Citrus Sinensis ID: 044724


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780--
MVIMFVLLLIIFEGGWSEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESYNNNSSLDKPFEISFDFRNTEKKVEKKSHEIFEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLPICRSPATMPEASTNNEGDDNLIDTGNFFITFTISYIILIFGIIIVLYVNPYWRRRWFYLVEMWIASCYYFVVDNLIPKRFCHSN
cHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccEEEccccEEEEEEccccccccccccEEEccccEEEEEcccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccccccccccEEEccccEEEEcccccccccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHccccccccEEEccccccccccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEcccEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEccccccccccccHHHHHccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccEEEEEEEEEEEcccccccc
cHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEcccccEEEEEEccccccccccccccccHHHcccccccEEEcccccccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHHcccccccEEEEcccccccccccHHHcccccccEEEccccccccccccccccHHHHHHHHHcccccccccccccccccEEEEccccccccccHHHHcccccccEEEEccccccccccHHHHHcccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHHHHcHcccEEEcccccccccccHHccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEcccccccccccccccccHHHHHHHHHHccccccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccccccccccccEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MVIMFVLLLIIFeggwsegcldHERFALLQLKhffndpvnylhdwvdakgatdccqwANVECNNTTGRVIQLYLSNTRSMELEEWYLNAylftpfqqleslSLSANNIagcvenegassrevtrlnnlkmfdlsgnsfnnSILSSLTRLSSVRSLKLSYNRlegsidvkefdsfnnlevldmkrneidnlvvpqgfphfkslehlDMSYAHIALNTNFLQIIGesmpslkhlslsnfspsndswtlNQVLWLSnnhfripispdplfnhsrlKIFHAYNNEIHAEiteshsltaptfqlkslslssgygdgpfrlpihshkslrlldvsnnnfqgcipveigdilpslscfnismnaldgsipssfeghmfsknfnlTNVRWLLLEEnhfvgeipqsLSKCFLLkglylnnnnlsgkipqwlgnltglqhiimpknhlegpipvefcqldwlqildisdnnisgslpscFHLLSIEQINGLSGLSHLILAHnnlegevpvqlcglnqlqlldlsdnnlhglippffyntalhesynnnssldkpfeisfdfrNTEKKVEKKSHEIFEfttksnaytyQGRVLSLLSGIDLscnklighipppignltRIQILNLshnnltgtipstfSKLEAYRNLDLSYnklngkiprqLVELNAFVVFSFACnnlsgkipeLTAQFATfnessykgnpflcglplpicrspatmpeastnnegddnlidtgnFFITFTISYIILIFGIIIVLYVNPYWRRRWFYLVEMWIASCYYFVvdnlipkrfchsn
MVIMFVLLLIIFEGGWSEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNrlegsidvkefdsfnNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESYNNNSSLDKPFEISFDFRNTEKKVEKKSHEifefttksnaytyQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLPICRSPATMPEASTNNEGDDNLIDTGNFFITFTISYIILIFGIIIVLYVNPYWRRRWFYLVEMWIASCYYFVVDNLIPKRFCHSN
MVIMFVLLLIIFEGGWSEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNsilssltrlssvrslklsYNRLEGSIDVKEFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFllkglylnnnnlSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVqlcglnqlqlldlsdnnlHGLIPPFFYNTALHESYNNNSSLDKPFEISFDFRNTEKKVEKKSHEIFEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLPICRSPATMPEASTNNEGDDNLIDTGNFFITFTisyiilifgiiiVLYVNPYWRRRWFYLVEMWIASCYYFVVDNLIPKRFCHSN
*VIMFVLLLIIFEGGWSEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLESLSLSANNIAGCVEN*******VTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESYNN*****KPFEISFDFR**********HEIFEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLPICR****************NLIDTGNFFITFTISYIILIFGIIIVLYVNPYWRRRWFYLVEMWIASCYYFVVDNLIPKRFC***
MVIMFVLLLIIFEGGWSEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESY********PFEISFDFRNTEKKVEKKSHEIFEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCG****************************GNFFITFTISYIILIFGIIIVLYVNPYWRRRWFYLVEMWIASCYYFVVDNLIPKRFCH**
MVIMFVLLLIIFEGGWSEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESYNNNSSLDKPFEISFDFRNTEKKVEKKSHEIFEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLPICRSPATMPEASTNNEGDDNLIDTGNFFITFTISYIILIFGIIIVLYVNPYWRRRWFYLVEMWIASCYYFVVDNLIPKRFCHSN
MVIMFVLLLIIFEGGWSEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESYNNNSSLDKPFEISFDFRNTEKKVEKKSHEIFEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLPICRSPATMPEASTNNEGDDNLIDTGNFFITFTISYIILIFGIIIVLYVNPYWRRRWFYLVEMWIASCYYFVVDNLIPKRFC***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooo
SSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIMFVLLLIIFEGGWSEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESYNNNSSLDKPFEISFDFRNTEKKVEKKSHEIFEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLPICRSPATMPEASTNNEGDDNLIDTGNFFITFTISYIILIFGIIIVLYVNPYWRRRWFYLVEMWIASCYYFVVDNLIPKRFCHSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query782 2.2.26 [Sep-21-2011]
Q9ZPS9 1143 Serine/threonine-protein no no 0.704 0.482 0.296 4e-54
Q8L899 1207 Systemin receptor SR160 O N/A no 0.913 0.591 0.295 7e-53
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.913 0.591 0.293 7e-52
Q9C9H7847 Receptor-like protein 12 no no 0.838 0.774 0.278 1e-47
Q9LJF3 1164 Receptor-like protein kin no no 0.884 0.594 0.280 6e-47
C0LGS2 1136 Probable LRR receptor-lik no no 0.794 0.546 0.295 2e-46
C0LGQ5 1249 LRR receptor-like serine/ no no 0.833 0.522 0.279 2e-45
Q9ZWC8 1166 Serine/threonine-protein no no 0.896 0.601 0.269 8e-45
Q9FL28 1173 LRR receptor-like serine/ no no 0.708 0.472 0.294 9e-45
Q8VZG8 1045 Probable LRR receptor-lik no no 0.846 0.633 0.268 1e-44
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function desciption
 Score =  213 bits (543), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 193/650 (29%), Positives = 285/650 (43%), Gaps = 99/650 (15%)

Query: 91  LFTPFQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLS 150
           LF   ++L++L LS NNI G +      +  ++   ++   D SGNS +  I  SL   +
Sbjct: 172 LFLSSKKLQTLDLSYNNITGPIS---GLTIPLSSCVSMTYLDFSGNSISGYISDSLINCT 228

Query: 151 SVRSLKLSYNRLEGSIDVKEFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYA 210
           +++SL LSYN  +G I  K F     L+ LD+  N +   + P+     +SL++L +SY 
Sbjct: 229 NLKSLNLSYNNFDGQIP-KSFGELKLLQSLDLSHNRLTGWIPPEIGDTCRSLQNLRLSY- 286

Query: 211 HIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHS 270
                 NF  +I ES+ S              SW   Q L LSNN+   P     L +  
Sbjct: 287 -----NNFTGVIPESLSSC-------------SWL--QSLDLSNNNISGPFPNTILRSFG 326

Query: 271 RLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSN 330
            L+I    NN I                            G F   I + KSLR+ D S+
Sbjct: 327 SLQILLLSNNLI---------------------------SGDFPTSISACKSLRIADFSS 359

Query: 331 NNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHF 390
           N F G IP ++     SL    +  N + G IP +            + +R + L  N+ 
Sbjct: 360 NRFSGVIPPDLCPGAASLEELRLPDNLVTGEIPPAIS--------QCSELRTIDLSLNYL 411

Query: 391 VGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLD 450
            G IP  +     L+      NN++G+IP  +G L  L+ +I+  N L G IP EF    
Sbjct: 412 NGTIPPEIGNLQKLEQFIAWYNNIAGEIPPEIGKLQNLKDLILNNNQLTGEIPPEFFNCS 471

Query: 451 WLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGLNQLQL 510
            ++ +  + N ++G +P  F +LS         L+ L L +NN  GE+P +L     L  
Sbjct: 472 NIEWVSFTSNRLTGEVPKDFGILS--------RLAVLQLGNNNFTGEIPPELGKCTTLVW 523

Query: 511 LDLSDNNLHGLIPPFFY--------------NTALHESYNNNSSLDKPFEISFDFRNTEK 556
           LDL+ N+L G IPP                 NT        NS       + F     E+
Sbjct: 524 LDLNTNHLTGEIPPRLGRQPGSKALSGLLSGNTMAFVRNVGNSCKGVGGLVEFSGIRPER 583

Query: 557 KVEKKSHEIFEFTTKSNAYTYQGRVLSLLSG------IDLSCNKLIGHIPPPIGNLTRIQ 610
            ++  S +  +FT       Y G +LSL +       +DLS N+L G IP  IG +  +Q
Sbjct: 584 LLQIPSLKSCDFT-----RMYSGPILSLFTRYQTIEYLDLSYNQLRGKIPDEIGEMIALQ 638

Query: 611 ILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGK 670
           +L LSHN L+G IP T  +L+     D S N+L G+IP     L+  V    + N L+G 
Sbjct: 639 VLELSHNQLSGEIPFTIGQLKNLGVFDASDNRLQGQIPESFSNLSFLVQIDLSNNELTGP 698

Query: 671 IPELTAQFATFNESSYKGNPFLCGLPLPICRS-----PATMPEASTNNEG 715
           IP+   Q +T   + Y  NP LCG+PLP C++     PA   E      G
Sbjct: 699 IPQ-RGQLSTLPATQYANNPGLCGVPLPECKNGNNQLPAGTEEGKRAKHG 747




Receptor with a serine/threonine-protein kinase activity, which may transduce extracellular spatial and temporal signals into downstream cell differentiation responses in provascular and procambial cells. In contrast to BRI1, BRL1 and BRL3, it does not bind brassinolide.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query782
255581263 912 serine-threonine protein kinase, plant-t 0.942 0.808 0.393 1e-146
224142717876 predicted protein [Populus trichocarpa] 0.934 0.834 0.382 1e-136
224112245876 predicted protein [Populus trichocarpa] 0.932 0.832 0.366 1e-130
224120284 929 predicted protein [Populus trichocarpa] 0.901 0.758 0.337 1e-120
224073436 1014 predicted protein [Populus trichocarpa] 0.971 0.749 0.332 1e-119
224134891 953 predicted protein [Populus trichocarpa] 0.964 0.791 0.335 1e-117
224142721 926 predicted protein [Populus trichocarpa] 0.867 0.732 0.370 1e-116
224123984 1016 predicted protein [Populus trichocarpa] 0.953 0.734 0.327 1e-113
224142481781 predicted protein [Populus trichocarpa] 0.835 0.836 0.368 1e-112
224134597 947 predicted protein [Populus trichocarpa] 0.884 0.730 0.365 1e-111
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 369/938 (39%), Positives = 486/938 (51%), Gaps = 201/938 (21%)

Query: 1   MVIMFV---LLLIIFEGGWSEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQW 57
           MV+ +V   +LL++ E    +GCLD ER ALLQLK FF D    L  W+ A+   DCCQW
Sbjct: 1   MVLKWVWMGVLLVLSETCCCKGCLDKERAALLQLKPFF-DSTLALQKWLGAEDNLDCCQW 59

Query: 58  ANVECNNTTGRVIQLYLSNTRSMELEE-WYLNAYLFTPFQQLESLSLSANNIAGCVENEG 116
             VEC++ TGRV +L L  TR+ +    WYLNA LF PF++L+SLSL  N+I  CVENEG
Sbjct: 60  ERVECSSITGRVTRLDLDTTRAYQSSRNWYLNASLFLPFEELKSLSLKGNSIVDCVENEG 119

Query: 117 ASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDSFNN 176
              R  TRL++L++ DLS NSFN SILSSL+  SS++SL L +N  E  I  ++  +F N
Sbjct: 120 FE-RLSTRLSSLEVLDLSYNSFNESILSSLSEFSSLKSLNLGFNPFEVPIQAQDLPNFEN 178

Query: 177 LEVLDMKRNEIDNLVVP-------------------------QGFPHFKSLEHLDMSYAH 211
           LE L + + E++N  +                          QG      L  LD+S   
Sbjct: 179 LEELYLDKIELENSFLQTVGVMTSLKVLSLSGCGLTGALPNVQGLCELIHLRVLDVS--- 235

Query: 212 IALNTNFLQIIGESMPSLKHLSLSNFSP-------SNDSWTLNQVLW---LSNNHFRIPI 261
              +  F  I+   + +L  L L + S        SN    + + L    +SNNHF++P 
Sbjct: 236 ---SNEFHGILPWCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLDVSNNHFQVPF 292

Query: 262 SPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYG------------ 309
           S  P FNHS LK     NN I+ E  E HS  AP FQL S+ + SGYG            
Sbjct: 293 SLGPFFNHSNLKHIRGQNNAIYLE-AELHS--APRFQLISI-IFSGYGICGTFPNFLYHQ 348

Query: 310 --------------------------------------DGPFRLPIHSHKSLRLLDVSNN 331
                                                  G  +LP+H H +L  LD+SNN
Sbjct: 349 NNLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHVNLLALDISNN 408

Query: 332 NFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSF------------------------- 366
           +    IP+EIG  LP L   N+S N  DGSIPSSF                         
Sbjct: 409 HVHDHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQLSGSIPEHLA 468

Query: 367 ----------------EGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLN 410
                           +G MFSK FNLTN+ WL L++NHF G IP+SLSK   L  + L+
Sbjct: 469 TGCFSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSKS-ALSIMDLS 527

Query: 411 NNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCF 470
           +N+LSG IP W+GNL+ LQ++I+  N L+GPIPVEFCQL +L++LD+++N++SG LPSC 
Sbjct: 528 DNHLSGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNSVSGILPSCL 587

Query: 471 HLLSIEQ---------------------------------------INGLSGLSHLILAH 491
              SI                                         I G++ L  L L  
Sbjct: 588 SPSSIIHVHLSQNMIEGPWTNAFSGSHFLVTLDLSSNRITGRIPTLIGGINALRILNLKS 647

Query: 492 NNLEGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESYNNNSSLDKPFEISFDF 551
           N  +GE+P Q+CGL QL L+ L+DNNL G IP                 LD+   ++ D 
Sbjct: 648 NRFDGEIPAQICGLYQLSLIVLADNNLSGSIPSCL-------------QLDQSDSLAPDV 694

Query: 552 RNTEKKVEKKSHEI--FEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRI 609
                 +      +    FTTK  +Y+YQG++LS +SGID SCNKL G IPP +GN + I
Sbjct: 695 PPVPNPLNPYYLPVRPMYFTTKRRSYSYQGKILSYISGIDFSCNKLTGEIPPEMGNHSAI 754

Query: 610 QILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSG 669
             LNLS+N  TG IPSTFS L+   +LDLSYN LNG IP QL+EL     FS A NNL G
Sbjct: 755 YSLNLSYNRFTGPIPSTFSNLKQIESLDLSYNNLNGDIPSQLLELKFLSYFSVAHNNLFG 814

Query: 670 KIPELTAQFATFNESSYKGNPFLCGLPLPIC---RSPATMPEASTNNEGDDNLIDTGNFF 726
           K P+ T QFATF  SSY+GNP LCGLPLP     R  ++ P AS  +E + N +D   F+
Sbjct: 815 KTPKRTGQFATFEVSSYEGNPNLCGLPLPKSCTEREASSAPRASAMDE-ESNFLDMNTFY 873

Query: 727 ITFTISYIILIFGIIIVLYVNPYWRRRWFYLVEMWIAS 764
            +F +SY  +I G+ +VLY+NP WRR WF  V++ I+S
Sbjct: 874 GSFIVSYTFVIIGMFLVLYINPQWRRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224142717|ref|XP_002324701.1| predicted protein [Populus trichocarpa] gi|222866135|gb|EEF03266.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142721|ref|XP_002324703.1| predicted protein [Populus trichocarpa] gi|222866137|gb|EEF03268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134597|ref|XP_002327443.1| predicted protein [Populus trichocarpa] gi|222835997|gb|EEE74418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query782
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.831 0.665 0.293 6.8e-51
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.896 0.701 0.277 1.4e-46
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.843 0.705 0.283 1.1e-45
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.644 0.522 0.299 2.9e-45
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.820 0.720 0.276 2.3e-43
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.618 0.446 0.294 2.8e-41
TAIR|locus:2005498 1196 BRI1 "BRASSINOSTEROID INSENSIT 0.443 0.290 0.292 1.6e-40
TAIR|locus:2119535725 RLP48 "receptor like protein 4 0.551 0.594 0.271 6.8e-40
TAIR|locus:2041150 1143 BRL2 "BRI1-like 2" [Arabidopsi 0.869 0.594 0.263 1.6e-39
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.782 0.489 0.268 1.8e-39
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 537 (194.1 bits), Expect = 6.8e-51, P = 6.8e-51
 Identities = 214/729 (29%), Positives = 320/729 (43%)

Query:    74 LSNTRSMELEEWYLNAYLFTPFQQLESL---SLSANNIAGCVENEGASSREVTRLNNLKM 130
             L+  R ++L    L+  L   F  LESL   SLS NN  G       S   +  L  LK+
Sbjct:   283 LNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNFEGFF-----SLNPLANLTKLKV 337

Query:   131 FDLSGNS--FNNXXXXXXXXXXXXXXXXXXYNRLEGSIDVKEFDSFN-NLEVLDMKRNEI 187
             F LS  S                       +  L G I    F  +  NL ++D+  N +
Sbjct:   338 FRLSSTSEMLQVETESNWLPKFQLTVAALPFCSL-GKIP--NFLVYQTNLRLVDLSSNRL 394

Query:   188 DNLV---VPQGFPHFKSLEHLDMSYAHIALNT--NFLQIIGESMPSLKHLSLSNFSPSND 242
                +   + +  P  K L+  + S+    + T  + LQ++  S   +     +   P N 
Sbjct:   395 SGDIPTWLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDI-----TGVLPDNI 449

Query:   243 SWTLNQVLWLSNNH--FR--IPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQ 298
                L ++L ++ +H  F+  +P S   + + S L +  +YNN    E+  S  L    F 
Sbjct:   450 GHVLPRLLHMNGSHNGFQGNLPSSMGEMNDISFLDL--SYNN-FSGELPRS--LLTGCFS 504

Query:   299 LKSLSLSSGYGDGPFRLPIHSH-KSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNA 357
             L +L LS     GP  LPI +   SL +L + NN F G I V +  ++ +LS F+ S N 
Sbjct:   505 LITLQLSHNSFSGPI-LPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLV-NLSIFDASNNR 562

Query:   358 LDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFXXXXXXXXXXXXSGK 417
             L G I SS          + +++  LLL  N   G +P SL                SG 
Sbjct:   563 LTGLISSSIPP-------DSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGD 615

Query:   418 IPQWLGN-LTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIE 476
             +P  + N + G++ I +  N   GP+PV    L+   ILD+ +N +SGS+P         
Sbjct:   616 LPSSVVNSMYGIK-IFLHNNSFTGPLPVTL--LENAYILDLRNNKLSGSIP--------- 663

Query:   477 QINGLSGLSHLILAHNNLEGEVPVXXXXXXXXXXXXXXXXXXHGLIPPFF--YNTALHES 534
             Q      +  L+L  NNL G +P                   +G+IPP     +T L E 
Sbjct:   664 QFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTELGEG 723

Query:   535 -----YNNNSSLDKPFEISFDFRNTEKKVE-----KKSHEI--FEFTTKSNAYTYQGRVL 582
                  ++   S     ++ F +R+T    E       ++ I   EF  K    ++ G  L
Sbjct:   724 IGLSGFSQEISFGDSLQMEF-YRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTL 782

Query:   583 SLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNK 642
               + G+DLS N+L G IP  +G+L++++ LNLS N L+ +IP+ FSKL+   +LDLSYN 
Sbjct:   783 DYMYGLDLSSNELSGVIPAELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNM 842

Query:   643 LNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLP-ICR 701
             L G IP QL  L +  VF+ + NNLSG IP+   QF TFN++SY GNP LCG P    C 
Sbjct:   843 LQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQ-GGQFNTFNDNSYLGNPLLCGTPTDRSCE 901

Query:   702 SPATMPEASTNNE------GDDNLIDTGNFFITFTXXXXXXXXXXXXVLYVNPYWRRRWF 755
                   EA    E       D+  ID    + T              ++  +  WRR W 
Sbjct:   902 GKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGILVLMCFDCPWRRTWL 961

Query:   756 YLVEMWIAS 764
              +V+ +IAS
Sbjct:   962 CIVDAFIAS 970


GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005498 BRI1 "BRASSINOSTEROID INSENSITIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041150 BRL2 "BRI1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00181274
hypothetical protein (876 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query782
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-50
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-26
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  191 bits (486), Expect = 1e-50
 Identities = 215/727 (29%), Positives = 311/727 (42%), Gaps = 144/727 (19%)

Query: 1   MVIMFVLLLIIFEGGWSEGCLDHERFALL-QLKHFFNDPVNYLHDWVDAKGATDCCQWAN 59
           ++ M   L + F        L  E   LL   K   NDP+ YL +W     + D C W  
Sbjct: 12  LIFMLFFLFLNF------SMLHAEELELLLSFKSSINDPLKYLSNW---NSSADVCLWQG 62

Query: 60  VECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLESLSLSANNIAGCVENEGASS 119
           + CNN                                ++ S+ LS  NI+G +      S
Sbjct: 63  ITCNN------------------------------SSRVVSIDLSGKNISGKI------S 86

Query: 120 REVTRLNNLKMFDLSGNSFNNSILSSLTRLS-SVRSLKLSYNRLEGSIDVKEFDSFNNLE 178
             + RL  ++  +LS N  +  I   +   S S+R L LS N   GSI      S  NLE
Sbjct: 87  SAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSI---PRGSIPNLE 143

Query: 179 VLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFS 238
            LD+  N +    +P     F SL+ LD       L  N L  +G+   SL +L      
Sbjct: 144 TLDLSNNMLSG-EIPNDIGSFSSLKVLD-------LGGNVL--VGKIPNSLTNL------ 187

Query: 239 PSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLK-IFHAYNN---EIHAEITESHSLTA 294
                 T  + L L++N     I P  L     LK I+  YNN   EI  EI    SL  
Sbjct: 188 ------TSLEFLTLASNQLVGQI-PRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNH 240

Query: 295 PTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNIS 354
                 +L+       GP    + + K+L+ L +  N   G IP  I   L  L   ++S
Sbjct: 241 LDLVYNNLT-------GPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFS-LQKLISLDLS 292

Query: 355 MNALDGSIP------SSFE-GHMFSKNF---------NLTNVRWLLLEENHFVGEIPQSL 398
            N+L G IP       + E  H+FS NF         +L  ++ L L  N F GEIP++L
Sbjct: 293 DNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNL 352

Query: 399 SKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDIS 458
            K   L  L L+ NNL+G+IP+ L +   L  +I+  N LEG IP        L+ + + 
Sbjct: 353 GKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQ 412

Query: 459 DNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGLNQLQLLDLSDNNL 518
           DN+ SG LPS F  L +        +  L +++NNL+G +  +   +  LQ+L L+ N  
Sbjct: 413 DNSFSGELPSEFTKLPL--------VYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKF 464

Query: 519 HGLIPPFFYNTALHESYNNNSSLDKPFEISFDFRNTEKKVEKKSHEIFEFTTKSNAYTYQ 578
            G +P  F +  L        +LD                   S   F     S A   +
Sbjct: 465 FGGLPDSFGSKRL-------ENLD------------------LSRNQF-----SGAVPRK 494

Query: 579 GRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDL 638
              LS L  + LS NKL G IP  + +  ++  L+LSHN L+G IP++FS++     LDL
Sbjct: 495 LGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDL 554

Query: 639 SYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCG---- 694
           S N+L+G+IP+ L  + + V  + + N+L G +P  T  F   N S+  GN  LCG    
Sbjct: 555 SQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS-TGAFLAINASAVAGNIDLCGGDTT 613

Query: 695 LPLPICR 701
             LP C+
Sbjct: 614 SGLPPCK 620


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 782
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
PLN03150623 hypothetical protein; Provisional 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.3
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.99
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.95
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.64
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.08
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.99
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.89
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.79
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.77
PRK15386426 type III secretion protein GogB; Provisional 97.76
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.76
PRK15386426 type III secretion protein GogB; Provisional 97.72
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.6
KOG4341483 consensus F-box protein containing LRR [General fu 97.21
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.2
KOG4341483 consensus F-box protein containing LRR [General fu 97.2
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.16
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.11
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.04
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.35
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.9
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.46
KOG4308478 consensus LRR-containing protein [Function unknown 92.81
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.93
smart0037026 LRR Leucine-rich repeats, outliers. 91.93
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.16
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.34
KOG1947482 consensus Leucine rich repeat proteins, some prote 89.71
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 89.62
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.47
smart0037026 LRR Leucine-rich repeats, outliers. 88.47
KOG4308478 consensus LRR-containing protein [Function unknown 87.93
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.73
KOG1947482 consensus Leucine rich repeat proteins, some prote 84.38
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=7.9e-73  Score=689.28  Aligned_cols=579  Identities=33%  Similarity=0.512  Sum_probs=525.5

Q ss_pred             cHHHHHHHHHhHhcCCCCCCCcCCCCCCCCCCCCCcccceEecCCCCCEEEEEcCCCCCccccccccCcccccCCCCCCE
Q 044724           21 LDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMELEEWYLNAYLFTPFQQLES  100 (782)
Q Consensus        21 ~~~~~~aLl~~k~~~~~~~~~l~~W~~~~~~~~~C~w~gv~C~~~~~~V~~L~L~~~~~~~~~~~~~~~~~~~~l~~L~~  100 (782)
                      .++|++||++||+++.+|.+.+++|..   +++||.|.||+|++ .++|+.|+|+++.+.  |.   .+..|..+++|++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~---~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~--~~---~~~~~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNS---SADVCLWQGITCNN-SSRVVSIDLSGKNIS--GK---ISSAIFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCC---CCCCCcCcceecCC-CCcEEEEEecCCCcc--cc---CChHHhCCCCCCE
Confidence            578999999999999888888899975   67899999999985 679999999998763  22   1456889999999


Q ss_pred             EeCCCCCCCCccCCCCcccccccCCCCCcEEeCCCCCCCCcchhhcCCCCCCCEEEccCCcCcCcCChhhhcCCCCCCEE
Q 044724          101 LSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDSFNNLEVL  180 (782)
Q Consensus       101 L~Ls~n~l~~~~~~~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~ip~~~~~~l~~L~~L  180 (782)
                      |+|++|++++.+|..     .+.++++|++|+|++|++++.+|.  +.+++|++|+|++|.+.+.+|. .++++++|++|
T Consensus        98 L~Ls~n~~~~~ip~~-----~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~-~~~~l~~L~~L  169 (968)
T PLN00113         98 INLSNNQLSGPIPDD-----IFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPN-DIGSFSSLKVL  169 (968)
T ss_pred             EECCCCccCCcCChH-----HhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCCh-HHhcCCCCCEE
Confidence            999999999887764     255899999999999999988775  5689999999999999988886 89999999999


Q ss_pred             EcccCCCCCccCCCCCCCCCCccEEecccCcccccccchHHHhhcCCCCCeEeCCC-----CCCC-CCCCCCCCeEEccC
Q 044724          181 DMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSN-----FSPS-NDSWTLNQVLWLSN  254 (782)
Q Consensus       181 ~Ls~n~l~~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~l~~~l~~L~~L~L~~-----~ip~-~~~l~~L~~L~Ls~  254 (782)
                      ++++|.+.+.. |..+.++++|++|++++  |.+.+.+|..+.. +++|++|++++     .+|. ++.+++|++|++++
T Consensus       170 ~L~~n~l~~~~-p~~~~~l~~L~~L~L~~--n~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~  245 (968)
T PLN00113        170 DLGGNVLVGKI-PNSLTNLTSLEFLTLAS--NQLVGQIPRELGQ-MKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVY  245 (968)
T ss_pred             ECccCcccccC-ChhhhhCcCCCeeeccC--CCCcCcCChHHcC-cCCccEEECcCCccCCcCChhHhcCCCCCEEECcC
Confidence            99999998875 88999999999999999  7788889999998 99999999987     4566 88999999999999


Q ss_pred             ceeeeecCCCCcCCCCCCcEEEccCCccceeccccccCCCCCCCccEEEccCCCCCCCCccCCCCCCCCcEEEccCCcCC
Q 044724          255 NHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNNFQ  334 (782)
Q Consensus       255 n~l~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~Ls~n~l~  334 (782)
                      |.+++.+|. .+.++++|++|++++|.+.+..+..   .....+|++|++++|.+.+..|..+..+++|+.|++++|.+.
T Consensus       246 n~l~~~~p~-~l~~l~~L~~L~L~~n~l~~~~p~~---l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~  321 (968)
T PLN00113        246 NNLTGPIPS-SLGNLKNLQYLFLYQNKLSGPIPPS---IFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFT  321 (968)
T ss_pred             ceeccccCh-hHhCCCCCCEEECcCCeeeccCchh---HhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccC
Confidence            999987775 4899999999999999998764432   345578999999999999999988999999999999999999


Q ss_pred             ccCChhhhhcCCCCcEEEcccCcCcccCCCcccccccccCCCCCCCCEEEccCccccccCCccccCCCCCcEEECcCCcc
Q 044724          335 GCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNL  414 (782)
Q Consensus       335 ~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~g~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l  414 (782)
                      +.+|..+.. +++|+.|++++|.+++.+|..+.        .+++|+.|++++|++++.+|..+..+++|+.|++++|++
T Consensus       322 ~~~~~~~~~-l~~L~~L~L~~n~l~~~~p~~l~--------~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l  392 (968)
T PLN00113        322 GKIPVALTS-LPRLQVLQLWSNKFSGEIPKNLG--------KHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSL  392 (968)
T ss_pred             CcCChhHhc-CCCCCEEECcCCCCcCcCChHHh--------CCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEe
Confidence            999988877 89999999999999988887776        789999999999999999999999999999999999999


Q ss_pred             cccCCccccCcCCCCEEeCCCCccccCCChhccCCCCCceEeccCCcceeeCCCCccccchhhhcCCCCCCEEEcCCCcc
Q 044724          415 SGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNL  494 (782)
Q Consensus       415 ~~~~p~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~~~~~~~~~l~~L~~L~L~~N~l  494 (782)
                      .+.+|..+..+++|+.|++++|++++.+|..|..+++|+.|++++|++++.+|        ..+..+++|++|++++|++
T Consensus       393 ~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~--------~~~~~l~~L~~L~L~~n~~  464 (968)
T PLN00113        393 EGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRIN--------SRKWDMPSLQMLSLARNKF  464 (968)
T ss_pred             cccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccC--------hhhccCCCCcEEECcCcee
Confidence            99999999999999999999999999999999999999999999999999888        5567889999999999999


Q ss_pred             eeecCccccCCCCCCEEEccCCcCCCcCCcccccccccccccCCCCCCCCccccccccccccccccccccEEEEEecCCe
Q 044724          495 EGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESYNNNSSLDKPFEISFDFRNTEKKVEKKSHEIFEFTTKSNA  574 (782)
Q Consensus       495 ~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  574 (782)
                      .+.+|..+ ..++|+.|++++|++++.+|..+..                                              
T Consensus       465 ~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~----------------------------------------------  497 (968)
T PLN00113        465 FGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGS----------------------------------------------  497 (968)
T ss_pred             eeecCccc-ccccceEEECcCCccCCccChhhhh----------------------------------------------
Confidence            98888766 4689999999999999988876654                                              


Q ss_pred             eeecchhhcccceeeccCCccCccCCcccccccccceeecccccccccCCccccCCCCCCEEecCCCccccCCchhhhcC
Q 044724          575 YTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVEL  654 (782)
Q Consensus       575 ~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~LdLs~N~l~~~ip~~l~~l  654 (782)
                             +++|+.|+|++|++++.+|..++.+++|++|+|++|.++|.+|..|+++++|++|||++|+++|.+|..+..+
T Consensus       498 -------l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l  570 (968)
T PLN00113        498 -------LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNV  570 (968)
T ss_pred             -------hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcC
Confidence                   5579999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcEEEcccCcCcccCCCCccccCCCCcccccCCCCCCCCC
Q 044724          655 NAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLP  696 (782)
Q Consensus       655 ~~L~~L~ls~N~l~~~~p~~~~~~~~l~~~~~~gNp~lC~~~  696 (782)
                      ++|+++++++|+++|.+|. .+++.++...++.|||.+|+.+
T Consensus       571 ~~L~~l~ls~N~l~~~~p~-~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        571 ESLVQVNISHNHLHGSLPS-TGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             cccCEEeccCCcceeeCCC-cchhcccChhhhcCCccccCCc
Confidence            9999999999999999999 7899999999999999999854



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query782
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-37
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-18
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-37
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-11
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 155 bits (391), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 172/643 (26%), Positives = 267/643 (41%), Gaps = 109/643 (16%) Query: 124 RLNNLKMFDLSGNSFNNXXXXX---XXXXXXXXXXXXXYNRLEGSIDVKEFDSFNNLEVL 180 +LN+L++ DLS NS + N++ G +DV NLE L Sbjct: 146 KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCV---NLEFL 202 Query: 181 DMKRNEIDNLVVPQGFPHF---KSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNF 237 D+ N G P +L+HLD+S ++ +F Sbjct: 203 DVSSNNFS-----TGIPFLGDCSALQHLDISGNKLS---------------------GDF 236 Query: 238 SPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTF 297 S + + T ++L +S+N F PI P PL L+ N+ EI + S T Sbjct: 237 SRAISTCTELKLLNISSNQFVGPIPPLPL---KSLQYLSLAENKFTGEIPDFLSGACDTL 293 Query: 298 QLKSLSLSSGYGDGP--------------------FRLPIHS---HKSLRLLDVSNNNFQ 334 LS + YG P LP+ + + L++LD+S N F Sbjct: 294 TGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS 353 Query: 335 GCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLEENHFVGEI 394 G +P + ++ SL ++S N G I + + KN ++ L L+ N F G+I Sbjct: 354 GELPESLTNLSASLLTLDLSSNNFSGPILPNLCQN--PKN----TLQELYLQNNGFTGKI 407 Query: 395 PQSLSKCFXXXXXXXXXXXXSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEFCQLDWLQI 454 P +LS C SG IP LG+L+ L+ + + N LEG IP E + L+ Sbjct: 408 PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET 467 Query: 455 LDISDNNISGSLPS----CFHL----LSIEQING--------LSGLSHLILAHNNLEGEV 498 L + N+++G +PS C +L LS ++ G L L+ L L++N+ G + Sbjct: 468 LILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI 527 Query: 499 PVXXXXXXXXXXXXXXXXXXHGLIPPFFYNTALHESYN----------NNSSLDKPFE-- 546 P +G IP + + + N N + K Sbjct: 528 PAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGA 587 Query: 547 ---ISFDFRNTEKKVEKKSHEIFEFTTK------SNAYTYQGRVLSLLSGIDLSCNKLIG 597 + F +E+ + T++ S + G ++ L D+S N L G Sbjct: 588 GNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFL----DMSYNMLSG 643 Query: 598 HIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAF 657 +IP IG++ + ILNL HN+++G+IP L LDLS NKL+G+IP+ + L Sbjct: 644 YIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTML 703 Query: 658 VVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLPIC 700 + NNLSG IPE+ QF TF + + NP LCG PLP C Sbjct: 704 TEIDLSNNNLSGPIPEM-GQFETFPPAKFLNNPGLCGYPLPRC 745
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query782
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-113
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-102
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-47
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-62
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-60
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-58
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-56
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-40
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-46
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-41
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-40
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-36
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-50
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-49
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-34
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-30
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-46
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-39
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-38
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-27
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-22
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-18
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 9e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  360 bits (927), Expect = e-113
 Identities = 160/628 (25%), Positives = 246/628 (39%), Gaps = 100/628 (15%)

Query: 95  FQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRS 154
              LE L +S+NN +  +         +   + L+  D+SGN  +     +++  + ++ 
Sbjct: 199 CVNLEFLDVSSNNFSTGIP-------FLGDCSALQHLDISGNKLSGDFSRAISTCTELKL 251

Query: 155 LKLSYNRLEGSIDVKEFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYAHIAL 214
           L +S N+  G I         +L+ L +  N+    +         +L  LD+S  H   
Sbjct: 252 LNISSNQFVGPIPP---LPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNH--F 306

Query: 215 NTNFLQIIGESMPSLKHLSLS--NFS---PSNDSWTLN--QVLWLSNNHFRIPISPDPLF 267
                   G S   L+ L+LS  NFS   P +    +   +VL LS N F   + P+ L 
Sbjct: 307 YGAVPPFFG-SCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGEL-PESLT 364

Query: 268 N-HSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLL 326
           N  + L      +N     I  +         L+ L L +    G     + +   L  L
Sbjct: 365 NLSASLLTLDLSSNNFSGPILPNLCQNPKN-TLQELYLQNNGFTGKIPPTLSNCSELVSL 423

Query: 327 DVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPSSFEGHMFSKNFNLTNVRWLLLE 386
            +S N   G IP  +G  L  L    + +N L+G IP             +  +  L+L+
Sbjct: 424 HLSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQEL--------MYVKTLETLILD 474

Query: 387 ENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNLTGLQHIIMPKNHLEGPIPVEF 446
            N   GEIP  LS C  L  + L+NN L+G+IP+W+G L  L  + +  N   G IP E 
Sbjct: 475 FNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL 534

Query: 447 CQLDWLQILDISDNNISGSLPSCF-HLLSIEQINGLSG-------------LSHLILAHN 492
                L  LD++ N  +G++P+           N ++G               H      
Sbjct: 535 GDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLL 594

Query: 493 NLEGEVPVQLCGLNQLQLLDLSDNNLHGLIPPFFYNTALHESYNNNSSLDKPFEISFDFR 552
             +G    QL  L+     +++     G   P F N                        
Sbjct: 595 EFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDN------------------------ 630

Query: 553 NTEKKVEKKSHEIFEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQIL 612
                                           +  +D+S N L G+IP  IG++  + IL
Sbjct: 631 -----------------------------NGSMMFLDMSYNMLSGYIPKEIGSMPYLFIL 661

Query: 613 NLSHNNLTGTIPSTFSKLEAYRNLDLSYNKLNGKIPRQLVELNAFVVFSFACNNLSGKIP 672
           NL HN+++G+IP     L     LDLS NKL+G+IP+ +  L        + NNLSG IP
Sbjct: 662 NLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIP 721

Query: 673 ELTAQFATFNESSYKGNPFLCGLPLPIC 700
           E   QF TF  + +  NP LCG PLP C
Sbjct: 722 E-MGQFETFPPAKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query782
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.35
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.06
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.93
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.76
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.67
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.33
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.33
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.86
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.59
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.99
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.97
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.72
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7.2e-82  Score=748.58  Aligned_cols=653  Identities=29%  Similarity=0.400  Sum_probs=477.0

Q ss_pred             CCCCcHHHHHHHHHhHhcCCCCCCCcCCCCCCCCCCCCCcccceEecCCCCCEEEEEcCCCCCccc----cc--------
Q 044724           17 SEGCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCCQWANVECNNTTGRVIQLYLSNTRSMEL----EE--------   84 (782)
Q Consensus        17 ~~~~~~~~~~aLl~~k~~~~~~~~~l~~W~~~~~~~~~C~w~gv~C~~~~~~V~~L~L~~~~~~~~----~~--------   84 (782)
                      ++.+.++||+|||+||+++.||. .+++|..   ++|||+|+||+|+  +|||++|+|++..+...    .+        
T Consensus         6 ~~~~~~~~~~all~~k~~~~~~~-~l~~W~~---~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L   79 (768)
T 3rgz_A            6 PSQSLYREIHQLISFKDVLPDKN-LLPDWSS---NKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGL   79 (768)
T ss_dssp             --CCHHHHHHHHHHHHTTCSCTT-SSTTCCT---TSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTC
T ss_pred             cccCCHHHHHHHHHHHhhCCCcc-cccCCCC---CCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCcc
Confidence            45668999999999999999988 8999975   6799999999998  79999999998876321    00        


Q ss_pred             ---------cccCcccccCCCCCCEEeCCCCCCCCccCCCCcccccccCCCCCcEEeCCCCCCCCcchhhc-CCCCCCCE
Q 044724           85 ---------WYLNAYLFTPFQQLESLSLSANNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSL-TRLSSVRS  154 (782)
Q Consensus        85 ---------~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~-~~l~~L~~  154 (782)
                               +...+..|..+++|++|||++|.++|.+|..    ..++++++|++|+|++|.+++.+|..+ .++++|++
T Consensus        80 ~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~----~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~  155 (768)
T 3rgz_A           80 ESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTL----TSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEV  155 (768)
T ss_dssp             CEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGG----GGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSE
T ss_pred             cccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCCh----HHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCE
Confidence                     0000135778888888888888888766641    015556666666666665555444443 44555555


Q ss_pred             EEccCCcCcCcCChh------------------------hhcCCCCCCEEEcccCCCCCccCCCCCCCCCCccEEecccC
Q 044724          155 LKLSYNRLEGSIDVK------------------------EFDSFNNLEVLDMKRNEIDNLVVPQGFPHFKSLEHLDMSYA  210 (782)
Q Consensus       155 L~Ls~n~l~~~ip~~------------------------~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~l~~L~~L~L~~n  210 (782)
                      |++++|.+++..|..                        .+..+++|++|++++|.+++.. |. ++++++|++|++++ 
T Consensus       156 L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~-~~-l~~l~~L~~L~Ls~-  232 (768)
T 3rgz_A          156 LDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGI-PF-LGDCSALQHLDISG-  232 (768)
T ss_dssp             EECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCC-CB-CTTCCSCCEEECCS-
T ss_pred             EECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCC-cc-cccCCCCCEEECcC-
Confidence            555555554332221                        1256677777777777777653 44 78888888888888 


Q ss_pred             cccccccchHHHhhcCCCCCeEeCCC-----CCCCCCCCCCCCeEEccCceeeeecCCCCcCCCCCCcEEEccCCcccee
Q 044724          211 HIALNTNFLQIIGESMPSLKHLSLSN-----FSPSNDSWTLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAE  285 (782)
Q Consensus       211 ~~~~~~~~~~~l~~~l~~L~~L~L~~-----~ip~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~l~~L~~L~l~~n~l~~~  285 (782)
                       +.+.+.+|..+.. +++|++|++++     .+|.. .+++|++|++++|.+++.+|......+++|++|++++|.+.+.
T Consensus       233 -n~l~~~~~~~l~~-l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~  309 (768)
T 3rgz_A          233 -NKLSGDFSRAIST-CTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGA  309 (768)
T ss_dssp             -SCCCSCHHHHTTT-CSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEEC
T ss_pred             -CcCCCcccHHHhc-CCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCc
Confidence             6677778888877 88888888877     23333 7788888888888888887776444458888888888888776


Q ss_pred             ccccccCCCCCCCccEEEccCCCCCCCCccC-CCCCCCCcEEEccCCcCCccCChhhhhcCC-CCcEEEcccCcCcccCC
Q 044724          286 ITESHSLTAPTFQLKSLSLSSGYGDGPFRLP-IHSHKSLRLLDVSNNNFQGCIPVEIGDILP-SLSCFNISMNALDGSIP  363 (782)
Q Consensus       286 ~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~-~~~~~~L~~L~Ls~n~l~~~ip~~~~~~l~-~L~~L~Ls~n~l~~~~p  363 (782)
                      .+..   +....+|++|++++|.+.+.++.. +..+++|++|++++|++++.+|..+.. ++ +|++|++++|.+++.+|
T Consensus       310 ~p~~---~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~-l~~~L~~L~Ls~N~l~~~~~  385 (768)
T 3rgz_A          310 VPPF---FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTN-LSASLLTLDLSSNNFSGPIL  385 (768)
T ss_dssp             CCGG---GGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHH-HTTTCSEEECCSSEEEEECC
T ss_pred             cchH---HhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHh-hhcCCcEEEccCCCcCCCcC
Confidence            5433   345567888888888887666654 778888888888888888888888776 44 78888888888777666


Q ss_pred             Cccc------------------ccccccCCCCCCCCEEEccCccccccCCccccCCCCCcEEECcCCcccccCCccccCc
Q 044724          364 SSFE------------------GHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGNL  425 (782)
Q Consensus       364 ~~~~------------------g~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l  425 (782)
                      ..+.                  +.+|..+.++++|++|++++|++++.+|..+..+++|++|++++|.+++.+|..+..+
T Consensus       386 ~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l  465 (768)
T 3rgz_A          386 PNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV  465 (768)
T ss_dssp             TTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGC
T ss_pred             hhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCC
Confidence            5543                  2344455567777777777777777777777777777777777777777777777777


Q ss_pred             CCCCEEeCCCCccccCCChhccCCCCCceEeccCCcceeeCCCCccccchhhhcCCCCCCEEEcCCCcceeecCccccCC
Q 044724          426 TGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGLSHLILAHNNLEGEVPVQLCGL  505 (782)
Q Consensus       426 ~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l  505 (782)
                      ++|++|++++|++++.+|..+.++++|++|++++|++++.+|        .+++.+++|++|++++|++++.+|..+..+
T Consensus       466 ~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p--------~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l  537 (768)
T 3rgz_A          466 KTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIP--------KWIGRLENLAILKLSNNSFSGNIPAELGDC  537 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCC--------GGGGGCTTCCEEECCSSCCEEECCGGGGGC
T ss_pred             CCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCC--------hHHhcCCCCCEEECCCCcccCcCCHHHcCC
Confidence            788888888888877777778788888888888888877777        567788888888888888888888888888


Q ss_pred             CCCCEEEccCCcCCCcCCcccccccccccccCCCCCCCCccccc--------------ccccc---cc-cc-----cccc
Q 044724          506 NQLQLLDLSDNNLHGLIPPFFYNTALHESYNNNSSLDKPFEISF--------------DFRNT---EK-KV-----EKKS  562 (782)
Q Consensus       506 ~~L~~L~Ls~N~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~--------------~~~~~---~~-~~-----~~~~  562 (782)
                      ++|++|++++|+++|.+|..+................ ..++..              .+...   .. ..     ....
T Consensus       538 ~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~  616 (768)
T 3rgz_A          538 RSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKR-YVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNIT  616 (768)
T ss_dssp             TTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCE-EEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTT
T ss_pred             CCCCEEECCCCccCCcCChHHhcccchhhhhcccccc-ccccccccccccccccccccccccccchhhhccccccccccc
Confidence            8888888888888888888776533111110000000 000000              00000   00 00     0000


Q ss_pred             ccEEEEEecCCeeeecchhhcccceeeccCCccCccCCcccccccccceeecccccccccCCccccCCCCCCEEecCCCc
Q 044724          563 HEIFEFTTKSNAYTYQGRVLSLLSGIDLSCNKLIGHIPPPIGNLTRIQILNLSHNNLTGTIPSTFSKLEAYRNLDLSYNK  642 (782)
Q Consensus       563 ~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~LdLs~N~  642 (782)
                      ...+....     ......+++|+.|||++|+++|.+|.+++++++|+.|+|++|+++|.+|..|+++++|++||||+|+
T Consensus       617 ~~~~~g~~-----~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~  691 (768)
T 3rgz_A          617 SRVYGGHT-----SPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNK  691 (768)
T ss_dssp             SCEEEEEC-----CCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC
T ss_pred             cceecccC-----chhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCc
Confidence            00000000     0011226789999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCchhhhcCCCCcEEEcccCcCcccCCCCccccCCCCcccccCCCCCCCCCCCCCCCCC
Q 044724          643 LNGKIPRQLVELNAFVVFSFACNNLSGKIPELTAQFATFNESSYKGNPFLCGLPLPICRSPA  704 (782)
Q Consensus       643 l~~~ip~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~~l~~~~~~gNp~lC~~~l~~C~~~~  704 (782)
                      ++|.+|..+.++++|++||+++|+++|.||. .+++.++...+|.|||++||.|+..|....
T Consensus       692 l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~-~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~  752 (768)
T 3rgz_A          692 LDGRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETFPPAKFLNNPGLCGYPLPRCDPSN  752 (768)
T ss_dssp             CEECCCGGGGGCCCCSEEECCSSEEEEECCS-SSSGGGSCGGGGCSCTEEESTTSCCCCSCC
T ss_pred             ccCcCChHHhCCCCCCEEECcCCcccccCCC-chhhccCCHHHhcCCchhcCCCCcCCCCCc
Confidence            9999999999999999999999999999999 799999999999999999999988897554



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 782
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 78.1 bits (191), Expect = 6e-16
 Identities = 61/392 (15%), Positives = 128/392 (32%), Gaps = 51/392 (13%)

Query: 125 LNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDSFNNLEVLDMKR 184
           L+ +           +  +  +  L+++  +  S N+L             NL  L    
Sbjct: 43  LDQVTTLQADRLGIKS--IDGVEYLNNLTQINFSNNQLTDIT------PLKNLTKLVDIL 94

Query: 185 NEIDNLVVPQGFPHFKSLEHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSW 244
              + +       +  +L  L +    I        +   +   L   ++S+ S  +   
Sbjct: 95  MNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLT 154

Query: 245 TLNQVLWLSNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSL 304
           +L Q+ + +      P++         +      +  + A++T   SL A   Q+  ++ 
Sbjct: 155 SLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDIT- 213

Query: 305 SSGYGDGPFRLPIHSHKSLRLLDVSNNNFQGCIPVEIGDILPSLSCFNISMNALDGSIPS 364
                      P+    +L  L ++ N  +    +     L +L+  +++ N +    P 
Sbjct: 214 -----------PLGILTNLDELSLNGNQLKDIGTLA---SLTNLTDLDLANNQISNLAPL 259

Query: 365 SFEGHMFSKNFNLTNVRWLLLEENHFVGEIPQSLSKCFLLKGLYLNNNNLSGKIPQWLGN 424
           S           LT +  L L  N      P +         L  N           + N
Sbjct: 260 S----------GLTKLTELKLGANQISNISPLAGLTALTNLELNENQLE----DISPISN 305

Query: 425 LTGLQHIIMPKNHLEGPIPVEFCQLDWLQILDISDNNISGSLPSCFHLLSIEQINGLSGL 484
           L  L ++ +  N++    P     L  LQ L  ++N +S           +  +  L+ +
Sbjct: 306 LKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD----------VSSLANLTNI 353

Query: 485 SHLILAHNNLEGEVPVQLCGLNQLQLLDLSDN 516
           + L   HN +    P  L  L ++  L L+D 
Sbjct: 354 NWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query782
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.45
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.97
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.88
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.9e-38  Score=332.88  Aligned_cols=278  Identities=25%  Similarity=0.415  Sum_probs=167.1

Q ss_pred             CCcHHHHHHHHHhHhcCCCCCCCcCCCCCCCCCCCCC--cccceEecCCC--CCEEEEEcCCCCCccccccccCcccccC
Q 044724           19 GCLDHERFALLQLKHFFNDPVNYLHDWVDAKGATDCC--QWANVECNNTT--GRVIQLYLSNTRSMELEEWYLNAYLFTP   94 (782)
Q Consensus        19 ~~~~~~~~aLl~~k~~~~~~~~~l~~W~~~~~~~~~C--~w~gv~C~~~~--~~V~~L~L~~~~~~~~~~~~~~~~~~~~   94 (782)
                      -|+++||+||++||+++.||. .+++|..   ++|||  .|.||+|+..+  +||++|||+++.+.  |...++ +.+.+
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~---~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~--g~~~lp-~~l~~   74 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWLP---TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLP--KPYPIP-SSLAN   74 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCT---TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCS--SCEECC-GGGGG
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCCC---CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCC--CCCCCC-hHHhc
Confidence            599999999999999999875 6899975   67999  49999998643  48999999988763  221222 34566


Q ss_pred             CCCCCEEeCCC-CCCCCccCCCCcccccccCCCCCcEEeCCCCCCCCcchhhcCCCCCCCEEEccCCcCcCcCChhhhcC
Q 044724           95 FQQLESLSLSA-NNIAGCVENEGASSREVTRLNNLKMFDLSGNSFNNSILSSLTRLSSVRSLKLSYNRLEGSIDVKEFDS  173 (782)
Q Consensus        95 l~~L~~L~Ls~-n~l~~~~~~~~~~~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~ip~~~~~~  173 (782)
                      +++|++|+|++ |+++|.+|.+      |+++++|++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|. .+.+
T Consensus        75 L~~L~~L~Ls~~N~l~g~iP~~------i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~-~l~~  147 (313)
T d1ogqa_          75 LPYLNFLYIGGINNLVGPIPPA------IAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPP-SISS  147 (313)
T ss_dssp             CTTCSEEEEEEETTEESCCCGG------GGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCG-GGGG
T ss_pred             Cccccccccccccccccccccc------cccccccchhhhccccccccccccccchhhhcccccccccccccCch-hhcc
Confidence            66666666664 5666666543      66666666666666666666666666666666666666666655554 5666


Q ss_pred             CCCCCEEEcccCCCCCccCCCCCCCCCCc-cEEecccCcccccccchHHHhhcCCCCCeEeCCCCCCCCCCCCCCCeEEc
Q 044724          174 FNNLEVLDMKRNEIDNLVVPQGFPHFKSL-EHLDMSYAHIALNTNFLQIIGESMPSLKHLSLSNFSPSNDSWTLNQVLWL  252 (782)
Q Consensus       174 l~~L~~L~Ls~n~l~~~~~~~~l~~l~~L-~~L~L~~n~~~~~~~~~~~l~~~l~~L~~L~L~~~ip~~~~l~~L~~L~L  252 (782)
                      +++|+++++++|.+.+.. |..+..+.++ +.+++++  +.+.+..|..+.. +                   ....+++
T Consensus       148 l~~L~~l~l~~n~l~~~i-p~~~~~l~~l~~~l~~~~--n~l~~~~~~~~~~-l-------------------~~~~l~l  204 (313)
T d1ogqa_         148 LPNLVGITFDGNRISGAI-PDSYGSFSKLFTSMTISR--NRLTGKIPPTFAN-L-------------------NLAFVDL  204 (313)
T ss_dssp             CTTCCEEECCSSCCEEEC-CGGGGCCCTTCCEEECCS--SEEEEECCGGGGG-C-------------------CCSEEEC
T ss_pred             Ccccceeecccccccccc-cccccccccccccccccc--ccccccccccccc-c-------------------ccccccc
Confidence            666666666666666543 5555555444 5555555  4444444444333 1                   1223444


Q ss_pred             cCceeeeecCCCCcCCCCCCcEEEccCCccceeccccccCCCCCCCccEEEccCCCCCCCCccCCCCCCCCcEEEccCCc
Q 044724          253 SNNHFRIPISPDPLFNHSRLKIFHAYNNEIHAEITESHSLTAPTFQLKSLSLSSGYGDGPFRLPIHSHKSLRLLDVSNNN  332 (782)
Q Consensus       253 s~n~l~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~Ls~n~  332 (782)
                      +.+...+.++. .+..+++++.+++.+|.+.+.++                            .+..+++|+.|++++|+
T Consensus       205 ~~~~~~~~~~~-~~~~~~~l~~l~~~~~~l~~~~~----------------------------~~~~~~~L~~L~Ls~N~  255 (313)
T d1ogqa_         205 SRNMLEGDASV-LFGSDKNTQKIHLAKNSLAFDLG----------------------------KVGLSKNLNGLDLRNNR  255 (313)
T ss_dssp             CSSEEEECCGG-GCCTTSCCSEEECCSSEECCBGG----------------------------GCCCCTTCCEEECCSSC
T ss_pred             ccccccccccc-ccccccccccccccccccccccc----------------------------ccccccccccccCccCe
Confidence            55555544432 23444444444444444332211                            12233455555555555


Q ss_pred             CCccCChhhhhcCCCCcEEEcccCcCcccCC
Q 044724          333 FQGCIPVEIGDILPSLSCFNISMNALDGSIP  363 (782)
Q Consensus       333 l~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p  363 (782)
                      ++|.+|..++. +++|++|+|++|+++|.+|
T Consensus       256 l~g~iP~~l~~-L~~L~~L~Ls~N~l~g~iP  285 (313)
T d1ogqa_         256 IYGTLPQGLTQ-LKFLHSLNVSFNNLCGEIP  285 (313)
T ss_dssp             CEECCCGGGGG-CTTCCEEECCSSEEEEECC
T ss_pred             ecccCChHHhC-CCCCCEEECcCCcccccCC
Confidence            55555555544 4555555555555555444



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure