Citrus Sinensis ID: 044640


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
IDFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSSFENERGRLGGPSIILPGSEIPEWFSNQSSGSLLTLQMPQHCRQTLVGFAFCAVLVSCDSERSGFDVDFRYSFETKTLGRRKRGRRCCFEEGWVGGYQVTKTDHVVLGFSPCGKVGFPDDNHHTTVSFEFLSRVDKVKCYGVCPVYANPNETKPNTFTLNFATQVWKLDDMASASGTSDEEELELSPKRICRDDEVDTP
cccccccccccccccccccccEEccccccEEccccccccccccEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccEEEEEcccccccccccEEEEEEEEccccccccccEEEEEEEEEcccccccccccEEEccccccccccccccEEEEEEEcccccccccccEEEEEEEEEEccccEEEEEEEEEEEccccccccccccccccccccccccccccccccHHHHHcccccEEEEccccccc
ccccccHHHcccccccHHHHEEEcccccEEEccccHHcHHcccEEEccccccHccccccHHHHHHHcEEcccccccHHcccHHHHHHHHcccccccccccccccccHHcHHHHHHHHHHcccccccccHHEcccccccEEEEEcccccccccccEEEEEEEEccccccccccEEEEEEEEEEcccccEEEEccccccccccccccccccEEEEEEcccccccccccccccEEEEEEEEccccEEEEEcEEEEEcccccccccccccccccccccccccccccccccccEEEcccccccccccccc
idfsscvnltefpqisgniKTLYLFETAIeevpssiecltnltlltisrctrLKRVSTSICKLKSLIWLSvhgclnlesfpESLEKMEHLNQINLGrakiteqrpssfenergrlggpsiilpgseipewfsnqssgslltlqmpqhCRQTLVGFAFCAVLVScdsersgfdvdfrysfetktlgrrkrgrrccfeegwvggyqvtktdhvvlgfspcgkvgfpddnhhttvSFEFLSRvdkvkcygvcpvyanpnetkpntftLNFATQVWklddmasasgtsdeeelelspkricrddevdtp
idfsscvnltefpqisgNIKTLYLFETAIEEVPSSIECLtnltlltisrctrlKRVSTSICKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLgrakiteqrpssfenergrlgGPSIILPGSEIPEWFSNQSSGSLLTLQMPQHCRQTLVGFAFCAVLVSCDSersgfdvdfrysfetktlgrrkrgrrccfeegwvggyqvtKTDHVVLGFSPCGKVGFPDDNHHTTVSFEFLSRVDKVKCYGVCPVyanpnetkpntFTLNFATQVWKLDDMASAsgtsdeeelelspkricrddevdtp
IDFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSSFENERGRLGGPSIILPGSEIPEWFSNQSSGSLLTLQMPQHCRQTLVGFAFCAVLVSCDSERSGFDVDFRYSFEtktlgrrkrgrrccFEEGWVGGYQVTKTDHVVLGFSPCGKVGFPDDNHHTTVSFEFLSRVDKVKCYGVCPVYANPNETKPNTFTLNFATQVWKLDDMASASGTSDEEELELSPKRICRDDEVDTP
*****CVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNLESFP**************************************IILP**EIPEWFSN***GSLLTLQMPQHCRQTLVGFAFCAVLVSCDSERSGFDVDFRYSFETKTLGRRKRGRRCCFEEGWVGGYQVTKTDHVVLGFSPCGKVGFPDDNHHTTVSFEFLSRVDKVKCYGVCPVYANPNETKPNTFTLNFATQVWKLD******************************
IDFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSSFENERGRLGGPSIILPGSEIPEWFSNQSSGSLLTLQMPQHCRQTLVGFAFCAVLVSCDSERSGFDVDFRYSFETKTLGRRKRGRRCCFEEGWVGGYQVTKTDHVVLGFSPCGKVGFPDDNHHTTVSFEFLSRVDKVKCYGVCPVYA******************************************ICRDD**D**
IDFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSSFENERGRLGGPSIILPGSEIPEWFSNQSSGSLLTLQMPQHCRQTLVGFAFCAVLVSCDSERSGFDVDFRYSFETKTLGRRKRGRRCCFEEGWVGGYQVTKTDHVVLGFSPCGKVGFPDDNHHTTVSFEFLSRVDKVKCYGVCPVYANPNETKPNTFTLNFATQVWKLDDM***************PKRICRDDEVDTP
*DFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSSFENERGRLGGPSIILPGSEIPEWFSNQSSGSLLTLQMPQHCRQTLVGFAFCAVLVSCDSERSGFDVDFRYSFETKTLGRRKRGRRCCFEEGWVGGYQVTKTDHVVLGFSPCGKVGFPDDNHHTTVSFEFLSRVDKVKCYGVCPVYANPNETKPNTFTLNFATQVWKLD******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IDFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSSFENERGRLGGPSIILPGSEIPEWFSNQSSGSLLTLQMPQHCRQTLVGFAFCAVLVSCDSERSGFDVDFRYSFETKTLGRRKRGRRCCFEEGWVGGYQVTKTDHVVLGFSPCGKVGFPDDNHHTTVSFEFLSRVDKVKCYGVCPVYANPNETKPNTFTLNFATQVWKLDDMASASGTSDEEELELSPKRICRDDEVDTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query305 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti yes no 0.350 0.056 0.435 4e-15
O23530 1301 Protein SUPPRESSOR OF npr no no 0.262 0.061 0.469 2e-09
Q40392 1144 TMV resistance protein N N/A no 0.295 0.078 0.372 7e-08
O825001095 Putative disease resistan no no 0.573 0.159 0.25 2e-06
P0CB161201 Putative disease resistan no no 0.298 0.075 0.356 9e-06
Q9LVT1623 Putative disease resistan no no 0.311 0.152 0.303 1e-05
Q7XBQ9970 Disease resistance protei N/A no 0.268 0.084 0.352 0.0008
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 66/108 (61%), Gaps = 1/108 (0%)

Query: 1    IDFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSI 60
            ++ S C  L  FP+IS N+K LY+  T I+E+PSSI+ L  L  L +     LK + TSI
Sbjct: 1333 LNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSI 1392

Query: 61   CKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSSF 108
             KLK L  L++ GC++LE FP+S  +M+ L  ++L R  I E  PSS 
Sbjct: 1393 YKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKE-LPSSI 1439




Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
224143578 722 predicted protein [Populus trichocarpa] 0.504 0.213 0.383 2e-21
224127754 1125 tir-nbs-lrr resistance protein [Populus 0.354 0.096 0.532 1e-20
147845221 901 hypothetical protein VITISV_003348 [Viti 0.754 0.255 0.339 2e-20
224109866 603 predicted protein [Populus trichocarpa] 0.567 0.286 0.32 2e-19
359495276 1542 PREDICTED: TMV resistance protein N-like 0.367 0.072 0.517 6e-19
147771827 587 hypothetical protein VITISV_028498 [Viti 0.367 0.190 0.517 6e-19
147787197 754 hypothetical protein VITISV_042806 [Viti 0.367 0.148 0.517 8e-19
147821215 1441 hypothetical protein VITISV_004613 [Viti 0.367 0.077 0.517 2e-18
359495285 1557 PREDICTED: TMV resistance protein N-like 0.367 0.071 0.508 7e-18
359487015 1610 PREDICTED: TMV resistance protein N-like 0.367 0.069 0.508 1e-17
>gi|224143578|ref|XP_002336058.1| predicted protein [Populus trichocarpa] gi|222869691|gb|EEF06822.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  109 bits (272), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 100/172 (58%), Gaps = 18/172 (10%)

Query: 6   CVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKS 65
           C  +T+FP+ISG++KTLYL  TAI+EVPSSI+ LT L +L +S C++L+        +KS
Sbjct: 413 CSKITKFPEISGDVKTLYLSGTAIKEVPSSIQFLTRLCVLDMSGCSKLESFPEIAVPMKS 472

Query: 66  LIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSSFENERGRLGGP------- 118
           L+ L++     ++  P S ++M  L  + L    I E+ P S ++ +  +          
Sbjct: 473 LVDLNLSKT-GIKEIPSSFKQMISLRSLGLDGTPI-EELPLSIKDMKPLIAAMHLKIQSG 530

Query: 119 --------SIILPGSEIPEWFSNQSSGSLLTLQMPQHCRQTLVGFAFCAVLV 162
                    ++LPGSEIPEWFS++  GS LT+Q+P +C Q L G AFC V +
Sbjct: 531 DKIPYDRIQMVLPGSEIPEWFSDKGIGSSLTIQLPTNCHQ-LKGIAFCLVFL 581




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224127754|ref|XP_002329169.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870950|gb|EEF08081.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147845221|emb|CAN81612.1| hypothetical protein VITISV_003348 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224109866|ref|XP_002333191.1| predicted protein [Populus trichocarpa] gi|222834646|gb|EEE73109.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495276|ref|XP_002276447.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147771827|emb|CAN62507.1| hypothetical protein VITISV_028498 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147787197|emb|CAN64645.1| hypothetical protein VITISV_042806 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147821215|emb|CAN66453.1| hypothetical protein VITISV_004613 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495285|ref|XP_002276740.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487015|ref|XP_003633506.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.347 0.055 0.439 1.4e-14
TAIR|locus:21530721229 AT5G51630 [Arabidopsis thalian 0.272 0.067 0.457 4.5e-14
TAIR|locus:21553221170 LAZ5 "LAZARUS 5" [Arabidopsis 0.318 0.082 0.381 1.1e-13
TAIR|locus:2170333 1197 CSA1 "constitutive shade-avoid 0.324 0.082 0.363 1.4e-13
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.301 0.072 0.391 8.8e-13
TAIR|locus:2122985 1167 AT4G19530 [Arabidopsis thalian 0.324 0.084 0.373 3.3e-12
TAIR|locus:21302701449 RPP5 "RECOGNITION OF PERONOSPO 0.242 0.051 0.459 5.1e-12
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.344 0.085 0.333 3.1e-11
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.324 0.081 0.414 3.7e-11
TAIR|locus:21704081139 AT5G46270 [Arabidopsis thalian 0.514 0.137 0.313 4.5e-11
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 207 (77.9 bits), Expect = 1.4e-14, Sum P(2) = 1.4e-14
 Identities = 47/107 (43%), Positives = 66/107 (61%)

Query:     1 IDFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSI 60
             ++ S C  L  FP+IS N+K LY+  T I+E+PSSI+ L  L  L +     LK + TSI
Sbjct:  1333 LNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTSI 1392

Query:    61 CKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSS 107
              KLK L  L++ GC++LE FP+S  +M+ L  ++L R  I E  PSS
Sbjct:  1393 YKLKHLETLNLSGCISLERFPDSSRRMKCLRFLDLSRTDIKEL-PSS 1438


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0006952 "defense response" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009556 "microsporogenesis" evidence=RCA
GO:0052543 "callose deposition in cell wall" evidence=RCA
TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122985 AT4G19530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130270 RPP5 "RECOGNITION OF PERONOSPORA PARASITICA 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170408 AT5G46270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_scaffold_1066000002
hypothetical protein (722 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-18
PLN03210 1153 PLN03210, PLN03210, Resistant to P 9e-08
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-06
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 85.3 bits (211), Expect = 2e-18
 Identities = 57/190 (30%), Positives = 83/190 (43%), Gaps = 13/190 (6%)

Query: 1    IDFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSI 60
            +D S C  L  FP IS NI  L L  T IEEVP  IE  +NL+ L ++ C  L+RVS +I
Sbjct: 830  LDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNI 889

Query: 61   CKLKSLIWLSVHGCLNLESFPESLEKMEHLNQINLGRAKITEQRPSSFEN---------E 111
             KLK L  +    C  L     +    E     +   +K+      +F N          
Sbjct: 890  SKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEALL 949

Query: 112  RGRLGGPSIILPGSEIPEWFSNQSSGSLLT---LQMPQHCRQTLVGFAFCAVLVSCDSER 168
            + +     +IL G E+P +F+++++G+ LT   L     C Q    F  CAV+ S     
Sbjct: 950  QQQSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPC-QPFFRFRACAVVDSESFFI 1008

Query: 169  SGFDVDFRYS 178
                 D +  
Sbjct: 1009 ISVSFDIQVC 1018


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 305
PLN032101153 Resistant to P. syringae 6; Provisional 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.24
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.22
KOG0617264 consensus Ras suppressor protein (contains leucine 99.14
PLN032101153 Resistant to P. syringae 6; Provisional 98.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.93
KOG0617264 consensus Ras suppressor protein (contains leucine 98.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.79
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.76
PLN03150623 hypothetical protein; Provisional 98.74
PLN03150623 hypothetical protein; Provisional 98.61
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.56
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.48
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.43
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.41
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.4
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.37
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.35
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.34
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.34
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.29
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.26
PRK15386426 type III secretion protein GogB; Provisional 98.22
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.18
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.16
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.09
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.02
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.99
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.93
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.88
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
PRK15386426 type III secretion protein GogB; Provisional 97.87
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.61
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.5
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.44
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.98
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.98
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.47
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.44
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 96.22
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.18
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 96.07
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.05
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.74
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.24
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.68
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.51
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 92.68
KOG2982418 consensus Uncharacterized conserved protein [Funct 92.02
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 91.88
KOG2123388 consensus Uncharacterized conserved protein [Funct 91.16
smart0037026 LRR Leucine-rich repeats, outliers. 90.26
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 88.2
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 86.67
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 86.49
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.21
smart0037026 LRR Leucine-rich repeats, outliers. 86.21
KOG2123388 consensus Uncharacterized conserved protein [Funct 84.73
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 83.4
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.06
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 82.88
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.43
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.93  E-value=8.8e-25  Score=230.64  Aligned_cols=243  Identities=27%  Similarity=0.335  Sum_probs=165.7

Q ss_pred             CeecCCCCCcccCCCcCCccEEEEecCCCcccCccccCCCCCCEEecccccccccccccccccccccEEEEEecCCCccc
Q 044640            1 IDFSSCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNLESF   80 (305)
Q Consensus         1 L~Ls~c~~l~~~P~~~~~L~~L~L~~n~i~~lP~si~~L~~L~~L~L~~c~~l~~lP~~i~~l~~L~~L~l~~c~~l~~l   80 (305)
                      |+|++|++++.+|....+|+.|+|++|+|+++|.++..+++|+.|+|++|+++..+|..+..+++|+.|++++|..+..+
T Consensus       830 L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~  909 (1153)
T PLN03210        830 LDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEA  909 (1153)
T ss_pred             EECCCCCccccccccccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccc
Confidence            46788888888888888899999999999999999999999999999999999999998889999999999999888765


Q ss_pred             CccccCCCCCcEeeecCCCcCeeCCC----Ccccccc---------CCCCCccccCCCCCccccccCCCCcEEE-EEcCC
Q 044640           81 PESLEKMEHLNQINLGRAKITEQRPS----SFENERG---------RLGGPSIILPGSEIPEWFSNQSSGSLLT-LQMPQ  146 (305)
Q Consensus        81 P~~~~~l~~L~~L~L~~n~i~~l~P~----si~~l~~---------l~~l~~~~lpG~~iP~~f~~~~~~~~l~-i~lp~  146 (305)
                      +-.  ..+. ....+..|....+ |.    .+.+.-+         ......+.+||.++|.||.|++.|++++ |.+|+
T Consensus       910 ~l~--~~~~-~~~~~~~n~~~~~-p~~~~l~f~nC~~L~~~a~l~~~~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~  985 (1153)
T PLN03210        910 SWN--GSPS-EVAMATDNIHSKL-PSTVCINFINCFNLDQEALLQQQSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLH  985 (1153)
T ss_pred             cCC--CCch-hhhhhcccccccC-CchhccccccccCCCchhhhcccccceEEECCCccCchhccCCcccceeeeeccCC
Confidence            421  1110 1111112211111 21    1111000         0123456899999999999999999998 99988


Q ss_pred             C-CCCCccceeEEEEeecCCCC--CCCceeEEEEEEeeCCCCccceeEEEEecCceeCCCCCCCCCeEEEeEecCCCCCC
Q 044640          147 H-CRQTLVGFAFCAVLVSCDSE--RSGFDVDFRYSFETKTLGRRKRGRRCCFEEGWVGGYQVTKTDHVVLGFSPCGKVGF  223 (305)
Q Consensus       147 ~-~~~~~~gf~~c~v~~~~~~~--~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sdHl~l~y~~~~~~~~  223 (305)
                      + ..+.+.||++|+|+++....  ...+.+.|.|+|+++.|.   .+........|..   ...++|++++- .+.  ..
T Consensus       986 ~~~~~~~~~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~---~~~~~~~~~~~~~---~~~~~~l~~~~-~~~--~~ 1056 (1153)
T PLN03210        986 ISPCQPFFRFRACAVVDSESFFIISVSFDIQVCCRFIDRLGN---HFDSPYQPHVFSV---TKKGSHLVIFD-CCF--PL 1056 (1153)
T ss_pred             cccCCCccceEEEEEEecCccccCCCceeEEEEEEEECCCCC---ccccCCCceeEee---eccccceEEec-ccc--cc
Confidence            7 66789999999999887654  347789999999988776   2211110001111   12355665532 221  11


Q ss_pred             CC------CCCccEEEEEEEeeCC-----cEeeeeeEEEEeCCCC
Q 044640          224 PD------DNHHTTVSFEFLSRVD-----KVKCYGVCPVYANPNE  257 (305)
Q Consensus       224 ~~------~~~~~~~sfef~~~~~-----vk~C~Gv~liy~~d~~  257 (305)
                      ..      +..+++|+++|.....     ||+| |||++|+++..
T Consensus      1057 ~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~c-g~~~~~~~~~~ 1100 (1153)
T PLN03210       1057 NEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGC-GIRLSEDDSSL 1100 (1153)
T ss_pred             cccccchhccCCceeeEEEEEecCCCCeEEEee-eEEEeccCCCc
Confidence            11      1246777777765442     8999 99999977544



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 76.5 bits (189), Expect = 4e-16
 Identities = 28/118 (23%), Positives = 48/118 (40%), Gaps = 14/118 (11%)

Query: 5   SCVNLTEFPQISGNIK---TLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSIC 61
             V L +FP  +  +     + +    + E+P +++    L  LT++R   L+ +  SI 
Sbjct: 89  RSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARN-PLRALPASIA 147

Query: 62  KLKSLIWLSVHGCLNLESFPESL---------EKMEHLNQINLGRAKITEQRPSSFEN 110
            L  L  LS+  C  L   PE L         + + +L  + L    I    P+S  N
Sbjct: 148 SLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSL-PASIAN 204


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.56
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.36
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.36
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.36
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.35
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.34
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.33
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.3
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.29
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.28
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.28
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.28
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.28
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.25
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.24
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.23
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.23
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.23
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.22
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.22
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.21
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.2
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.2
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.2
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.19
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.11
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.1
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.03
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.03
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.03
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.02
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.02
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.02
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.01
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.01
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.0
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.99
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.99
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.96
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.95
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.95
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.94
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.94
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.93
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.92
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.91
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.9
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.9
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 98.89
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.86
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.86
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.83
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.82
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.8
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.79
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.79
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.76
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.74
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.66
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.62
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.43
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.37
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.32
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.93
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.82
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.8
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.8
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.62
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.58
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.58
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.55
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.51
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.5
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.43
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.09
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.01
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.64
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.44
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 94.9
4fdw_A401 Leucine rich hypothetical protein; putative cell s 94.01
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 93.36
4gt6_A394 Cell surface protein; leucine rich repeats, putati 86.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 83.45
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 80.63
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.56  E-value=1.9e-14  Score=131.32  Aligned_cols=132  Identities=22%  Similarity=0.347  Sum_probs=89.6

Q ss_pred             CeecCCCCCcccCCCcC---CccEEEEecCCCcccCccccCCCCCCEEecccccccccccccccccccccEEEEEecCCC
Q 044640            1 IDFSSCVNLTEFPQISG---NIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNL   77 (305)
Q Consensus         1 L~Ls~c~~l~~~P~~~~---~L~~L~L~~n~i~~lP~si~~L~~L~~L~L~~c~~l~~lP~~i~~l~~L~~L~l~~c~~l   77 (305)
                      |+|++| .++.+|..+.   +|++|+|++|.|+.+|..++.+++|+.|+|++| .+..+|..+..+++|++|++++|+.+
T Consensus        86 L~L~~n-~l~~lp~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n-~l~~lp~~l~~l~~L~~L~L~~n~~~  163 (328)
T 4fcg_A           86 LELRSV-PLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARN-PLRALPASIASLNRLRELSIRACPEL  163 (328)
T ss_dssp             EEEESS-CCSSCCSCGGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESC-CCCCCCGGGGGCTTCCEEEEEEETTC
T ss_pred             EEccCC-CchhcChhhhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCCC-ccccCcHHHhcCcCCCEEECCCCCCc
Confidence            467776 6667776554   677788888877777777777888888888774 45577777777778888888777777


Q ss_pred             cccCccccC---------CCCCcEeeecCCCcCeeCCCCccccccCC--CCCccccCCCCCccccccCCCC
Q 044640           78 ESFPESLEK---------MEHLNQINLGRAKITEQRPSSFENERGRL--GGPSIILPGSEIPEWFSNQSSG  137 (305)
Q Consensus        78 ~~lP~~~~~---------l~~L~~L~L~~n~i~~l~P~si~~l~~l~--~l~~~~lpG~~iP~~f~~~~~~  137 (305)
                      +.+|..++.         +++|++|++++|.++.+ |..+..+.+|.  .+..+.+.  .+|..|......
T Consensus       164 ~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~l-p~~l~~l~~L~~L~L~~N~l~--~l~~~l~~l~~L  231 (328)
T 4fcg_A          164 TELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSL-PASIANLQNLKSLKIRNSPLS--ALGPAIHHLPKL  231 (328)
T ss_dssp             CCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCC-CGGGGGCTTCCEEEEESSCCC--CCCGGGGGCTTC
T ss_pred             cccChhHhhccchhhhccCCCCCEEECcCCCcCcc-hHhhcCCCCCCEEEccCCCCC--cCchhhccCCCC
Confidence            777766554         77777777777777766 76666665554  33333333  356555544333



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 305
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 42.1 bits (97), Expect = 5e-05
 Identities = 19/90 (21%), Positives = 32/90 (35%), Gaps = 9/90 (10%)

Query: 5   SCVNLTEFPQISGNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLK 64
           S   +     +  +++ L +    + E+P+    L  L          L  V      LK
Sbjct: 272 SSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIA----SFNHLAEVPELPQNLK 327

Query: 65  SLIWLSVHGCLNLESFPESLEKMEHLNQIN 94
               L V     L  FP+  E +E L ++N
Sbjct: 328 Q---LHVEYN-PLREFPDIPESVEDL-RMN 352


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.28
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.28
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.18
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.14
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.14
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.1
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.07
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.91
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.85
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.78
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.69
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.62
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.49
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.49
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.38
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.27
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.12
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.11
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.51
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.45
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.78
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.74
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 95.61
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.04
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.5
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 89.12
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 87.86
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.32  E-value=1.8e-12  Score=99.79  Aligned_cols=99  Identities=19%  Similarity=0.263  Sum_probs=82.7

Q ss_pred             CeecCCCCCcccCCCc--CCccEEEEecCCCcccCccccCCCCCCEEecccccccccccccccccccccEEEEEecCCCc
Q 044640            1 IDFSSCVNLTEFPQIS--GNIKTLYLFETAIEEVPSSIECLTNLTLLTISRCTRLKRVSTSICKLKSLIWLSVHGCLNLE   78 (305)
Q Consensus         1 L~Ls~c~~l~~~P~~~--~~L~~L~L~~n~i~~lP~si~~L~~L~~L~L~~c~~l~~lP~~i~~l~~L~~L~l~~c~~l~   78 (305)
                      |+|++| .++.+|..-  .+|++|++++|.|+++|+.++.+++|+.|++++ +.+..+|. +..+++|+.|++++| .+.
T Consensus         3 L~Ls~n-~l~~l~~l~~l~~L~~L~ls~N~l~~lp~~~~~l~~L~~L~l~~-N~i~~l~~-~~~l~~L~~L~l~~N-~i~   78 (124)
T d1dcea3           3 LHLAHK-DLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASD-NALENVDG-VANLPRLQELLLCNN-RLQ   78 (124)
T ss_dssp             EECTTS-CCSSCCCGGGGTTCCEEECCSSCCCCCCGGGGGCTTCCEEECCS-SCCCCCGG-GTTCSSCCEEECCSS-CCC
T ss_pred             EEcCCC-CCCCCcccccCCCCCEEECCCCccCcchhhhhhhhccccccccc-ccccccCc-cccccccCeEECCCC-ccC
Confidence            688898 788887532  378999999999999999999999999999999 56778875 889999999999985 566


Q ss_pred             ccC--ccccCCCCCcEeeecCCCcCee
Q 044640           79 SFP--ESLEKMEHLNQINLGRAKITEQ  103 (305)
Q Consensus        79 ~lP--~~~~~l~~L~~L~L~~n~i~~l  103 (305)
                      .+|  ..++.+++|+.|++++|.+...
T Consensus        79 ~~~~~~~l~~~~~L~~L~l~~N~i~~~  105 (124)
T d1dcea3          79 QSAAIQPLVSCPRLVLLNLQGNSLCQE  105 (124)
T ss_dssp             SSSTTGGGGGCTTCCEEECTTSGGGGS
T ss_pred             CCCCchhhcCCCCCCEEECCCCcCCcC
Confidence            665  3577889999999999998765



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure