Populus trichocarpa] 0.931 0.534 0.635 2e-69
225431405 411 PREDICTED: 3-hydroxybenzoate 6-hydroxyla 0.961 0.542 0.592 2e-69
255578418 412 monoxygenase, putative [Ricinus communis 0.952 0.536 0.615 2e-66
>gi|255578424|ref|XP_002530077.1| monoxygenase, putative [Ricinus communis] gi|223530430|gb|EEF32317.1| monoxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 184/226 (81%), Gaps = 5/226 (2%)

Query: 1   MEMVEEDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDAL 60
           MEMV+ D VI+GAGIAGLATAVAL+R+GI+AL+LE+SDGLRATG+ALTL PNAWLALDAL
Sbjct: 52  MEMVQ-DAVIVGAGIAGLATAVALKRVGIQALILERSDGLRATGSALTLFPNAWLALDAL 110

Query: 61  GVSHKLTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSLLEALADELPD 120
           GVSH LTS Y+ A R  VTN+ TGA QE+S+ G +G    G +SVHR++LLEAL  ELP 
Sbjct: 111 GVSHMLTSFYSSALRGSVTNVATGAVQEISFVGNNG----GPKSVHRKALLEALVQELPA 166

Query: 121 DTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINS 180
           D+++FSSK  AI+     G+S  +++L D T +K+KVLIGCDGVHS+VAQWLGLS   +S
Sbjct: 167 DSVRFSSKFTAIEMVEQGGTSIPVVHLEDGTTVKSKVLIGCDGVHSVVAQWLGLSAPFHS 226

Query: 181 GRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLN 226
           GRSSVRGL+VFP GHGL Q I+QFV VG RAGF+PLND+++YWFL 
Sbjct: 227 GRSSVRGLSVFPQGHGLEQAIKQFVDVGKRAGFVPLNDKEIYWFLT 272




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255578420|ref|XP_002530075.1| monoxygenase, putative [Ricinus communis] gi|223530428|gb|EEF32315.1| monoxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224126917|ref|XP_002329505.1| predicted protein [Populus trichocarpa] gi|222870185|gb|EEF07316.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105743|ref|XP_002333773.1| predicted protein [Populus trichocarpa] gi|222838457|gb|EEE76822.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359477074|ref|XP_002272352.2| PREDICTED: 3-hydroxybenzoate 6-hydroxylase 1-like [Vitis vinifera] gi|296088638|emb|CBI37629.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088642|emb|CBI37633.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477076|ref|XP_002272571.2| PREDICTED: 3-hydroxybenzoate 6-hydroxylase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224056051|ref|XP_002298720.1| predicted protein [Populus trichocarpa] gi|222845978|gb|EEE83525.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225431405|ref|XP_002272608.1| PREDICTED: 3-hydroxybenzoate 6-hydroxylase 1 [Vitis vinifera] gi|296088643|emb|CBI37634.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255578418|ref|XP_002530074.1| monoxygenase, putative [Ricinus communis] gi|223530427|gb|EEF32314.1| monoxygenase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2121254 407 AT4G38540 "AT4G38540" [Arabido 0.853 0.486 0.406 8.5e-33
TAIR|locus:2153499 406 AT5G05320 "AT5G05320" [Arabido 0.853 0.487 0.392 1.8e-30
TAIR|locus:2060584 427 CTF2B "AT2G29720" [Arabidopsis 0.857 0.466 0.373 1.6e-29
TAIR|locus:2058723 439 CTF2A "AT2G35660" [Arabidopsis 0.857 0.453 0.359 5.6e-29
TAIR|locus:2130694 422 MO1 "monooxygenase 1" [Arabido 0.814 0.447 0.333 1.6e-21
TAIR|locus:504955430271 AT4G15765 "AT4G15765" [Arabido 0.297 0.254 0.347 6.7e-10
TIGR_CMR|SPO_3692 395 SPO_3692 "monooxygenase, putat 0.698 0.410 0.295 0.00012
UNIPROTKB|A6T923 384 hpxO "FAD-dependent urate hydr 0.853 0.515 0.214 0.0002
UNIPROTKB|B6D1N4 384 hpxO "FAD-dependent urate hydr 0.853 0.515 0.214 0.0002
TIGR_CMR|SPO_2510 388 SPO_2510 "salicylate hydroxyla 0.775 0.463 0.227 0.00027
TAIR|locus:2121254 AT4G38540 "AT4G38540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 358 (131.1 bits), Expect = 8.5e-33, P = 8.5e-33
 Identities = 83/204 (40%), Positives = 113/204 (55%)

Query:    26 RLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTGA 85
             RLGI+++VLE S+ LRATG A T   NAW A++ALGVS  + S++   +   V  +  G 
Sbjct:    27 RLGIRSMVLESSETLRATGFAFTTWFNAWKAMEALGVSQHIRSLHDRLEGWVVGTISAGT 86

Query:    86 TQELSYAGKSGRIGSGLRSVHRQSXXXXXXXXXXXXTIQFSSKIAAIDSQTLNGSSAAII 145
                     +S    S  R V R+             TI+FSSK+  I+   L+G    + 
Sbjct:    87 PPTEMLFPESEEYES--RCVQRKLLLEALAGELPEETIRFSSKVVHIE---LSGCYKKV- 140

Query:   146 NLGDSTIIKAKVLIGCDGVHSMVAQWLGLSESINSGRSSVRGLAVFPHGHGLNQDIRQFV 205
             +L D TI+K KVL+GCDGV+S+V +WLG      + R ++RGL  FP GHG  +   QF 
Sbjct:   141 HLSDGTILKTKVLVGCDGVYSVVGKWLGFKNPATTARLAIRGLTHFPEGHGFGKRFFQFY 200

Query:   206 GVGFRAGFIPLNDRDVYWFLNRYS 229
             G G R+GFIP +   VYWFL   S
Sbjct:   201 GDGVRSGFIPCDHNTVYWFLTHTS 224




GO:0004497 "monooxygenase activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050832 "defense response to fungus" evidence=IEP
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
TAIR|locus:2153499 AT5G05320 "AT5G05320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060584 CTF2B "AT2G29720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058723 CTF2A "AT2G35660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130694 MO1 "monooxygenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955430 AT4G15765 "AT4G15765" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3692 SPO_3692 "monooxygenase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|A6T923 hpxO "FAD-dependent urate hydroxylase" [Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (taxid:272620)] Back     alignment and assigned GO terms
UNIPROTKB|B6D1N4 hpxO "FAD-dependent urate hydroxylase" [Klebsiella pneumoniae (taxid:573)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2510 SPO_2510 "salicylate hydroxylase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
COG0654 387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 8e-28
PRK06753 373 PRK06753, PRK06753, hypothetical protein; Provisio 9e-22
PRK07538 413 PRK07538, PRK07538, hypothetical protein; Provisio 1e-21
PRK08163 396 PRK08163, PRK08163, salicylate hydroxylase; Provis 4e-20
PRK06475 400 PRK06475, PRK06475, salicylate hydroxylase; Provis 1e-14
PRK06847 375 PRK06847, PRK06847, hypothetical protein; Provisio 4e-14
COG0644 396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 1e-13
TIGR01988 387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 3e-12
pfam01494 349 pfam01494, FAD_binding_3, FAD binding domain 6e-12
TIGR03219 414 TIGR03219, salicylate_mono, salicylate 1-monooxyge 2e-11
TIGR01984 382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy 2e-10
PRK06126 545 PRK06126, PRK06126, hypothetical protein; Provisio 4e-09
PRK07364 415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl h 2e-08
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 1e-07
PRK07333 403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h 3e-07
COG1233 487 COG1233, COG1233, Phytoene dehydrogenase and relat 4e-07
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 5e-07
PRK06184 502 PRK06184, PRK06184, hypothetical protein; Provisio 1e-06
COG0665 387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 2e-06
PRK07608 388 PRK07608, PRK07608, ubiquinone biosynthesis hydrox 2e-06
COG3380 331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 4e-06
TIGR01989 437 TIGR01989, COQ6, ubiquinone biosynthesis monooxyge 4e-06
COG1053 562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 4e-06
COG2072 443 COG2072, TrkA, Predicted flavoprotein involved in 4e-06
pfam00890 401 pfam00890, FAD_binding_2, FAD binding domain 6e-06
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 7e-06
PLN02927 668 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxa 8e-06
PRK05868 372 PRK05868, PRK05868, hypothetical protein; Validate 8e-06
PRK10157 428 PRK10157, PRK10157, putative oxidoreductase FixC; 1e-05
TIGR04018316 TIGR04018, Bthiol_YpdA, putative bacillithiol syst 1e-05
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 1e-05
COG0579 429 COG0579, COG0579, Predicted dehydrogenase [General 1e-05
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 2e-05
PRK06183 500 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr 2e-05
PRK11728 393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 3e-05
PRK01747 662 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)- 4e-05
pfam12831 415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 5e-05
PRK07208 479 PRK07208, PRK07208, hypothetical protein; Provisio 5e-05
PRK07045 388 PRK07045, PRK07045, putative monooxygenase; Review 6e-05
PRK07494 388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl h 7e-05
PRK12842 574 PRK12842, PRK12842, putative succinate dehydrogena 8e-05
PTZ00367 567 PTZ00367, PTZ00367, squalene epoxidase; Provisiona 1e-04
PRK09126 392 PRK09126, PRK09126, hypothetical protein; Provisio 1e-04
COG0578 532 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase 1e-04
COG1148 622 COG1148, HdrA, Heterodisulfide reductase, subunit 1e-04
PRK05329 422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate 2e-04
TIGR03364 365 TIGR03364, HpnW_proposed, FAD dependent oxidoreduc 2e-04
TIGR02734 502 TIGR02734, crtI_fam, phytoene desaturase 2e-04
PRK07804 541 PRK07804, PRK07804, L-aspartate oxidase; Provision 2e-04
PRK06292 460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 2e-04
PRK06069 577 PRK06069, sdhA, succinate dehydrogenase flavoprote 3e-04
PRK05732 395 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl h 3e-04
PRK08132 547 PRK08132, PRK08132, FAD-dependent oxidoreductase; 3e-04
PRK09853 1019 PRK09853, PRK09853, putative selenate reductase su 4e-04
PLN02268 435 PLN02268, PLN02268, probable polyamine oxidase 4e-04
PRK07236 386 PRK07236, PRK07236, hypothetical protein; Provisio 5e-04
COG1232 444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 5e-04
PRK08274 466 PRK08274, PRK08274, tricarballylate dehydrogenase; 6e-04
pfam05834 374 pfam05834, Lycopene_cycl, Lycopene cyclase protein 6e-04
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 7e-04
COG1249 454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 7e-04
PRK07233 434 PRK07233, PRK07233, hypothetical protein; Provisio 9e-04
TIGR01790 388 TIGR01790, carotene-cycl, lycopene cyclase family 0.001
PRK08013 400 PRK08013, PRK08013, oxidoreductase; Provisional 0.001
PRK07588 391 PRK07588, PRK07588, hypothetical protein; Provisio 0.001
PLN02529 738 PLN02529, PLN02529, lysine-specific histone demeth 0.001
TIGR04046 400 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxido 0.001
COG1231 450 COG1231, COG1231, Monoamine oxidase [Amino acid tr 0.001
PRK11883 451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 0.001
TIGR01813 439 TIGR01813, flavo_cyto_c, flavocytochrome c 0.001
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 0.002
TIGR02730 493 TIGR02730, carot_isom, carotene isomerase 0.002
PRK12844 557 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrog 0.002
TIGR02733 492 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD 0.002
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 0.003
PRK06134 581 PRK06134, PRK06134, putative FAD-binding dehydroge 0.003
PRK07190 487 PRK07190, PRK07190, hypothetical protein; Provisio 0.003
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 0.003
pfam01946229 pfam01946, Thi4, Thi4 family 0.003
pfam01134 391 pfam01134, GIDA, Glucose inhibited division protei 0.004
PRK07121 492 PRK07121, PRK07121, hypothetical protein; Validate 0.004
PRK12843 578 PRK12843, PRK12843, putative FAD-binding dehydroge 0.004
pfam03486 405 pfam03486, HI0933_like, HI0933-like protein 0.004
COG0029 518 COG0029, NadB, Aspartate oxidase [Coenzyme metabol 0.004
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
 Score =  108 bits (272), Expect = 8e-28
 Identities = 63/224 (28%), Positives = 99/224 (44%), Gaps = 13/224 (5%)

Query: 7   DVVIIGAGIAGLATAVALRRLGIKALVLEKS-DGLRATGAALTLSPNAWLALDALGVSHK 65
           DV I+GAG AGLA A+AL R G+   +LE++   L   G  + LSPNA  AL+ LG+  +
Sbjct: 4   DVAIVGAGPAGLALALALARAGLDVTLLERAPRELLERGRGIALSPNALRALERLGLWDR 63

Query: 66  LTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSLLEAL---ADELPDDT 122
           L ++  P   V V + G         A      G+    V R  LL AL   A  LP+ T
Sbjct: 64  LEALGVPPLHVMVVDDGGRRLLIFDAAELGR--GALGYVVPRSDLLNALLEAARALPNVT 121

Query: 123 IQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQ--WLGLSESINS 180
           ++F +++ A++    +G    +    D   + A +L+G DG +S V +   +      + 
Sbjct: 122 LRFGAEVEAVE---QDGDGVTVTLSFDGETLDADLLVGADGANSAVRRAAGIAEFSGRDY 178

Query: 181 GRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWF 224
           G++++         H      R      F    +PL D      
Sbjct: 179 GQTALVANVEPEEPHEGRAGERFTHAGPF--ALLPLPDNRSSVV 220


Length = 387

>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|180582 PRK06475, PRK06475, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|132263 TIGR03219, salicylate_mono, salicylate 1-monooxygenase Back     alignment and domain information
>gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|235704 PRK06126, PRK06126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236001 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|235728 PRK06184, PRK06184, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|233672 TIGR01989, COQ6, ubiquinone biosynthesis monooxygenase COQ6 Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>gnl|CDD|180297 PRK05868, PRK05868, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional Back     alignment and domain information
>gnl|CDD|188533 TIGR04018, Bthiol_YpdA, putative bacillithiol system oxidoreductase, YpdA family Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|234978 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|237224 PRK12842, PRK12842, putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|240384 PTZ00367, PTZ00367, squalene epoxidase; Provisional Back     alignment and domain information
>gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|132407 TIGR03364, HpnW_proposed, FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information
>gnl|CDD|236102 PRK07804, PRK07804, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235689 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235584 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|236158 PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information
>gnl|CDD|235980 PRK07236, PRK07236, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|236214 PRK08274, PRK08274, tricarballylate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|130850 TIGR01790, carotene-cycl, lycopene cyclase family protein Back     alignment and domain information
>gnl|CDD|236139 PRK08013, PRK08013, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|169028 PRK07588, PRK07588, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 Back     alignment and domain information
>gnl|CDD|234447 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxidoreductase, MSMEG_0569 family Back     alignment and domain information
>gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|233583 TIGR01813, flavo_cyto_c, flavocytochrome c Back     alignment and domain information
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|131777 TIGR02730, carot_isom, carotene isomerase Back     alignment and domain information
>gnl|CDD|183787 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235955 PRK07190, PRK07190, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information
>gnl|CDD|216319 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|180854 PRK07121, PRK07121, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|223108 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 100.0
PRK06753 373 hypothetical protein; Provisional 99.98
PRK08013 400 oxidoreductase; Provisional 99.98
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.98
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 99.97
PRK07045 388 putative monooxygenase; Reviewed 99.97
PRK07588 391 hypothetical protein; Provisional 99.97
PRK05868 372 hypothetical protein; Validated 99.97
PRK06475 400 salicylate hydroxylase; Provisional 99.97
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.97
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.97
PRK09126 392 hypothetical protein; Provisional 99.97
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.97
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 99.97
PRK08163 396 salicylate hydroxylase; Provisional 99.97
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.97
PRK08244 493 hypothetical protein; Provisional 99.97
PRK06847 375 hypothetical protein; Provisional 99.97
PRK07190 487 hypothetical protein; Provisional 99.97
PRK06184 502 hypothetical protein; Provisional 99.97
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.97
KOG2614 420 consensus Kynurenine 3-monooxygenase and related f 99.97
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.97
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.96
PTZ00367 567 squalene epoxidase; Provisional 99.96
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 99.96
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.96
PRK07538 413 hypothetical protein; Provisional 99.96
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.96
PRK07236 386 hypothetical protein; Provisional 99.96
PRK06185 407 hypothetical protein; Provisional 99.96
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.96
PRK08294 634 phenol 2-monooxygenase; Provisional 99.96
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.96
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.96
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 99.96
PRK06996 398 hypothetical protein; Provisional 99.96
PLN02985 514 squalene monooxygenase 99.96
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 99.95
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 99.95
PRK08132 547 FAD-dependent oxidoreductase; Provisional 99.95
PRK06126 545 hypothetical protein; Provisional 99.95
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 99.95
PRK06834 488 hypothetical protein; Provisional 99.95
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 99.93
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.93
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.93
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 99.91
PRK11445 351 putative oxidoreductase; Provisional 99.91
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 99.9
PRK10015 429 oxidoreductase; Provisional 99.89
PRK10157 428 putative oxidoreductase FixC; Provisional 99.88
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 99.88
KOG3855 481 consensus Monooxygenase involved in coenzyme Q (ub 99.87
PLN02463 447 lycopene beta cyclase 99.85
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.85
PLN02697 529 lycopene epsilon cyclase 99.84
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.82
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 99.8
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.78
COG2081 408 Predicted flavoproteins [General function predicti 99.77
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 99.77
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.74
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 99.72
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 99.71
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 99.7
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.7
PRK11728 393 hydroxyglutarate oxidase; Provisional 99.7
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.7
COG0579 429 Predicted dehydrogenase [General function predicti 99.69
TIGR01377 380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.69
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.67
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.66
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.66
TIGR01373 407 soxB sarcosine oxidase, beta subunit family, heter 99.66
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.64
KOG2820 399 consensus FAD-dependent oxidoreductase [General fu 99.64
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.62
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 99.62
PRK05257 494 malate:quinone oxidoreductase; Validated 99.62
PLN02464 627 glycerol-3-phosphate dehydrogenase 99.6
TIGR01320 483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.59
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.58
PTZ00383 497 malate:quinone oxidoreductase; Provisional 99.58
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 99.57
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 99.55
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.54
PRK13339 497 malate:quinone oxidoreductase; Reviewed 99.54
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.54
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.53
TIGR03329 460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.52
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 99.51
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 99.5
TIGR03364 365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.5
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.49
COG0665 387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.49
COG0492 305 TrxB Thioredoxin reductase [Posttranslational modi 99.47
PLN02661357 Putative thiazole synthesis 99.46
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 99.45
TIGR01292 300 TRX_reduct thioredoxin-disulfide reductase. This m 99.42
TIGR00275 400 flavoprotein, HI0933 family. The model when search 99.39
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 99.38
PRK08274 466 tricarballylate dehydrogenase; Validated 99.38
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.38
PF00890 417 FAD_binding_2: FAD binding domain of the Pfam fami 99.37
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 99.37
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 99.36
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 99.36
PRK07804 541 L-aspartate oxidase; Provisional 99.36
PRK06481 506 fumarate reductase flavoprotein subunit; Validated 99.35
TIGR01813 439 flavo_cyto_c flavocytochrome c. This model describ 99.35
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 99.35
PRK07121 492 hypothetical protein; Validated 99.35
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.33
PRK06175 433 L-aspartate oxidase; Provisional 99.33
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.33
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 99.32
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 99.32
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 99.31
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.31
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.3
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.3
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.3
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.3
PF06039 488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 99.29
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.28
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 99.28
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.28
PRK08401 466 L-aspartate oxidase; Provisional 99.28
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.28
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.27
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 99.26
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 99.26
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 99.25
PLN02568 539 polyamine oxidase 99.25
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.24
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 99.24
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 99.24
PRK08275 554 putative oxidoreductase; Provisional 99.24
PRK08071 510 L-aspartate oxidase; Provisional 99.23
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 99.22
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 99.22
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 99.21
PRK10262321 thioredoxin reductase; Provisional 99.18
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 99.18
PLN02815 594 L-aspartate oxidase 99.17
PRK14694 468 putative mercuric reductase; Provisional 99.17
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 99.16
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.16
PRK09077 536 L-aspartate oxidase; Provisional 99.16
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 99.15
PRK07395 553 L-aspartate oxidase; Provisional 99.15
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 99.15
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.14
PRK11883 451 protoporphyrinogen oxidase; Reviewed 99.14
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 99.14
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 99.14
KOG2853 509 consensus Possible oxidoreductase [General functio 99.14
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.13
PRK07512 513 L-aspartate oxidase; Provisional 99.13
PRK06370 463 mercuric reductase; Validated 99.13
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 99.13
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 99.13
PRK12842 574 putative succinate dehydrogenase; Reviewed 99.12
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 99.12
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 99.11
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.11
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 99.11
PRK06116 450 glutathione reductase; Validated 99.1
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 99.1
PRK09897 534 hypothetical protein; Provisional 99.1
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 99.1
PRK12416 463 protoporphyrinogen oxidase; Provisional 99.08
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.08
KOG2665 453 consensus Predicted FAD-dependent oxidoreductase [ 99.08
PLN02612 567 phytoene desaturase 99.07
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.07
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.06
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 99.06
PLN02507 499 glutathione reductase 99.05
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 99.05
PRK12839 572 hypothetical protein; Provisional 99.05
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.05
PRK13748 561 putative mercuric reductase; Provisional 99.04
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 99.04
TIGR02485 432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 99.03
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.03
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.02
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 99.01
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 98.99
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.99
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.99
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 98.99
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.98
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.98
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.95
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.95
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 98.94
PTZ00058 561 glutathione reductase; Provisional 98.94
PRK14727 479 putative mercuric reductase; Provisional 98.93
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.92
PF13434 341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.92
PLN02676 487 polyamine oxidase 98.92
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.91
PLN02546 558 glutathione reductase 98.91
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.89
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.87
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 98.87
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.86
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 98.86
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 98.86
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.85
COG2907 447 Predicted NAD/FAD-binding protein [General functio 98.85
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 98.83
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.82
KOG2852 380 consensus Possible oxidoreductase [General functio 98.8
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.79
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 98.79
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 98.78
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 98.78
COG2509 486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.78
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.78
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 98.77
TIGR03197 381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 98.77
COG3573 552 Predicted oxidoreductase [General function predict 98.77
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.77
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 98.76
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 98.75
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 98.74
KOG2404 477 consensus Fumarate reductase, flavoprotein subunit 98.74
PRK07208 479 hypothetical protein; Provisional 98.74
PTZ00153 659 lipoamide dehydrogenase; Provisional 98.73
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 98.72
KOG0404 322 consensus Thioredoxin reductase [Posttranslational 98.72
PRK07845 466 flavoprotein disulfide reductase; Reviewed 98.72
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.72
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.72
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 98.71
PRK06116 450 glutathione reductase; Validated 98.71
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.7
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.68
KOG1335 506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.68
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 98.67
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 98.66
COG3486 436 IucD Lysine/ornithine N-monooxygenase [Secondary m 98.65
PRK07846 451 mycothione reductase; Reviewed 98.65
PRK07846 451 mycothione reductase; Reviewed 98.64
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.63
PRK07233 434 hypothetical protein; Provisional 98.62
TIGR01421 450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.62
PRK07251 438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.62
PLN02576 496 protoporphyrinogen oxidase 98.6
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 98.58
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 98.58
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 98.58
PLN02507 499 glutathione reductase 98.58
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 98.57
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.57
PRK07845 466 flavoprotein disulfide reductase; Reviewed 98.57
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 98.56
COG3075 421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.56
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.56
COG3349 485 Uncharacterized conserved protein [Function unknow 98.56
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 98.56
COG1249 454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.56
PLN02268 435 probable polyamine oxidase 98.55
TIGR02053 463 MerA mercuric reductase. This model represents the 98.52
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 98.52
PRK02106 560 choline dehydrogenase; Validated 98.52
TIGR02053 463 MerA mercuric reductase. This model represents the 98.52
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.52
PLN02487 569 zeta-carotene desaturase 98.51
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 98.51
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.5
PRK06370 463 mercuric reductase; Validated 98.48
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 98.48
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 98.48
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.48
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 98.48
PTZ00052 499 thioredoxin reductase; Provisional 98.47
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.45
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.45
PRK12831464 putative oxidoreductase; Provisional 98.45
PRK05329 422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.44
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 98.44
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.44
PTZ00058 561 glutathione reductase; Provisional 98.41
PRK13512 438 coenzyme A disulfide reductase; Provisional 98.41
COG0562 374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.41
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.41
PLN02852 491 ferredoxin-NADP+ reductase 98.4
PTZ00052499 thioredoxin reductase; Provisional 98.38
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 98.37
PRK14694 468 putative mercuric reductase; Provisional 98.37
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.36
PRK09564 444 coenzyme A disulfide reductase; Reviewed 98.36
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 98.35
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 98.34
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 98.34
PRK14727 479 putative mercuric reductase; Provisional 98.34
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 98.33
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.32
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.3
PRK06567 1028 putative bifunctional glutamate synthase subunit b 98.29
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 98.29
PLN02529 738 lysine-specific histone demethylase 1 98.28
PLN02546 558 glutathione reductase 98.27
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.27
KOG2960328 consensus Protein involved in thiamine biosynthesi 98.26
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.26
PLN02328 808 lysine-specific histone demethylase 1 homolog 98.26
PRK13748 561 putative mercuric reductase; Provisional 98.26
PTZ00188 506 adrenodoxin reductase; Provisional 98.25
KOG3923 342 consensus D-aspartate oxidase [Amino acid transpor 98.24
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 98.23
PRK12814 652 putative NADPH-dependent glutamate synthase small 98.22
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 98.21
PTZ00153 659 lipoamide dehydrogenase; Provisional 98.2
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 98.19
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 98.18
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 98.17
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.16
KOG4254 561 consensus Phytoene desaturase [Coenzyme transport 98.15
PRK12770 352 putative glutamate synthase subunit beta; Provisio 98.13
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.11
PRK10262321 thioredoxin reductase; Provisional 98.1
KOG3851 446 consensus Sulfide:quinone oxidoreductase/flavo-bin 98.09
PF01593 450 Amino_oxidase: Flavin containing amine oxidoreduct 98.09
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.08
PLN02785 587 Protein HOTHEAD 98.07
PF08491 276 SE: Squalene epoxidase; InterPro: IPR013698 This d 98.07
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 98.06
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.05
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.05
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 98.04
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 98.03
KOG1276 491 consensus Protoporphyrinogen oxidase [Coenzyme tra 98.0
PLN03000 881 amine oxidase 97.99
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.95
PRK13984604 putative oxidoreductase; Provisional 97.94
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.93
PLN02976 1713 amine oxidase 97.91
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.86
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.79
TIGR03862 376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 97.75
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.74
PRK12831464 putative oxidoreductase; Provisional 97.74
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 97.72
KOG1800 468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 97.72
PF00996 438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 97.7
COG1206 439 Gid NAD(FAD)-utilizing enzyme possibly involved in 97.7
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.67
PF06100 500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.65
KOG1336 478 consensus Monodehydroascorbate/ferredoxin reductas 97.64
KOG0399 2142 consensus Glutamate synthase [Amino acid transport 97.63
KOG4716 503 consensus Thioredoxin reductase [Posttranslational 97.6
KOG0405 478 consensus Pyridine nucleotide-disulphide oxidoredu 97.59
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.52
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.5
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.48
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 97.47
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.41
PRK06249313 2-dehydropantoate 2-reductase; Provisional 97.4
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.38
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.37
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.35
KOG1346 659 consensus Programmed cell death 8 (apoptosis-induc 97.33
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.27
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.26
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.21
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.18
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.17
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.17
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.16
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 97.15
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.14
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.14
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 97.11
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.09
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.08
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.07
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.06
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.05
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.04
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.02
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 97.01
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 97.0
PRK05708305 2-dehydropantoate 2-reductase; Provisional 96.94
PTZ00082321 L-lactate dehydrogenase; Provisional 96.92
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.91
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.9
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.87
COG5044 434 MRS6 RAB proteins geranylgeranyltransferase compon 96.85
PRK06719157 precorrin-2 dehydrogenase; Validated 96.83
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.79
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.78
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.77
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.77
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.72
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 96.71
PRK12921305 2-dehydropantoate 2-reductase; Provisional 96.68
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.68
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.67
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.66
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.64
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 96.64
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 96.64
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 96.64
COG0446 415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.63
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.59
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 96.59
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 96.59
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.57
PRK15116268 sulfur acceptor protein CsdL; Provisional 96.56
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 96.53
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.53
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 96.52
KOG2495 491 consensus NADH-dehydrogenase (ubiquinone) [Energy 96.49
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.49
KOG1346 659 consensus Programmed cell death 8 (apoptosis-induc 96.45
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.44
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.43
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 96.43
PRK13984604 putative oxidoreductase; Provisional 96.43
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.4
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 96.38
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.37
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.37
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 96.36
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.34
PRK04148134 hypothetical protein; Provisional 96.32
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 96.31
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 96.3
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.27
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.25
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.25
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.23
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.23
KOG1439 440 consensus RAB proteins geranylgeranyltransferase c 96.19
KOG4405 547 consensus GDP dissociation inhibitor [Signal trans 96.19
PRK07417279 arogenate dehydrogenase; Reviewed 96.18
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 96.17
cd01483143 E1_enzyme_family Superfamily of activating enzymes 96.14
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.13
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.12
PRK06223307 malate dehydrogenase; Reviewed 96.11
PLN02602350 lactate dehydrogenase 96.1
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.08
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.07
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.06
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.03
PRK11730 715 fadB multifunctional fatty acid oxidation complex 95.99
PRK08328231 hypothetical protein; Provisional 95.98
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 95.96
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 95.96
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 95.95
PRK07502307 cyclohexadienyl dehydrogenase; Validated 95.95
PRK10669558 putative cation:proton antiport protein; Provision 95.94
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 95.94
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.91
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 95.9
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 95.89
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 95.84
KOG2755 334 consensus Oxidoreductase [General function predict 95.83
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.81
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 95.79
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.79
PTZ00117319 malate dehydrogenase; Provisional 95.78
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 95.77
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 95.76
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 95.76
PLN02852491 ferredoxin-NADP+ reductase 95.74
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 95.74
PRK12549284 shikimate 5-dehydrogenase; Reviewed 95.74
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 95.74
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 95.73
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.71
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.69
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 95.67
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.64
PLN02353 473 probable UDP-glucose 6-dehydrogenase 95.62
PRK08223287 hypothetical protein; Validated 95.62
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 95.6
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 95.59
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 95.59
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.57
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.56
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.55
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.53
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.53
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 95.53
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 95.53
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.51
PRK03659601 glutathione-regulated potassium-efflux system prot 95.5
PRK09496 453 trkA potassium transporter peripheral membrane com 95.49
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 95.49
PLN02240 352 UDP-glucose 4-epimerase 95.49
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.49
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.44
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 95.43
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=2.9e-30  Score=206.96  Aligned_cols=209  Identities=29%  Similarity=0.411  Sum_probs=158.7

Q ss_pred             cccEEEECCCHHHHHHHHHHHhCCCcEEEEecC-CCCcCcceeeeecccHHHHHHHcCChHHHHhhccCceeeEEEEcCC
Q 044609            5 EEDVVIIGAGIAGLATAVALRRLGIKALVLEKS-DGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGT   83 (232)
Q Consensus         5 ~~dV~IvG~G~~G~~~A~~L~~~g~~v~viE~~-~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~   83 (232)
                      .+||+||||||+|+++|..|+++|++|+||||. ......++++.+.++++++|+++|+.+.+.....+.......+...
T Consensus         2 ~~dV~IvGaG~aGl~lA~~L~~~G~~V~l~E~~~~~~~~~~r~~~l~~~~~~~L~~lG~~~~i~~~~~~~~~~~~~~~~~   81 (387)
T COG0654           2 MLDVAIVGAGPAGLALALALARAGLDVTLLERAPRELLERGRGIALSPNALRALERLGLWDRLEALGVPPLHVMVVDDGG   81 (387)
T ss_pred             CCCEEEECCCHHHHHHHHHHHhCCCcEEEEccCccccccCceeeeecHhHHHHHHHcCChhhhhhccCCceeeEEEecCC
Confidence            479999999999999999999999999999998 4555667999999999999999999888887776555554444333


Q ss_pred             CceeEEeccCCCCCCCCceeeeehHHHHHHHhhhCC---CCeEEeCceEEEEEecCCCCCccEEEEeC-CCcEEEccEEE
Q 044609           84 GATQELSYAGKSGRIGSGLRSVHRQSLLEALADELP---DDTIQFSSKIAAIDSQTLNGSSAAIINLG-DSTIIKAKVLI  159 (232)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~---~~~i~~~~~v~~i~~~~~~g~~~~~v~~~-~g~~~~a~~vV  159 (232)
                      .....++......  ....+.+.+..+.+.|.+.+.   +++++++++|+.++.++   +. +.+++. +|++++||+||
T Consensus        82 ~~~~~~~~~~~~~--~~~~~~~~~~~l~~~L~~~~~~~~~v~~~~~~~v~~~~~~~---~~-v~v~l~~dG~~~~a~llV  155 (387)
T COG0654          82 RRLLIFDAAELGR--GALGYVVPRSDLLNALLEAARALPNVTLRFGAEVEAVEQDG---DG-VTVTLSFDGETLDADLLV  155 (387)
T ss_pred             ceeEEecccccCC--CcceEEeEhHHHHHHHHHHHhhCCCcEEEcCceEEEEEEcC---Cc-eEEEEcCCCcEEecCEEE
Confidence            2234444444443  455678999999999999874   48999999999999885   33 557777 99999999999


Q ss_pred             ecCCCchhhhhhhcC-CCCc-ccceeEEEEeeecCCCCCCccceeEEEecCeEEEEEEcCCCeE
Q 044609          160 GCDGVHSMVAQWLGL-SESI-NSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDV  221 (232)
Q Consensus       160 ~A~G~~S~~r~~~~~-~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~  221 (232)
                      +|||.+|.+|+.++. .... .+.+..+.+.+....+ .....+.+|.+.+ .+.++|++++..
T Consensus       156 gADG~~S~vR~~~~~~~~~~~~y~~~~l~~~~~~~~~-~~~~~~~~~~~~~-~~~~~p~~~~~~  217 (387)
T COG0654         156 GADGANSAVRRAAGIAEFSGRDYGQTALVANVEPEEP-HEGRAGERFTHAG-PFALLPLPDNRS  217 (387)
T ss_pred             ECCCCchHHHHhcCCCCccCCCCCceEEEEEeecCCC-CCCeEEEEecCCC-ceEEEecCCCce
Confidence            999999999999993 3333 4555555555555422 2233444555555 488999996553



>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
3rp8_A 407 Crystal Structure Of Klebsiella Pneumoniae R204q Hp 3e-05
3rp6_A 407 Crystal Structure Of Klebsiella Pneumoniae Hpxo Com 4e-04
>pdb|3RP8|A Chain A, Crystal Structure Of Klebsiella Pneumoniae R204q Hpxo Complexed With Fad Length = 407 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 43/205 (20%), Positives = 79/205 (38%), Gaps = 7/205 (3%) Query: 25 RRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGTG 84 ++ GI V E ++ GAA+++ PN + LG+ + + P +R+ + +G Sbjct: 43 KQSGIDCDVYEAVKEIKPVGAAISVWPNGVKCMAHLGMGDIMETFGGPLRRMAYRDFRSG 102 Query: 85 ATQ-ELSYAGKSGRIGSGLRSVHRQSXXXXXXXXXXXXTIQFSSKIAAIDSQTLNGSSAA 143 + S A R GS V R ++QF ++ + + Sbjct: 103 ENMTQFSLAPLIERTGSRPCPVSRAELQREMLDYWGRDSVQFGKRVTRCEED----ADGV 158 Query: 144 IINLGDSTIIKAKVLIGCDGVHSMVAQW-LGLS-ESINSGRSSVRGLAVFPHGHGLNQDI 201 + D + +LI DG HS + W LG + + +G + GL Sbjct: 159 TVWFTDGSSASGDLLIAADGSHSALRPWVLGFTPQRRYAGYVNWNGLVEIDEALAPGDQW 218 Query: 202 RQFVGVGFRAGFIPLNDRDVYWFLN 226 FVG G + +P++ Y+F + Sbjct: 219 TTFVGEGKQVSLMPVSAGRFYFFFD 243
>pdb|3RP6|A Chain A, Crystal Structure Of Klebsiella Pneumoniae Hpxo Complexed With Fad Length = 407 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 3e-49
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 3e-37
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 1e-35
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 6e-34
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 9e-34
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 2e-20
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 7e-19
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 2e-18
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 1e-16
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 1e-15
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 4e-15
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 1e-13
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 1e-13
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 2e-13
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 2e-13
3atr_A 453 Conserved archaeal protein; saturating double bond 2e-12
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 2e-12
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 1e-11
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 2e-11
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 1e-10
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 3e-09
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 5e-09
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 5e-09
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 1e-08
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 3e-08
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 3e-08
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 4e-08
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 5e-08
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 5e-08
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 5e-08
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 6e-08
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 6e-08
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 9e-08
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 1e-07
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 1e-07
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 2e-07
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 2e-07
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 2e-07
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 2e-07
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 3e-07
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 3e-07
3dme_A 369 Conserved exported protein; structural genomics, P 4e-07
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 4e-07
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 4e-07
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 4e-07
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 5e-07
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 5e-07
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 5e-07
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 6e-07
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 7e-07
3utf_A 513 UDP-galactopyranose mutase; nucleotide binding, fl 7e-07
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 9e-07
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 1e-06
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 1e-06
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 1e-06
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 2e-06
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 2e-06
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 2e-06
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 3e-06
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 3e-06
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 3e-06
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 4e-06
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 4e-06
4fk1_A304 Putative thioredoxin reductase; structural genomic 5e-06
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 7e-06
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 8e-06
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 1e-05
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 1e-05
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 1e-05
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 1e-05
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 1e-05
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 2e-05
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 2e-05
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 2e-05
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 2e-05
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 2e-05
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 2e-05
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 2e-05
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 3e-05
2bry_A 497 NEDD9 interacting protein with calponin homology a 4e-05
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 5e-05
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 5e-05
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 6e-05
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 6e-05
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 6e-05
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 6e-05
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 8e-05
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 8e-05
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 1e-04
2ywl_A180 Thioredoxin reductase related protein; uncharacter 1e-04
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 1e-04
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 2e-04
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 2e-04
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 2e-04
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 3e-04
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 3e-04
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 3e-04
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 3e-04
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 3e-04
1yqz_A 438 Coenzyme A disulfide reductase; oxidoreductase; HE 4e-04
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 4e-04
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 5e-04
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 5e-04
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 5e-04
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 5e-04
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 6e-04
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 6e-04
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 6e-04
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 6e-04
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 6e-04
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 7e-04
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 8e-04
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 8e-04
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
 Score =  165 bits (419), Expect = 3e-49
 Identities = 56/228 (24%), Positives = 96/228 (42%), Gaps = 7/228 (3%)

Query: 7   DVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKL 66
             ++IGAGI GL+ AVAL++ GI   V E    ++  GAA+++ PN    +  LG+   +
Sbjct: 25  KAIVIGAGIGGLSAAVALKQSGIDCDVYEAVKEIKPVGAAISVWPNGVKCMAHLGMGDIM 84

Query: 67  TSVYAPAKRVFVTNLGTGAT-QELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQF 125
            +   P +R+   +  +G    + S A    R GS    V R  L   + D    D++QF
Sbjct: 85  ETFGGPLRRMAYRDFRSGENMTQFSLAPLIERTGSRPCPVSRAELQREMLDYWGRDSVQF 144

Query: 126 SSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWL--GLSESINSGRS 183
             ++   +      +    +   D +     +LI  DG HS +  W+     +   +G  
Sbjct: 145 GKRVTRCE----EDADGVTVWFTDGSSASGDLLIAADGSHSALRPWVLGFTPQRRYAGYV 200

Query: 184 SVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYSPP 231
           +  GL               FVG G +   +P++    Y+F +   P 
Sbjct: 201 NWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYFFFDVPLPA 248


>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Length = 584 Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Length = 497 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Length = 602 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Length = 643 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Length = 180 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Length = 453 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Length = 540 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Length = 472 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 100.0
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 99.97
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.97
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.97
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.97
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.96
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 99.96
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 99.96
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 99.96
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.96
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.96
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.95
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.95
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 99.95
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 99.95
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.95
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.95
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.95
4hb9_A 412 Similarities with probable monooxygenase; flavin, 99.95
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 99.94
3atr_A 453 Conserved archaeal protein; saturating double bond 99.93
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 99.91
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 99.9
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 99.89
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.89
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.88
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 99.83
2bry_A 497 NEDD9 interacting protein with calponin homology a 99.79
3dme_A369 Conserved exported protein; structural genomics, P 99.77
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 99.76
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.76
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.76
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.75
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 99.74
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 99.74
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.74
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.73
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.73
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 99.71
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.71
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.7
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.7
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.69
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.69
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.69
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 99.68
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.67
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 99.66
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 99.65
2zbw_A 335 Thioredoxin reductase; redox protein, oxidoreducta 99.64
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 99.64
2cul_A232 Glucose-inhibited division protein A-related PROT 99.63
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.63
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.63
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.62
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.62
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.61
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.61
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.61
3ab1_A 360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.61
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 99.6
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.6
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.59
4fk1_A 304 Putative thioredoxin reductase; structural genomic 99.58
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.58
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.56
2gv8_A 447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.55
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.54
1vdc_A 333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.53
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.53
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.52
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.52
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 99.52
3lzw_A 332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.51
3fbs_A 297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.51
3f8d_A 323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.51
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.51
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.5
2q0l_A 311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.49
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.48
1trb_A 320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.46
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.46
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.46
2q7v_A 325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.46
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.46
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 99.46
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.45
1fl2_A 310 Alkyl hydroperoxide reductase subunit F; reactive 99.45
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 99.45
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.44
3cty_A 319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.44
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 99.44
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 99.43
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 99.42
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 99.41
2a87_A 335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.41
3s5w_A 463 L-ornithine 5-monooxygenase; class B flavin depend 99.4
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 99.39
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.39
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 99.39
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.38
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 99.37
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.37
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 99.36
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 99.36
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.34
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 99.33
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 99.32
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 99.32
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.31
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.31
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.3
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.28
3r9u_A 315 Thioredoxin reductase; structural genomics, center 99.27
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.26
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.25
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 99.25
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 99.24
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 99.24
4dna_A 463 Probable glutathione reductase; structural genomic 99.24
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.24
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 99.23
1ojt_A 482 Surface protein; redox-active center, glycolysis, 99.22
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.21
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.21
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 99.2
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 99.17
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 99.16
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 99.16
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.15
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.15
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.14
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.12
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.11
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.11
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.11
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.11
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.1
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 99.1
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.09
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.09
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.07
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 99.06
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.05
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.05
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 99.03
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.03
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 99.03
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 99.02
1xhc_A 367 NADH oxidase /nitrite reductase; southe collaborat 99.01
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 99.01
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.01
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.0
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.99
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.99
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.99
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.97
2v3a_A 384 Rubredoxin reductase; alkane degradation, NADH oxi 98.97
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 98.96
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.94
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.93
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.91
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.9
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.89
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.89
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 98.88
1fec_A 490 Trypanothione reductase; redox-active center, oxid 98.88
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 98.85
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 98.82
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.81
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 98.81
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 98.81
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.79
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.79
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 98.77
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.77
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.75
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.75
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.75
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 98.75
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.74
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.74
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.74
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 98.74
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.73
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.72
1fec_A 490 Trypanothione reductase; redox-active center, oxid 98.72
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 98.72
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 98.71
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.69
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.68
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 98.67
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 98.67
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.67
1ojt_A 482 Surface protein; redox-active center, glycolysis, 98.65
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.64
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.63
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 98.63
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 98.62
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 98.62
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 98.62
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 98.62
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.61
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.61
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.61
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 98.61
1ges_A 450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.61
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 98.59
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 98.58
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.58
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.57
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.57
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.56
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.55
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.55
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.55
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 98.54
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.53
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.52
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.52
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.52
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 98.52
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.52
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.51
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.49
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.49
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.49
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.48
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.48
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.48
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 98.47
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 98.45
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.44
3dk9_A 478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.44
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.44
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 98.43
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.42
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.41
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 98.39
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 98.39
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.38
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 98.37
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 98.37
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 98.36
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.36
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 98.35
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.35
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 98.33
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.32
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.31
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.31
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 98.31
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 98.3
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.3
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.29
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.29
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.29
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 98.28
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.28
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.26
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.24
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.23
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 98.22
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.22
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.21
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 98.19
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 98.16
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.16
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 98.15
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.14
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.13
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 98.08
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.08
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.07
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.07
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 98.07
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.01
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.99
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.98
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.95
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.94
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.83
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.82
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.74
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.68
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.66
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.62
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.55
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.55
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.54
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.53
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.5
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.46
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.46
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.44
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.41
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.38
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.34
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.32
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.31
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 97.3
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 97.29
3tl2_A315 Malate dehydrogenase; center for structural genomi 97.28
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.27
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 97.25
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.22
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.21
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 97.19
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 97.15
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 97.13
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.12
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.1
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.1
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 97.07
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.07
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.04
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 97.03
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.02
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.01
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.99
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 96.96
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.92
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 96.91
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.88
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.86
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 96.85
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.84
4g65_A 461 TRK system potassium uptake protein TRKA; structur 96.84
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 96.83
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 96.83
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 96.83
3qha_A296 Putative oxidoreductase; seattle structural genomi 96.83
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 96.82
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 96.8
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.8
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.79
4fk1_A304 Putative thioredoxin reductase; structural genomic 96.79
4ezb_A317 Uncharacterized conserved protein; structural geno 96.78
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 96.77
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.74
3l6d_A306 Putative oxidoreductase; structural genomics, prot 96.72
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.71
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.71
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 96.7
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 96.7
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 96.66
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 96.66
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 96.65
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.62
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.61
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 96.61
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.61
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 96.59
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.55
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 96.54
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 96.52
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 96.52
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 96.52
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.5
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.5
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 96.48
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.48
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 96.47
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 96.46
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 96.45
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 96.43
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 96.42
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 96.41
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 96.41
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.4
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.39
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 96.38
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 96.37
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.35
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 96.34
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 96.34
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 96.34
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 96.32
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.32
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.32
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.31
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 96.29
1vpd_A299 Tartronate semialdehyde reductase; structural geno 96.28
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.27
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 96.27
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 96.26
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 96.25
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 96.25
4dna_A463 Probable glutathione reductase; structural genomic 96.23
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.23
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 96.23
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.21
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 96.2
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 96.16
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 96.13
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 96.11
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 96.11
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 96.1
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.08
4gx0_A565 TRKA domain protein; membrane protein, ION channel 96.06
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 96.04
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.03
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.03
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.02
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 96.01
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 95.99
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 95.99
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 95.98
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.96
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 95.96
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 95.94
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 95.93
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 95.92
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 95.92
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 95.92
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 95.91
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 95.9
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 95.9
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 95.89
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.86
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 95.85
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 95.85
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 95.83
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 95.82
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 95.82
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 95.81
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 95.81
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.8
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 95.8
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 95.79
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 95.78
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 95.77
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 95.76
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 95.76
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 95.73
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.72
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 95.71
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 95.69
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 95.69
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 95.68
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 95.67
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 95.66
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 95.66
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.66
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 95.65
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 95.65
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 95.65
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.64
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.63
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.63
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.62
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 95.62
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 95.62
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 95.61
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 95.57
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 95.55
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 95.51
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 95.47
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.42
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 95.37
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 95.33
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 95.32
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 95.31
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 95.3
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 95.29
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 95.28
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 95.28
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.27
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 95.18
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.15
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 95.15
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.14
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.11
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 95.09
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 95.09
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 95.08
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 95.07
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.04
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 94.04
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.01
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 95.01
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 95.0
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 94.99
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 94.97
1yb4_A295 Tartronic semialdehyde reductase; structural genom 94.97
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 94.95
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 94.93
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 94.93
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 94.93
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.92
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 94.91
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 94.89
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 94.87
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 94.85
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.85
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 94.85
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 94.84
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 94.83
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 94.82
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
Probab=100.00  E-value=5.6e-33  Score=223.58  Aligned_cols=223  Identities=26%  Similarity=0.459  Sum_probs=178.3

Q ss_pred             ccccEEEECCCHHHHHHHHHHHhCCCcEEEEecCCCCcCcceeeeecccHHHHHHHcCChHHHHhhccCceeeEEEEcCC
Q 044609            4 VEEDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNLGT   83 (232)
Q Consensus         4 ~~~dV~IvG~G~~G~~~A~~L~~~g~~v~viE~~~~~~~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~   83 (232)
                      .++||+||||||+|+++|+.|+++|++|+||||.+.+...++++.+++++.+.|+++|+++.+.....+.....++....
T Consensus        22 ~~~dV~IVGaG~aGl~~A~~La~~G~~V~v~E~~~~~~~~~~~~~l~~~~~~~l~~lg~~~~~~~~~~~~~~~~~~~~~~  101 (407)
T 3rp8_A           22 GHMKAIVIGAGIGGLSAAVALKQSGIDCDVYEAVKEIKPVGAAISVWPNGVKCMAHLGMGDIMETFGGPLRRMAYRDFRS  101 (407)
T ss_dssp             -CCEEEEECCSHHHHHHHHHHHHTTCEEEEEESSSCC----CEEEECHHHHHHHHHTTCHHHHHHHSCCCCEEEEEETTT
T ss_pred             CCCEEEEECCCHHHHHHHHHHHhCCCCEEEEeCCCCCCCcCeeEEECHHHHHHHHHCCCHHHHHhhcCCCcceEEEECCC
Confidence            34899999999999999999999999999999999888788999999999999999999999988888888877777553


Q ss_pred             Cce-eEEeccCCCCCCCCceeeeehHHHHHHHhhhCCCCeEEeCceEEEEEecCCCCCccEEEEeCCCcEEEccEEEecC
Q 044609           84 GAT-QELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQFSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCD  162 (232)
Q Consensus        84 ~~~-~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~i~~~~~v~~i~~~~~~g~~~~~v~~~~g~~~~a~~vV~A~  162 (232)
                      +.. ..+++......+....+.++|..|.+.|.+.++.++++++++|++++.++   .. +.|++.+|+++.||+||+||
T Consensus       102 g~~~~~~~~~~~~~~~~~~~~~i~r~~l~~~L~~~~~~~~i~~~~~v~~i~~~~---~~-v~v~~~~g~~~~a~~vV~Ad  177 (407)
T 3rp8_A          102 GENMTQFSLAPLIERTGSRPCPVSRAELQREMLDYWGRDSVQFGKRVTRCEEDA---DG-VTVWFTDGSSASGDLLIAAD  177 (407)
T ss_dssp             CCEEEEEECHHHHHHHSSCCEEEEHHHHHHHHHHHHCGGGEEESCCEEEEEEET---TE-EEEEETTSCEEEESEEEECC
T ss_pred             CCEeEEecchhhhhhcCCceEEEEHHHHHHHHHHhCCcCEEEECCEEEEEEecC---Cc-EEEEEcCCCEEeeCEEEECC
Confidence            444 44444321111123456899999999999988668999999999999874   44 88999999999999999999


Q ss_pred             CCchhhhhhh-cCC-CCcccceeEEEEeeecCCCCCCccceeEEEecCeEEEEEEcCCCeEEEEEEecCC
Q 044609          163 GVHSMVAQWL-GLS-ESINSGRSSVRGLAVFPHGHGLNQDIRQFVGVGFRAGFIPLNDRDVYWFLNRYSP  230 (232)
Q Consensus       163 G~~S~~r~~~-~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~  230 (232)
                      |.+|.+|+.+ +.. .+.+.++.++.+.+..+........+..|++++.+++++|++++..+|++....+
T Consensus       178 G~~S~vr~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~  247 (407)
T 3rp8_A          178 GSHSALRPWVLGFTPQRRYAGYVNWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYFFFDVPLP  247 (407)
T ss_dssp             CTTCSSHHHHHSSCCCCEEEEEEEEEEEEECCTTTCCTTEEEEEEETTEEEEEEEETTTEEEEEEEEECC
T ss_pred             CcChHHHHHhcCCCCCCcccCcEEEEEEEecccccCCCCceEEEECCCcEEEEEEcCCCeEEEEEEeCCC
Confidence            9999999998 765 5556677788877765554444456677778888899999999998888876543



>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 1e-20
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 3e-18
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 3e-17
d1pn0a1 360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 2e-14
d2bs2a2 336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 1e-10
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 3e-10
d1d5ta1 336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 4e-10
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 4e-10
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 4e-10
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 5e-10
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 3e-09
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 4e-09
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 4e-09
d2v5za1 383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 6e-09
d2gmha1 380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 1e-08
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-08
d2ivda1 347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 1e-08
d2iida1 370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 1e-08
d1jnra2 356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 2e-08
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-08
d1b5qa1 347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 3e-08
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 4e-08
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 4e-08
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 4e-08
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 5e-08
d2dw4a2 449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 5e-08
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 6e-08
d1seza1 373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 1e-07
d2gv8a1 335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 6e-07
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 2e-06
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 2e-06
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 2e-06
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 2e-06
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 3e-06
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 3e-06
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 3e-06
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 3e-06
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 3e-06
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 3e-06
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 3e-06
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 4e-06
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 5e-06
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 6e-06
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 6e-06
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 7e-06
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 7e-06
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 1e-05
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 2e-05
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 5e-05
d3coxa1 370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 9e-05
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 1e-04
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 1e-04
d2f5va1 379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 2e-04
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 2e-04
d1n4wa1 367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 4e-04
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 4e-04
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 5e-04
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 6e-04
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 7e-04
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 0.001
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 0.002
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 0.002
d1ju2a1 351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 0.002
d1kdga1 360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 0.004
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 0.004
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: p-Hydroxybenzoate hydroxylase, PHBH
species: Pseudomonas aeruginosa [TaxId: 287]
 Score = 85.8 bits (211), Expect = 1e-20
 Identities = 33/168 (19%), Positives = 56/168 (33%), Gaps = 4/168 (2%)

Query: 7   DVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLRATGA--ALTLSPNAWLALDALGVSH 64
            V IIGAG +GL     L + GI  ++LE+       G   A  L       L   GV  
Sbjct: 4   QVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDR 63

Query: 65  KLTSVYAPAKRVFVTNLGTGATQELSYAGKSGRIGSGLRSVHRQSLLEALADELPDDTIQ 124
           ++       + V +   G     +L        +    ++   + L+EA        T  
Sbjct: 64  RMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREA--CGATTV 121

Query: 125 FSSKIAAIDSQTLNGSSAAIINLGDSTIIKAKVLIGCDGVHSMVAQWL 172
           + +    +               G+   +    + GCDG H +  Q +
Sbjct: 122 YQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSI 169


>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.92
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.91
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.89
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.83
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.81
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.8
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.79
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.76
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.75
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.68
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.66
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.64
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 99.62
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.62
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.58
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.57
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.56
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.54
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.53
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.53
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.51
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.46
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.43
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.42
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 99.4
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.39
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.38
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.38
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.35
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.33
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.32
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.31
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.31
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.3
d1jnra2 356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.27
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.27
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.25
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.24
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.23
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.23
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.22
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.22
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.22
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.18
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.16
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.15
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.15
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.14
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 99.12
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.11
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.1
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.09
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.08
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.08
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.07
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.07
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.06
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 99.05
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.05
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 99.05
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 99.02
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.01
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.01
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 99.0
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.99
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.92
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.92
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.9
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.89
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.83
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.83
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.83
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.8
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.77
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.77
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.76
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.71
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.71
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.71
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 98.68
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 98.63
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.59
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.58
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.57
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 98.48
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.43
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 98.37
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.34
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.31
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.14
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 98.05
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.98
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.92
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.85
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.81
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.75
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.68
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.64
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.61
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.6
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 97.58
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.56
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.52
d1vg0a1 491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 97.46
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.42
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.36
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.36
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.3
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.28
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.25
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.25
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.17
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.09
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.05
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.05
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.04
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.02
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.94
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.94
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.91
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.9
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.85
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.82
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.79
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.79
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.78
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.76
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.72
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.68
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.68
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.68
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.66
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.65
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.64
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.64
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.58
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.56
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.55
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.55
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.53
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 96.51
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.49
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.44
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.43
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.36
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.18
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 96.15
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.04
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 95.99
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.95
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 95.89
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.82
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 95.82
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.81
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.75
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.66
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.61
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 95.57
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 95.55
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.52
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.4
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 95.3
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.28
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.18
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 95.1
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 95.06
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 94.97
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.83
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 94.79
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.76
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.69
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.69
d2voua2128 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.69
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 94.67
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 94.45
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 94.43
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 94.32
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.21
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 94.16
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 93.99
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 93.99
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.92
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.84
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 93.69
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 93.52
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 93.36
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 93.34
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 93.29
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.26
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 93.12
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 93.05
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 93.04
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 92.99
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 92.97
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 92.97
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.89
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 92.85
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 92.8
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 92.8
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 92.56
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 92.43
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 92.2
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 92.19
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 92.12
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.91
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 91.88
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 91.7
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 91.64
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 91.56
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 91.53
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 91.52
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 91.51
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 91.29
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 91.27
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.21
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 91.06
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 90.97
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 90.92
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.89
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 90.81
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 90.8
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 90.79
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 90.68
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 90.64
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 90.54
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 90.42
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 90.35
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 90.09
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 90.07
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 90.07
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 90.06
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 90.05
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 89.94
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.9
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 89.84
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.63
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 89.53
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 89.52
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 89.46
d3c96a2111 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 89.34
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 89.23
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 89.19
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 88.99
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 88.96
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 88.88
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 88.79
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 88.78
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.69
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 88.69
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 88.46
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 88.43
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 88.42
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 88.27
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 88.09
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 88.06
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 88.03
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 87.85
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.84
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 87.81
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 87.61
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 87.58
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 87.44
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 87.21
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 87.06
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 87.06
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 87.04
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 86.99
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 86.91
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 86.84
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 86.79
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 86.49
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 86.48
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 86.41
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 86.35
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 86.3
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 86.21
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 86.05
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 85.74
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 85.7
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 85.69
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 85.47
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 85.46
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 85.35
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 85.34
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 85.29
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 85.24
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 85.05
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 84.82
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 84.71
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 84.66
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 84.34
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 84.34
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 84.15
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 84.14
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 83.87
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 83.11
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 82.92
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 82.41
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 82.26
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 82.22
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 82.16
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 81.79
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 81.34
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 81.03
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 80.77
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 80.43
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 80.33
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: p-Hydroxybenzoate hydroxylase, PHBH
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.92  E-value=6.2e-25  Score=167.29  Aligned_cols=165  Identities=20%  Similarity=0.291  Sum_probs=122.4

Q ss_pred             ccccEEEECCCHHHHHHHHHHHhCCCcEEEEecCCCCc--CcceeeeecccHHHHHHHcCChHHHHhhccCceeeEEEEc
Q 044609            4 VEEDVVIIGAGIAGLATAVALRRLGIKALVLEKSDGLR--ATGAALTLSPNAWLALDALGVSHKLTSVYAPAKRVFVTNL   81 (232)
Q Consensus         4 ~~~dV~IvG~G~~G~~~A~~L~~~g~~v~viE~~~~~~--~~~~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~   81 (232)
                      |++||+||||||+||++|+.|+++|++|+||||.+...  ..+++..+.++++++|+++|+++.+.....+.....+++.
T Consensus         1 mk~~V~IvGaGp~Gl~~A~~L~~~G~~v~vlE~~~~~~~~~~~~~~~l~~~~~~~l~~lg~~~~l~~~~~~~~~~~~~~~   80 (292)
T d1k0ia1           1 MKTQVAIIGAGPSGLLLGQLLHKAGIDNVILERQTPDYVLGRIRAGVLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFA   80 (292)
T ss_dssp             CBCSEEEECCSHHHHHHHHHHHHHTCCEEEECSSCHHHHHTCCCCCEECHHHHHHHHHTTCCHHHHHHCEEESCEEEEET
T ss_pred             CCCCEEEECcCHHHHHHHHHHHHCCCCEEEEeCCCCCCCCCCceEEEECHHHHHHHHHcCchHHHHhhcccccceEEEec
Confidence            45799999999999999999999999999999987542  3456788999999999999999999888887777776652


Q ss_pred             CCCceeEEeccCCCCCCCCceeeeehHHHHHHHhhhCC--CCeEEeCceEEEEEecCCCCCccEEEEe-CCCc--EEEcc
Q 044609           82 GTGATQELSYAGKSGRIGSGLRSVHRQSLLEALADELP--DDTIQFSSKIAAIDSQTLNGSSAAIINL-GDST--IIKAK  156 (232)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~--~~~i~~~~~v~~i~~~~~~g~~~~~v~~-~~g~--~~~a~  156 (232)
                      .  ............  ....+.+.+..+.+.|.+.+.  +..+.++..+......+  ++. +.|++ .+|+  ++.||
T Consensus        81 ~--~~~~~~~~~~~~--~~~~~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~~~~~~~--~~~-~~v~~~~~g~~~~i~a~  153 (292)
T d1k0ia1          81 G--QRRRIDLKRLSG--GKTVTVYGQTEVTRDLMEAREACGATTVYQAAEVRLHDLQ--GER-PYVTFERDGERLRLDCD  153 (292)
T ss_dssp             T--EEEEECHHHHHT--SCCEEECCHHHHHHHHHHHHHHTTCEEESSCEEEEEECTT--SSS-CEEEEEETTEEEEEECS
T ss_pred             c--cccccccccccc--cccceeecHHHHHHHHHHHHHhCCCcEEEcceeeeeeeec--cCc-eEEEEecCCcEEEEEeC
Confidence            2  122222222222  344567889999999887764  45666666655555443  333 44544 4553  68899


Q ss_pred             EEEecCCCchhhhhhhcCC
Q 044609          157 VLIGCDGVHSMVAQWLGLS  175 (232)
Q Consensus       157 ~vV~A~G~~S~~r~~~~~~  175 (232)
                      +||+|||.+|.+|+.+...
T Consensus       154 ~vVgADG~~S~vR~~i~~~  172 (292)
T d1k0ia1         154 YIAGCDGFHGISRQSIPAE  172 (292)
T ss_dssp             EEEECCCTTCSTGGGSCGG
T ss_pred             EEEECCCCCCcccceeeec
Confidence            9999999999999998654



>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2voua2 d.16.1.2 (A:164-291) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d3c96a2 d.16.1.2 (A:183-293) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure