Citrus Sinensis ID: 044748

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600--
LVNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCKSLTSLPTGIHSKYLKILNLWGCSNLNNFPEITSCHICIFELAEVGIKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSGNTDGSTRIERLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLKIIDCQKFKRLPNEIGNSKCLTVLIVKGTAIREVPESLGQLSSLESLVLSNNKLERLPESFNQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLSIDLRYCLKLDSNELSEIVKGGWMKQSFDGNIGIAKSMYFPGNEIPKWF
cccccEEEccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHcccccccEEEcccccccccccHHHHccccEEEccccccccccccccccccccEEccccccccccccHHHcccccccEEEcccccccccccccccccccccccccccccccHHHccccccccccccccccccccEEccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccHHHHccccccEEccccccccccccHHHHccccccEEEEccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccHHccccccccEEccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccHHHcccccccccccccccccEEEEccccccccc
ccccEEEEEcccccccccccccccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHccccccEEEEEccccccccccHHHHHHHcEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccccccccccccHcccccEEEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHHHcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccHEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccccccccEEcEEEccccccccccHHHHHHcccccEEEccccccccccccHcccccccEEEccccccccccccccccccccccccccc
lvnlkeidlsgsesltklpdlsraenlkilrlddclsltethSSIQYLNKLEFLTLEMCksltslptgihsKYLKILNLwgcsnlnnfpeitscHICIFELAEVGIKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNfkrfleipscntdgctgIERLASFKlklegcsspqslpinmfsfkslpsikiihcpnieslpsslcmfksltsleivdcqnfkrlpdELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKltncsglesiSSSIFKLKSLKSIVISHCSNfkrfleipsgntdgstRIERLASsnlcmfkslkyleivdcqnfkrlpdelgnlkVLKRLtidgtairevPKSLSQLAILRWLKLtncsglgrisssifklkslksieisncsnfkrflkipscnidggtrIERLASFKLRLDLCMVKnltslkiidcqkfkrlpneignskCLTVLIVKGtairevpeslgqlssLESLVLSNNKLERLPESFNQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLSIDLRYCLkldsnelseivkggwmkqsfdgnigiaksmyfpgneipkwf
lvnlkeidlsgsesltklpdlsraenLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCKSLTSLPTGIHSKYLKILNLWGCSNLNNFPEITSCHICIFELAEVGIKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKSIVISHCSNFKrfleipsgntdgsTRIERLASSNLCMFKSLKYLEIVDCQNFKrlpdelgnlkvlkrltidgtairevpkslSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLtslkiidcqkfkrlpneignskCLTVLIVKGTAIREVPESLGQLSSLESLVLSNNKLERLPESFNQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLSIDLRYCLKLDSNELSEIVKGGWMKQSFDGNIGIAKsmyfpgneipkwf
LVNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCKSLTSLPTGIHSKYLKILNLWGCSNLNNFPEITSCHICIFELAEVGIKELPSSIECLSNLRELLIMDCselesisssifklkslksivisHCSNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGlesisssifklkslksivisHCSNFKRFLEIPSGNTDGSTRIERLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRisssifklkslksieisNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLKIIDCQKFKRLPNEIGNSKCLTVLIVKGTAIREVPEslgqlssleslvlsNNKLERLPESFNQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLSIDLRYCLKLDSNELSEIVKGGWMKQSFDGNIGIAKSMYFPGNEIPKWF
************************ENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCKSLTSLPTGIHSKYLKILNLWGCSNLNNFPEITSCHICIFELAEVGIKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSGNTDGSTRIERLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLKIIDCQKFKRLPNEIGNSKCLTVLIVKGTAIREVPESLGQL**LESLVL**********SFNQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLSIDLRYCLKLDSNELSEIVKGGWMKQSFDGNIGIAKSMYFPG*******
LVNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCKSLTSLPTGIHSKYLKILNLWGCSNLNNFPEITSCHICIFELAEVGIKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSGNTDGSTRIERLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLKIIDCQKFKRLPNEIGNSKCLTVLIVKGTAIREVPESLGQLSSLESLVLSNNKLERLPESFNQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLSIDLRYCLKL***********************IAKSMYFPGNEIPKWF
LVNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCKSLTSLPTGIHSKYLKILNLWGCSNLNNFPEITSCHICIFELAEVGIKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSGNTDGSTRIERLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLKIIDCQKFKRLPNEIGNSKCLTVLIVKGTAIREVPESLGQLSSLESLVLSNNKLERLPESFNQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLSIDLRYCLKLDSNELSEIVKGGWMKQSFDGNIGIAKSMYFPGNEIPKWF
*VNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCKSLTSLPTGIHSKYLKILNLWGCSNLNNFPEITSCHICIFELAEVGIKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSGNTDGSTRIERLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLKIIDCQKFKRLPNEIGNSKCLTVLIVKGTAIREVPESLGQLSSLESLVLSNNKLERLPESFNQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLSIDLRYCLKLDSNELSEIVKGGWMKQSFDGNIGIAKSMYFPGNEIPKWF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LVNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCKSLTSLPTGIHSKYLKILNLWGCSNLNNFPEITSCHICIFELAEVGIKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSGNTDGSTRIERLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLKIIDCQKFKRLPNEIGNSKCLTVLIVKGTAIREVPESLGQLSSLESLVLSNNKLERLPESFNQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLSIDLRYCLKLDSNELSEIVKGGWMKQSFDGNIGIAKSMYFPGNEIPKWF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query602 2.2.26 [Sep-21-2011]
O235301301 Protein SUPPRESSOR OF npr no no 0.739 0.342 0.279 4e-29
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.730 0.429 0.274 2e-20
B0W6M9628 Leucine-rich repeat prote N/A no 0.639 0.613 0.252 2e-18
Q9SZ671895 Probable WRKY transcripti no no 0.259 0.082 0.414 1e-17
Q403921144 TMV resistance protein N N/A no 0.446 0.235 0.331 1e-17
Q9V780 849 Protein lap1 OS=Drosophil yes no 0.468 0.332 0.270 3e-17
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.541 0.176 0.249 4e-15
Q80TH2 1402 Protein LAP2 OS=Mus muscu yes no 0.544 0.233 0.262 6e-15
B4LXW1614 Leucine-rich repeat prote N/A no 0.629 0.617 0.248 7e-15
Q4R6F0863 Leucine-rich repeat and d N/A no 0.772 0.538 0.248 8e-15
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function desciption
 Score =  130 bits (326), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 152/544 (27%), Positives = 245/544 (45%), Gaps = 99/544 (18%)

Query: 1    LVNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCK 60
            L +LKE++L  S +L ++PDLS A NL+ L L  C SL    SSIQ   KL +L +  CK
Sbjct: 612  LGSLKEMNLRYSNNLKEIPDLSLAINLEELDLVGCKSLVTLPSSIQNATKLIYLDMSDCK 671

Query: 61   SLTSLPTGIHSKYLKILNLWGCSNLNNFPEI-TSCHICIFELAEVGI--------KELPS 111
             L S PT ++ + L+ LNL GC NL NFP I   C    F      I        K LP+
Sbjct: 672  KLESFPTDLNLESLEYLNLTGCPNLRNFPAIKMGCSDVDFPEGRNEIVVEDCFWNKNLPA 731

Query: 112  SIECLSNLRE------------LLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLE 159
             ++ L  L               L +   + E +   I  L SL+ + +S   N     E
Sbjct: 732  GLDYLDCLTRCMPCEFRPEQLAFLNVRGYKHEKLWEGIQSLGSLEGMDLSESENLT---E 788

Query: 160  IPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLC 219
            IP  +    T +E L      L  C S  +LP  + +   L  +++  C  +E LP+ + 
Sbjct: 789  IPDLSK--ATKLESLI-----LNNCKSLVTLPSTIGNLHRLVRLEMKECTGLEVLPTDVN 841

Query: 220  MFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNC 279
            +  SL +L++  C + +  P    N+  L    ++ TAI E+P ++G L  L RL++  C
Sbjct: 842  L-SSLETLDLSGCSSLRSFPLISTNIVWLY---LENTAIEEIPSTIGNLHRLVRLEMKKC 897

Query: 280  SGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSGNTD---GSTRIERLASSNLCMFKS 336
            +GLE + + +  L SL+++ +S CS+ + F  I          +T IE +   +L    +
Sbjct: 898  TGLEVLPTDV-NLSSLETLDLSGCSSLRSFPLISESIKWLYLENTAIEEIP--DLSKATN 954

Query: 337  LKYLEIVDCQNFKRLPDELGNLKVLKR--------------------------------- 363
            LK L++ +C++   LP  +GNL+ L                                   
Sbjct: 955  LKNLKLNNCKSLVTLPTTIGNLQKLVSFEMKECTGLEVLPIDVNLSSLMILDLSGCSSLR 1014

Query: 364  -----------LTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIE 412
                       L ++ TAI E+P ++  L  L  L++  C+GL  + + +  L SL  ++
Sbjct: 1015 TFPLISTNIVWLYLENTAIEEIPSTIGNLHRLVKLEMKECTGLEVLPTDV-NLSSLMILD 1073

Query: 413  ISNCSNFKRFLKIPSCNIDGGTRIE--RLASFKLRLDLCMVKNLTSLKIID---CQKFKR 467
            +S CS+ + F  I        TRIE   L +  +    C +++ T L ++    CQ+ K 
Sbjct: 1074 LSGCSSLRTFPLI-------STRIECLYLQNTAIEEVPCCIEDFTRLTVLMMYCCQRLKT 1126

Query: 468  L-PN 470
            + PN
Sbjct: 1127 ISPN 1130
Disease resistance protein of the TIR-NB-LRR-type. Part of the RPP5 locus that contains a cluster of several paralogous disease resistance (R) genes. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Regulated by RNA silencing. Expression regulated by MOS1 at chromatin level. Negatively regulated at the transcript level by BON1.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 Back     alignment and function description
>sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
359493406 1351 PREDICTED: TMV resistance protein N-like 0.833 0.371 0.323 8e-57
147862827 1454 hypothetical protein VITISV_024045 [Viti 0.833 0.345 0.323 9e-57
359493402 1186 PREDICTED: TMV resistance protein N-like 0.790 0.401 0.332 3e-53
359493394 1327 PREDICTED: TMV resistance protein N-like 0.805 0.365 0.327 3e-51
147821370 1386 hypothetical protein VITISV_013693 [Viti 0.808 0.351 0.324 1e-50
359493398 1327 PREDICTED: TMV resistance protein N-like 0.820 0.372 0.312 1e-48
147802252 1441 hypothetical protein VITISV_020931 [Viti 0.780 0.326 0.310 2e-46
359486100 1535 PREDICTED: TMV resistance protein N-like 0.843 0.330 0.296 3e-46
359495250 1427 PREDICTED: TMV resistance protein N-like 0.915 0.386 0.292 5e-46
224094841491 predicted protein [Populus trichocarpa] 0.754 0.924 0.321 8e-46
>gi|359493406|ref|XP_002279885.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  228 bits (581), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 200/619 (32%), Positives = 297/619 (47%), Gaps = 117/619 (18%)

Query: 1    LVNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCK 60
            L  LK IDLS S+ L K+P  S   NL+ L L+ C+SL E H SI  L +L +L L  C+
Sbjct: 529  LGKLKVIDLSDSKQLVKMPKFSSMPNLERLNLEGCISLRELHLSIGDLKRLTYLNLGGCE 588

Query: 61   SLTSLPTGIHSKYLKILNLWGCSNLNNFPEITS--CHICIFELAEVGIKELPSSIECLSN 118
             L S P G+  + L++L L  C NL  FP+I     H+    L +  IKELPSSI  L++
Sbjct: 589  QLQSFPPGMKFESLEVLYLDRCQNLKKFPKIHGNMGHLKELYLNKSEIKELPSSIVYLAS 648

Query: 119  LRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFK 178
            L  L + +CS LE        +K L+ + +  CS F++F       +D  T +E L    
Sbjct: 649  LEVLNLSNCSNLEKFPEIHGNMKFLRELHLEGCSKFEKF-------SDTFTYMEHLRGLH 701

Query: 179  LKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRL 238
            L   G                           I+ LPSS+   +SL  L++  C  F++ 
Sbjct: 702  LGESG---------------------------IKELPSSIGYLESLEILDLSYCSKFEKF 734

Query: 239  PDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNC------------------- 279
            P+  GN+K L+ L +D TAI+E+P S+G L  L  L L  C                   
Sbjct: 735  PEIKGNMKCLKELYLDNTAIKELPNSMGSLTSLEILSLKECLKFEKFSDIFTNMGLLREL 794

Query: 280  ----SGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSGNTD-------GSTRIERLAS 328
                SG++ + +SI  L+SL+ + +S+CSNF++F EI  GN          +T I+ L +
Sbjct: 795  YLRESGIKELPNSIGYLESLEILNLSYCSNFQKFPEI-QGNLKCLKELCLENTAIKELPN 853

Query: 329  SNLCMFKSLKYLEIVDCQNFKRLPD-ELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWL 387
               C+ ++L+ L +  C NF+R P+ ++G L     L +D T I+E+P S+  L  L+WL
Sbjct: 854  GIGCL-QALESLALSGCSNFERFPEIQMGKLWA---LFLDETPIKELPCSIGHLTRLKWL 909

Query: 388  KLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLD 447
             L NC  L  + +SI  LKSL+ + ++ CSN + F +I          +ERL    LR  
Sbjct: 910  DLENCRNLRSLPNSICGLKSLERLSLNGCSNLEAFSEITE-------DMERLEHLFLRET 962

Query: 448  --------LCMVKNLTSLKIIDCQKFKRLPNEIGNSKCLTVLIVKG-TAIR--------- 489
                    +  ++ L SL++I+C+    LPN IG+  CLT L V+  T +R         
Sbjct: 963  GITELPSLIGHLRGLESLELINCENLVALPNSIGSLTCLTTLRVRNCTKLRNLPDNLRSL 1022

Query: 490  -----------------EVPESLGQLSSLESLVLSNNKLERLPESFNQLSSLEYLQLFEN 532
                             E+P  L  LS L SL +S N +  +P    QLS L+   LF N
Sbjct: 1023 QCCLLWLDLGGCNLMEGEIPSDLWCLSLLVSLDVSENHIRCIPAGITQLSKLK--ALFMN 1080

Query: 533  SLEGIPEYLRSLPSKLTSL 551
                + E +  +PS LT +
Sbjct: 1081 HCPMLEE-IGEVPSSLTVM 1098

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147862827|emb|CAN78931.1| hypothetical protein VITISV_024045 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493402|ref|XP_002279700.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493394|ref|XP_002279512.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147821370|emb|CAN67940.1| hypothetical protein VITISV_013693 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493398|ref|XP_003634586.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147802252|emb|CAN68265.1| hypothetical protein VITISV_020931 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486100|ref|XP_002274578.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495250|ref|XP_002271616.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224094841|ref|XP_002334784.1| predicted protein [Populus trichocarpa] gi|222874625|gb|EEF11756.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query602
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.609 0.185 0.297 6.7e-29
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.622 0.289 0.289 1.6e-26
TAIR|locus:21292361301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.609 0.282 0.289 8.2e-25
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.724 0.280 0.269 8.1e-20
TAIR|locus:21704881205 AT5G46260 [Arabidopsis thalian 0.202 0.101 0.451 1.2e-21
TAIR|locus:2174900968 AT5G40060 [Arabidopsis thalian 0.563 0.350 0.293 3.8e-21
TAIR|locus:21158701234 AT4G08450 [Arabidopsis thalian 0.380 0.185 0.323 9.3e-21
TAIR|locus:21515061127 RPS6 "RESISTANT TO P. SYRINGAE 0.330 0.176 0.333 1.8e-19
TAIR|locus:21514911123 AT5G46450 [Arabidopsis thalian 0.408 0.219 0.323 5.1e-19
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.443 0.224 0.327 3.2e-18
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 342 (125.4 bits), Expect = 6.7e-29, Sum P(2) = 6.7e-29
 Identities = 119/400 (29%), Positives = 190/400 (47%)

Query:     1 LVNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCK 60
             L NLK +DLS S SL +LPDLS A NL+ L L  C+SL +  S +  L KL+ L L  C 
Sbjct:   663 LRNLKWMDLSYSISLKELPDLSTATNLEELILKYCVSLVKVPSCVGKLGKLQVLCLHGCT 722

Query:    61 SLTSLPTGIHSKY-LKILNLWGCSNLNNFPEITSCHICI--FELAEVGIKELPSSIECLS 117
             S+  LP+   +   L+ L+L  CS+L   P      I +   +L  + + +LP SI   +
Sbjct:   723 SILELPSFTKNVTGLQSLDLNECSSLVELPSSIGNAINLQNLDLGCLRLLKLPLSIVKFT 782

Query:   118 NLRELLIMDCXXXXXXXXXXXXXXXXXXXXXXHCSNFKRFLEIPSCNTDGCTGIERLASF 177
             NL++ ++  C                      +CS+    +E+PS +      ++ L   
Sbjct:   783 NLKKFILNGCSSLVELPFMGNATNLQNLDLG-NCSSL---VELPS-SIGNAINLQNL--- 834

Query:   178 KLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKR 237
                L  CSS   LP  + +  +L  + +  C ++  +P+S+    +L  L++  C +   
Sbjct:   835 --DLSNCSSLVKLPSFIGNATNLEILDLRKCSSLVEIPTSIGHVTNLWRLDLSGCSSLVE 892

Query:   238 LPDELGNLKALQRLTVDRTA-IREVPESLGQLAILRRLKLTNCSGXXXXXXXXXXXXXXX 296
             LP  +GN+  LQ L +   + + ++P S G    L RL L+ CS                
Sbjct:   893 LPSSVGNISELQVLNLHNCSNLVKLPSSFGHATNLWRLDLSGCSSLVELPSSIGNITNLQ 952

Query:   297 XXXXXHCSNFKRFLEIPS--GN-----TDGSTRIERLAS--SNLCMFKSLKYLEIVDCQN 347
                  +CSN    +++PS  GN     T    R ++L +  SN+ + KSL+ L++ DC  
Sbjct:   953 ELNLCNCSNL---VKLPSSIGNLHLLFTLSLARCQKLEALPSNINL-KSLERLDLTDCSQ 1008

Query:   348 FKRLPDELGNLKVLKRLTIDGTAIREVP---KSLSQLAIL 384
             FK  P+   N++ L    +DGTA+ EVP   KS S+L +L
Sbjct:  1009 FKSFPEISTNIECLY---LDGTAVEEVPSSIKSWSRLTVL 1045
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170488 AT5G46260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174900 AT5G40060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151506 RPS6 "RESISTANT TO P. SYRINGAE 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151491 AT5G46450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00007023001
SubName- Full=Chromosome chr13 scaffold_181, whole genome shotgun sequence; (1237 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
PLN032101153 PLN03210, PLN03210, Resistant to P 5e-39
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-20
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-07
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-05
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-04
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.002
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  153 bits (388), Expect = 5e-39
 Identities = 116/349 (33%), Positives = 180/349 (51%), Gaps = 39/349 (11%)

Query: 1   LVNLKEIDLSGSESLTKLPDLSRAENLKILRLDDCLSLTETHSSIQYLNKLEFLTLEMCK 60
           L  L+ IDL GS++L ++PDLS A NL+ L+L DC SL E  SSIQYLNKLE L +  C+
Sbjct: 633 LTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCE 692

Query: 61  SLTSLPTGIHSKYLKILNLWGCSNLNNFPEITSCHICIFELAEVGIKELPSSIECLSNLR 120
           +L  LPTGI+ K L  LNL GCS L +FP+I S +I   +L E  I+E PS++  L NL 
Sbjct: 693 NLEILPTGINLKSLYRLNLSGCSRLKSFPDI-STNISWLDLDETAIEEFPSNLR-LENLD 750

Query: 121 ELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFKLK 180
           EL++      E  S  +++     + +++  S        PS               +L 
Sbjct: 751 ELIL-----CEMKSEKLWERVQPLTPLMTMLS--------PSLT-------------RLF 784

Query: 181 LEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFKRLPD 240
           L    S   LP ++ +   L  ++I +C N+E+LP+ +   +SL SL++  C   +  PD
Sbjct: 785 LSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPD 843

Query: 241 ELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKSIVI 300
              N   +  L + RT I EVP  + + + L  L +  C+ L+ +S +I KLK L+++  
Sbjct: 844 ISTN---ISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDF 900

Query: 301 SHCSNFKRFLEIPSGNTDGSTRIERLASSNL-CMFKSLKYLEIVDCQNF 348
           S C        +   + +GS     +A+ N+     S   +  ++C N 
Sbjct: 901 SDCG------ALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNL 943

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 602
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.95
PLN032101153 Resistant to P. syringae 6; Provisional 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.8
KOG4237498 consensus Extracellular matrix protein slit, conta 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.13
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.93
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.92
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.89
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
PLN03150623 hypothetical protein; Provisional 98.81
KOG4341483 consensus F-box protein containing LRR [General fu 98.8
PLN03150623 hypothetical protein; Provisional 98.59
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.58
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.54
KOG4341483 consensus F-box protein containing LRR [General fu 98.53
PRK15386 426 type III secretion protein GogB; Provisional 98.47
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.47
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.46
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.45
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.37
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.29
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
PRK15386 426 type III secretion protein GogB; Provisional 98.07
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.98
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.91
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.84
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.73
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.67
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.51
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.35
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.31
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.92
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.71
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.7
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.64
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.25
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.21
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.2
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.19
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.52
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.39
smart0037026 LRR Leucine-rich repeats, outliers. 94.18
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.18
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.9
KOG4308 478 consensus LRR-containing protein [Function unknown 93.49
KOG4308 478 consensus LRR-containing protein [Function unknown 92.59
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.24
smart0037026 LRR Leucine-rich repeats, outliers. 92.24
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.88
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.08
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.06
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.38
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.23
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.86
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-51  Score=467.03  Aligned_cols=505  Identities=22%  Similarity=0.294  Sum_probs=444.2

Q ss_pred             CCCcEEecCCCCcCcCCcc-ccCCCCCcEEEcCCCcchhcchhhhc-cCCCCcEEeccCCccccCCCCccCccccceecc
Q 044748            2 VNLKEIDLSGSESLTKLPD-LSRAENLKILRLDDCLSLTETHSSIQ-YLNKLEFLTLEMCKSLTSLPTGIHSKYLKILNL   79 (602)
Q Consensus         2 ~~L~~L~l~~~~~~~~~~~-~~~l~~L~~L~Ls~~~~~~~~~~~~~-~~~~L~~L~l~~~~~~~~l~~~~~~~~L~~L~l   79 (602)
                      .++++|+|+++.+.+.++. |..+++|++|+|++|.+.+.+|..+. .+++|++|++++|...+.+|.. .+++|++|++
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~-~l~~L~~L~L  147 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG-SIPNLETLDL  147 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCcc-ccCCCCEEEC
Confidence            3688999999987777777 99999999999999998888887655 8999999999999766666643 6889999999


Q ss_pred             cCCCCCCCCcccccccccchhccccc---cccCCccccCcccCceEecccccccccccccccccCCccEEEeeCCCCccc
Q 044748           80 WGCSNLNNFPEITSCHICIFELAEVG---IKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKR  156 (602)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~L~~L~l~~---~~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~  156 (602)
                      ++|.+.+.+|..++.+++|++|++++   .+.+|..++++++|++|++++|.+.+.+|..+..+++|++|++++|.+...
T Consensus       148 s~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~  227 (968)
T PLN00113        148 SNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGE  227 (968)
T ss_pred             cCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCc
Confidence            99998889999999999999999988   568899999999999999999988888999999999999999999998888


Q ss_pred             cccCCCCCCCCCcCcccceeeecccCCCCCCccccccccCCCCCcccccccCCCCcccccchhccccccEEeeeccCCCc
Q 044748          157 FLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMFKSLTSLEIVDCQNFK  236 (602)
Q Consensus       157 ~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~  236 (602)
                      .|       ..+..+++|++|++++  +.....+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|.+.+
T Consensus       228 ~p-------~~l~~l~~L~~L~L~~--n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~  298 (968)
T PLN00113        228 IP-------YEIGGLTSLNHLDLVY--NNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSG  298 (968)
T ss_pred             CC-------hhHhcCCCCCEEECcC--ceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeecc
Confidence            88       8899999999999998  34445788889999999999999999989999999999999999999999988


Q ss_pred             cCCcccCCCCCCcEEEcCccccc-cccccccccccccEEeecCCCCccccccccccCCCCcEEEeecCCCccccccCCCC
Q 044748          237 RLPDELGNLKALQRLTVDRTAIR-EVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSG  315 (602)
Q Consensus       237 ~~~~~~~~l~~L~~L~l~~n~l~-~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~  315 (602)
                      .+|..+..+++|+.|++++|.+. .+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|.. +        
T Consensus       299 ~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l-~--------  369 (968)
T PLN00113        299 EIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNL-T--------  369 (968)
T ss_pred             CCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCee-E--------
Confidence            99999999999999999999887 6777789999999999999998888999999999999999998632 2        


Q ss_pred             CCCCCcchhccccccccCCCcccEEEEecCCCCccCCccccCCCCccEEEecCcccc-cCCccccccccCcEEeccCCCC
Q 044748          316 NTDGSTRIERLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIR-EVPKSLSQLAILRWLKLTNCSG  394 (602)
Q Consensus       316 ~~~~~~~~~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~i~-~l~~~~~~l~~L~~L~l~~~~~  394 (602)
                              +.++..+.. +++|+.+++++|.+.+.+|..+..+++|+.|++++|.++ .+|..+..+++|+.+++++|.+
T Consensus       370 --------~~~p~~~~~-~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l  440 (968)
T PLN00113        370 --------GEIPEGLCS-SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNL  440 (968)
T ss_pred             --------eeCChhHhC-cCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcc
Confidence                    133443333 788999999999988889988999999999999999998 6788888999999999999999


Q ss_pred             CCccCccccCCCCCCeEEeccCCCccccccCCCCCCCCCcchhhhhhhccccchhccCCCCeEEeeccccccCCChhhhC
Q 044748          395 LGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLKIIDCQKFKRLPNEIGN  474 (602)
Q Consensus       395 ~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~  474 (602)
                      .+.++..+..+++|++|++++|.+.+.+|.                      .+ ..++|+.|++++|.+.+..|..+..
T Consensus       441 ~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~----------------------~~-~~~~L~~L~ls~n~l~~~~~~~~~~  497 (968)
T PLN00113        441 QGRINSRKWDMPSLQMLSLARNKFFGGLPD----------------------SF-GSKRLENLDLSRNQFSGAVPRKLGS  497 (968)
T ss_pred             cCccChhhccCCCCcEEECcCceeeeecCc----------------------cc-ccccceEEECcCCccCCccChhhhh
Confidence            888888888999999999999988877765                      22 3468899999999988888888889


Q ss_pred             CcccceEeecCcccc-cCcccccCCCCCcEEEccCCcc-cccchhhhcCCCCceeecccccccC-Cchhhhccccccccc
Q 044748          475 SKCLTVLIVKGTAIR-EVPESLGQLSSLESLVLSNNKL-ERLPESFNQLSSLEYLQLFENSLEG-IPEYLRSLPSKLTSL  551 (602)
Q Consensus       475 ~~~L~~L~L~~n~l~-~l~~~~~~l~~L~~L~L~~n~l-~~l~~~l~~l~~L~~L~l~~N~l~~-~~~~l~~~~~~L~~L  551 (602)
                      +++|+.|++++|.+. .+|..+.++++|+.|++++|.+ +.+|..+..+++|+.|++++|++++ +|..+..++ +|+.+
T Consensus       498 l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~-~L~~l  576 (968)
T PLN00113        498 LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVE-SLVQV  576 (968)
T ss_pred             hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCc-ccCEE
Confidence            999999999999986 7788888899999999999998 5778888899999999999999987 888888776 88888


Q ss_pred             ccceeec
Q 044748          552 NLSIDLR  558 (602)
Q Consensus       552 ~l~~~~~  558 (602)
                      +++.|..
T Consensus       577 ~ls~N~l  583 (968)
T PLN00113        577 NISHNHL  583 (968)
T ss_pred             eccCCcc
Confidence            8876654

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query602
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-35
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-35
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-05
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  142 bits (360), Expect = 4e-38
 Identities = 67/418 (16%), Positives = 129/418 (30%), Gaps = 105/418 (25%)

Query: 112 SIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGI 171
                S    L     + L      + + +   +   +   +  R               
Sbjct: 7   HHHHSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANS----------- 55

Query: 172 ERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSL--CMFKSLTSLEI 229
                                      + P I+      +++    L         +LE+
Sbjct: 56  ---------------------------NNPQIETRTGRALKATADLLEDATQPGRVALEL 88

Query: 230 VDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSI 289
                  + PD+   L  LQ +T+D   + E+P+++ Q A L  L L     L ++ +SI
Sbjct: 89  RSVP-LPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNP-LRALPASI 146

Query: 290 FKLKSLKSIVISHCSNFKRFLEIPS--GNTDGSTRIERLASSNLCMFKSLKYLEIVDCQN 347
             L  L+ + I  C       E+P    +TD S   + L         +L+ L +     
Sbjct: 147 ASLNRLRELSIRACPELT---ELPEPLASTDASGEHQGL--------VNLQSLRLEWTG- 194

Query: 348 FKRLPDELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRISSSIFKLKS 407
            + LP  + NL+ LK L I  + +  +  ++  L  L  L L  C+ L            
Sbjct: 195 IRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAP 254

Query: 408 LKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLKIIDCQKFKR 467
           LK + + +CSN                                                 
Sbjct: 255 LKRLILKDCSN----------------------------------------------LLT 268

Query: 468 LPNEIGNSKCLTVLIVKG-TAIREVPESLGQLSSLESLVLSNNKLERLPESFNQLSSL 524
           LP +I     L  L ++G   +  +P  + QL +   +++  +   +L +  ++  + 
Sbjct: 269 LPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQAQLDQ--HRPVAR 324
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query602
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.77
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.64
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.52
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.5
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.46
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.45
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.43
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.4
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.23
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.1
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.0
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.0
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.94
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.85
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.8
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.18
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.15
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-56  Score=491.42  Aligned_cols=536  Identities=20%  Similarity=0.177  Sum_probs=325.4

Q ss_pred             CCCcEEecCCCCcCcCCcc-ccCCCCCcEEEcCCCcchhcchh--hhccCCCCcEEeccCCccccCCCCcc--Cccccce
Q 044748            2 VNLKEIDLSGSESLTKLPD-LSRAENLKILRLDDCLSLTETHS--SIQYLNKLEFLTLEMCKSLTSLPTGI--HSKYLKI   76 (602)
Q Consensus         2 ~~L~~L~l~~~~~~~~~~~-~~~l~~L~~L~Ls~~~~~~~~~~--~~~~~~~L~~L~l~~~~~~~~l~~~~--~~~~L~~   76 (602)
                      ++|+.++++.+.+ ..++. +..+++|++|+|++|.+.+.+|.  .++.+++|++|++++|......|..+  .+++|++
T Consensus        77 ~~L~~l~~~~~~~-~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~  155 (768)
T 3rgz_A           77 TGLESLFLSNSHI-NGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEV  155 (768)
T ss_dssp             TTCCEEECTTSCE-EECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSE
T ss_pred             CcccccCCcCCCc-CCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCE
Confidence            5667777777753 23445 88889999999999888887887  88888999999999886666666655  7888888


Q ss_pred             ecccCCCCCCCCccc---ccccccchhccccc--cccCCccccCcccCceEecccccccccccccccccCCccEEEeeCC
Q 044748           77 LNLWGCSNLNNFPEI---TSCHICIFELAEVG--IKELPSSIECLSNLRELLIMDCSELESISSSIFKLKSLKSIVISHC  151 (602)
Q Consensus        77 L~l~~~~~~~~~~~~---~~~~~~L~~L~l~~--~~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~  151 (602)
                      |++++|.+.+..+..   +.++++|++|++++  +.... .+..+++|++|++++|.+.+.+|. +..+++|++|++++|
T Consensus       156 L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~-~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n  233 (768)
T 3rgz_A          156 LDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDV-DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGN  233 (768)
T ss_dssp             EECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCC-BCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSS
T ss_pred             EECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccC-CcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCC
Confidence            888888877666665   66777777777777  22221 136677777777777766655555 677777777777777


Q ss_pred             CCccccccCCCCCCCCCcCcccceeeecccCCCCCCccccccccCCCCCcccccccCCCCcccccchhcc-ccccEEeee
Q 044748          152 SNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSSLCMF-KSLTSLEIV  230 (602)
Q Consensus       152 ~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~-~~L~~L~l~  230 (602)
                      .+....|       ..+..+++|++|+++++  .....+|..  .+++|++|++++|.+.+.+|..+... ++|++|+++
T Consensus       234 ~l~~~~~-------~~l~~l~~L~~L~Ls~n--~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls  302 (768)
T 3rgz_A          234 KLSGDFS-------RAISTCTELKLLNISSN--QFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLS  302 (768)
T ss_dssp             CCCSCHH-------HHTTTCSSCCEEECCSS--CCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECC
T ss_pred             cCCCccc-------HHHhcCCCCCEEECCCC--cccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECc
Confidence            7666666       56667777777777762  222233332  55666666666666655666555443 666666666


Q ss_pred             ccCCCccCCcccCCCCCCcEEEcCccccc-ccccc-ccccccccEEeecCCCCccccccccccCC-CCcEEEeecCCCcc
Q 044748          231 DCQNFKRLPDELGNLKALQRLTVDRTAIR-EVPES-LGQLAILRRLKLTNCSGLESISSSIFKLK-SLKSIVISHCSNFK  307 (602)
Q Consensus       231 ~~~~~~~~~~~~~~l~~L~~L~l~~n~l~-~l~~~-~~~l~~L~~L~l~~~~~~~~~~~~~~~l~-~L~~L~l~~~~~~~  307 (602)
                      +|.+.+.+|..+..+++|+.|++++|.++ .+|.. +..+++|+.|++++|.+.+.+|..+..++ +|++|++++|....
T Consensus       303 ~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~  382 (768)
T 3rgz_A          303 GNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG  382 (768)
T ss_dssp             SSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEE
T ss_pred             CCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCC
Confidence            66666666666666666666666666665 55544 55666666666666655555555555554 66666666542111


Q ss_pred             cccc---------CCCCCCCCCcchh-ccccccccCCCcccEEEEecCCCCccCCccccCCCCccEEEecCcccc-cCCc
Q 044748          308 RFLE---------IPSGNTDGSTRIE-RLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIR-EVPK  376 (602)
Q Consensus       308 ~~~~---------~~~~~~~~~~~~~-~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~i~-~l~~  376 (602)
                      ....         +..... ..+.+. .+|..+ ..+++|++|++++|.+.+..|..+..+++|++|++++|.++ .+|.
T Consensus       383 ~~~~~~~~~~~~~L~~L~L-~~n~l~~~~p~~l-~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~  460 (768)
T 3rgz_A          383 PILPNLCQNPKNTLQELYL-QNNGFTGKIPPTL-SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ  460 (768)
T ss_dssp             ECCTTTTCSTTCCCCEEEC-CSSEEEEECCGGG-GGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCG
T ss_pred             CcChhhhhcccCCccEEEC-CCCccccccCHHH-hcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCH
Confidence            0000         000000 111122 222222 23666666666666666666666666666666666666666 5555


Q ss_pred             cccccccCcEEeccCCCCCCccCccccCCCCCCeEEeccCCCccccccCCCCCCCCCcchhhhhhhccccchhccCCCCe
Q 044748          377 SLSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTS  456 (602)
Q Consensus       377 ~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~L~~  456 (602)
                      .+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+.+.+|.                      .+..+++|+.
T Consensus       461 ~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~----------------------~~~~l~~L~~  518 (768)
T 3rgz_A          461 ELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPK----------------------WIGRLENLAI  518 (768)
T ss_dssp             GGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCG----------------------GGGGCTTCCE
T ss_pred             HHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCCh----------------------HHhcCCCCCE
Confidence            666666666666666666666666666666666666666666655554                      4455555555


Q ss_pred             EEeeccccccCCChhhhCCcccceEeecCcccc-cCccc-----------------------------------------
Q 044748          457 LKIIDCQKFKRLPNEIGNSKCLTVLIVKGTAIR-EVPES-----------------------------------------  494 (602)
Q Consensus       457 L~l~~~~~~~~~~~~l~~~~~L~~L~L~~n~l~-~l~~~-----------------------------------------  494 (602)
                      |++++|.+.+.+|..+..+++|++|++++|.++ .+|..                                         
T Consensus       519 L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  598 (768)
T 3rgz_A          519 LKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQG  598 (768)
T ss_dssp             EECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTT
T ss_pred             EECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccccccccccccccc
Confidence            555555555555555555555555555555553 33322                                         


Q ss_pred             -----------------------------ccCCCCCcEEEccCCcc-cccchhhhcCCCCceeecccccccC-Cchhhhc
Q 044748          495 -----------------------------LGQLSSLESLVLSNNKL-ERLPESFNQLSSLEYLQLFENSLEG-IPEYLRS  543 (602)
Q Consensus       495 -----------------------------~~~l~~L~~L~L~~n~l-~~l~~~l~~l~~L~~L~l~~N~l~~-~~~~l~~  543 (602)
                                                   +..+++|+.||+++|++ +.+|..+..+++|+.|++++|++++ +|+.+..
T Consensus       599 ~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~  678 (768)
T 3rgz_A          599 IRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGD  678 (768)
T ss_dssp             CCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGG
T ss_pred             ccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhC
Confidence                                         22234555666666665 3555556666666666666666654 5555555


Q ss_pred             cccccccccccee---------eccccccccccchhhhhhcc
Q 044748          544 LPSKLTSLNLSID---------LRYCLKLDSNELSEIVKGGW  576 (602)
Q Consensus       544 ~~~~L~~L~l~~~---------~~~~~~L~~~~l~~~~~~~~  576 (602)
                      ++ +|+.||++.|         +..++.|+.+++++|.+.+-
T Consensus       679 L~-~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~  719 (768)
T 3rgz_A          679 LR-GLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGP  719 (768)
T ss_dssp             CT-TCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEE
T ss_pred             CC-CCCEEECCCCcccCcCChHHhCCCCCCEEECcCCccccc
Confidence            55 5666665533         22344555555555555443
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 602
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]

 Score = 58.3 bits (139), Expect = 8e-10
 Identities = 48/336 (14%), Positives = 96/336 (28%), Gaps = 18/336 (5%)

Query: 219 CMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTN 278
           C+ +    LE+ +      LP+   +L   + L     ++ E+PE    L     +   N
Sbjct: 35  CLDRQAHELELNNL-GLSSLPELPPHL---ESLVASCNSLTELPELPQSL-KSLLVDNNN 89

Query: 279 CSGLESISSSIFKLKSLKSIVISHCSNFKRFLEIPSGNTDGSTRIERLASSNLCMFKSLK 338
              L  +   +  L    + +                  + S +       +L    +  
Sbjct: 90  LKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGN 149

Query: 339 YLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIREVPKSLSQLAILRWLKLTNCSGLGRI 398
                  +                   +    +           +    +L N   L  I
Sbjct: 150 NQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTI 209

Query: 399 SSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSLK 458
            +    LK+L  +  S  +   R   +        +      S  +   L  +       
Sbjct: 210 YADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYL 269

Query: 459 IIDCQKFKRLPNEIGNSKCLTVLIVKGTAIREVPESLGQLSSLESLVLSNNKLERLPESF 518
                + + L +   +   L  L V    + E+P        LE L+ S N L  +PE  
Sbjct: 270 NASSNEIRSLCDLPPS---LEELNVSNNKLIELPALPP---RLERLIASFNHLAEVPEL- 322

Query: 519 NQLSSLEYLQLFENSLEGIPEYLRSLPSKLTSLNLS 554
               +L+ L +  N L   P+    +P  +  L ++
Sbjct: 323 --PQNLKQLHVEYNPLREFPD----IPESVEDLRMN 352
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query602
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.69
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.36
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.36
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.83
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.97
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.94  E-value=6.7e-25  Score=219.72  Aligned_cols=343  Identities=22%  Similarity=0.264  Sum_probs=231.7

Q ss_pred             cccCCccEEEeeCCCCccccccCCCCCCCCCcCcccceeeecccCCCCCCccccccccCCCCCcccccccCCCCcccccc
Q 044748          138 FKLKSLKSIVISHCSNFKRFLEIPSCNTDGCTGIERLASFKLKLEGCSSPQSLPINMFSFKSLPSIKIIHCPNIESLPSS  217 (602)
Q Consensus       138 ~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~  217 (602)
                      ..+.+|++|+++++.+...         ..++.+++|++|++++   +.++.++. +..+++|++|++++|.+.+..  .
T Consensus        41 ~~l~~l~~L~l~~~~I~~l---------~gl~~L~nL~~L~Ls~---N~l~~l~~-l~~L~~L~~L~L~~n~i~~i~--~  105 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSI---------DGVEYLNNLTQINFSN---NQLTDITP-LKNLTKLVDILMNNNQIADIT--P  105 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCC---------TTGGGCTTCCEEECCS---SCCCCCGG-GTTCTTCCEEECCSSCCCCCG--G
T ss_pred             HHhCCCCEEECCCCCCCCc---------cccccCCCCCEEeCcC---CcCCCCcc-ccCCccccccccccccccccc--c
Confidence            3466788888888766532         4566777888888877   34555543 666777777777777655432  2


Q ss_pred             hhccccccEEeeeccCCCccCCcccCCCCCCcEEEcCccccccccccccccccccEEeecCCCCccccccccccCCCCcE
Q 044748          218 LCMFKSLTSLEIVDCQNFKRLPDELGNLKALQRLTVDRTAIREVPESLGQLAILRRLKLTNCSGLESISSSIFKLKSLKS  297 (602)
Q Consensus       218 l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~n~l~~l~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~  297 (602)
                      +..+++|+.|++.++...+..+  ......+.......+.+..+.... .....+....... .  .....+...+....
T Consensus       106 l~~l~~L~~L~~~~~~~~~~~~--~~~~~~~~~~~~~~~~l~~~~~~~-~~~~~~~~~~~~~-~--~~~~~~~~~~~~~~  179 (384)
T d2omza2         106 LANLTNLTGLTLFNNQITDIDP--LKNLTNLNRLELSSNTISDISALS-GLTSLQQLSFGNQ-V--TDLKPLANLTTLER  179 (384)
T ss_dssp             GTTCTTCCEEECCSSCCCCCGG--GTTCTTCSEEEEEEEEECCCGGGT-TCTTCSEEEEEES-C--CCCGGGTTCTTCCE
T ss_pred             cccccccccccccccccccccc--cccccccccccccccccccccccc-ccccccccccccc-c--chhhhhcccccccc
Confidence            5667777777776665544322  233445556666555554332211 1111111111110 0  01112222233333


Q ss_pred             EEeecCCCccccccCCCCCCCCCcchhccccccccCCCcccEEEEecCCCCccCCccccCCCCccEEEecCcccccCCcc
Q 044748          298 IVISHCSNFKRFLEIPSGNTDGSTRIERLASSNLCMFKSLKYLEIVDCQNFKRLPDELGNLKVLKRLTIDGTAIREVPKS  377 (602)
Q Consensus       298 L~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~i~~l~~~  377 (602)
                      .....+.                    .........+++++.+++++|.+.+..+  ...+++|+++++++|.++.++ .
T Consensus       180 ~~~~~~~--------------------~~~~~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~~-~  236 (384)
T d2omza2         180 LDISSNK--------------------VSDISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDIG-T  236 (384)
T ss_dssp             EECCSSC--------------------CCCCGGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCCG-G
T ss_pred             ccccccc--------------------cccccccccccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCcc-h
Confidence            3333221                    1111222337889999999988665443  566789999999999999876 5


Q ss_pred             ccccccCcEEeccCCCCCCccCccccCCCCCCeEEeccCCCccccccCCCCCCCCCcchhhhhhhccccchhccCCCCeE
Q 044748          378 LSQLAILRWLKLTNCSGLGRISSSIFKLKSLKSIEISNCSNFKRFLKIPSCNIDGGTRIERLASFKLRLDLCMVKNLTSL  457 (602)
Q Consensus       378 ~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~L~~L  457 (602)
                      +..+++|+.+++.+|.+.+..  .+..+++|++++++++.+.+..                        .+..++.++.+
T Consensus       237 l~~l~~L~~L~l~~n~l~~~~--~~~~~~~L~~L~l~~~~l~~~~------------------------~~~~~~~l~~l  290 (384)
T d2omza2         237 LASLTNLTDLDLANNQISNLA--PLSGLTKLTELKLGANQISNIS------------------------PLAGLTALTNL  290 (384)
T ss_dssp             GGGCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECCSSCCCCCG------------------------GGTTCTTCSEE
T ss_pred             hhcccccchhccccCccCCCC--cccccccCCEeeccCcccCCCC------------------------ccccccccccc
Confidence            788999999999999776533  3678999999999998765432                        34567788999


Q ss_pred             EeeccccccCCChhhhCCcccceEeecCcccccCcccccCCCCCcEEEccCCcccccchhhhcCCCCceeecccccccCC
Q 044748          458 KIIDCQKFKRLPNEIGNSKCLTVLIVKGTAIREVPESLGQLSSLESLVLSNNKLERLPESFNQLSSLEYLQLFENSLEGI  537 (602)
Q Consensus       458 ~l~~~~~~~~~~~~l~~~~~L~~L~L~~n~l~~l~~~~~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~l~~N~l~~~  537 (602)
                      .+..|.+.+.  ..+..+++++.|++++|+++.++ .+..+++|++|++++|+|+.++ .+..+++|++|++++|+++++
T Consensus       291 ~~~~n~l~~~--~~~~~~~~l~~L~ls~n~l~~l~-~l~~l~~L~~L~L~~n~l~~l~-~l~~l~~L~~L~l~~N~l~~l  366 (384)
T d2omza2         291 ELNENQLEDI--SPISNLKNLTYLTLYFNNISDIS-PVSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDL  366 (384)
T ss_dssp             ECCSSCCSCC--GGGGGCTTCSEEECCSSCCSCCG-GGGGCTTCCEEECCSSCCCCCG-GGGGCTTCCEEECCSSCCCBC
T ss_pred             cccccccccc--cccchhcccCeEECCCCCCCCCc-ccccCCCCCEEECCCCCCCCCh-hHcCCCCCCEEECCCCcCCCC
Confidence            9998876552  34788899999999999999886 4889999999999999999887 588999999999999999997


Q ss_pred             chhhhccccccccccccee
Q 044748          538 PEYLRSLPSKLTSLNLSID  556 (602)
Q Consensus       538 ~~~l~~~~~~L~~L~l~~~  556 (602)
                      ++ +..++ +|++|+++.|
T Consensus       367 ~~-l~~l~-~L~~L~L~~N  383 (384)
T d2omza2         367 TP-LANLT-RITQLGLNDQ  383 (384)
T ss_dssp             GG-GTTCT-TCSEEECCCE
T ss_pred             hh-hccCC-CCCEeeCCCC
Confidence            64 66676 8888888765
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure