Citrus Sinensis ID: 044749

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
MRQDLTVQQMSEDDDRSPPLDLRCGAAPSINKARNCSGEAVSGSGSSTSSSIPASVPVTVTEYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDRARGRFRRVRSVVLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKPVICNCHKLQIFGPSIQYVMKDFRPWLQRAKNFVNFGFFL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHccccccEEEEcccccccccccccccccccccHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHcccccEEEccccccccccccHHcccccccccccEEEEccccccccHHHHHHHHHHcccccEEEccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHcccccHHccccccccHHHHHHHccccccccEEEcccccccHHHHHHHHHccccccEEcccccccccccHHHHHHHcccccccccc
ccccccHHHHccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHcccccEEEEcccccccHccccccccccccHHHHHHHHHHcccccEEEccEEEEcHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHcccccEEEEEEcEccccccHHHHHHccccccEEEEEEEcccccccHHHHHHHHHccccccEEEEcccccHHHHHHHHHHcHHHHHHcccccccccccccccccHHHHHHHHHHcHHHHHHcccHcccHHHHHHHHHHHHHccEEEccccccccHHHHHHHHHcccHHEEEccccEEHccHHHHHHHccccccccccc
mrqdltvqqmsedddrsppldlrcgaapsinkarncsgeavsgsgsstsssipasvpvtvteyqsqypDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAealtrselfigncyavspdrargrfRRVRSVVLkgkprfadfnlmppdwgahfgpWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCcegfgtcglAFIASKCRQLRVLDLIETevtddevdwislfpegetcLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVrapqlthlgtgkygpsevaqrqgdtepDYIAAFAACKSLVCLsgfreitpdYLSAIYPVCanltslnfsyatitadqlkpvicnchklqifgpsIQYVMKDFRPWLQRAKNfvnfgffl
mrqdltvqqmsedddrspplDLRCGAAPSINKARNCSGEavsgsgsstsssiPASVPVTVTEYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRaealtrselfigncyavspdrargrfrrvrsvvlkgkprfadFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVarspflrklrlnRHVSIRQLYRLMVRAPQlthlgtgkygpsevAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKPVICNCHKLQIFGPSIQYVMKDFRPWLQRAKNFVNFGFFL
MRQDLTVQQMSEDDDRSPPLDLRCGAAPSINKARNCsgeavsgsgsstsssipasvpvtvtEYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDrargrfrrvrsvvLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKPVICNCHKLQIFGPSIQYVMKDFRPWLQRAKNFVNFGFFL
*********************************************************VTVTEYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDRARGRFRRVRSVVLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTHLGTGKY*************PDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKPVICNCHKLQIFGPSIQYVMKDFRPWLQRAKNFVNFGFF*
******************************************************************YPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDRARGRFRRVRSVVLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKPVICNCHKLQIFGPSIQYVMKDFRPWLQRAKNFVNFGFFL
******************PLDLRCGAAPSINKAR********************SVPVTVTEYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDRARGRFRRVRSVVLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTHLGTGKYG*********DTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKPVICNCHKLQIFGPSIQYVMKDFRPWLQRAKNFVNFGFFL
****************************************************************SQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDRARGRFRRVRSVVLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKPVICNCHKLQIFGPSIQYVMKDFRPWLQRAKNFVNFGFFL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRQDLTVQQMSEDDDRSPPLDLRCGAAPSINKARNCSGEAVSGSGSSTSSSIPASVPVTVTEYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDRARGRFRRVRSVVLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKPVICNCHKLQIFGPSIQYVMKDFRPWLQRAKNFVNFGFFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query413 2.2.26 [Sep-21-2011]
Q9LTX2 619 Transport inhibitor respo yes no 0.864 0.576 0.659 1e-141
Q8RWQ8 623 F-box protein FBX14 OS=Ar no no 0.765 0.507 0.729 1e-136
Q570C0 594 Protein TRANSPORT INHIBIT no no 0.743 0.516 0.501 1e-81
Q9LW29 575 Protein AUXIN SIGNALING F no no 0.743 0.533 0.493 2e-78
Q7XVM8 575 Transport inhibitor respo no no 0.743 0.533 0.483 4e-76
Q9LPW7 577 Protein AUXIN SIGNALING F no no 0.733 0.525 0.481 4e-76
Q9ZR12 585 GRR1-like protein 1 OS=Ar no no 0.738 0.521 0.482 3e-75
Q2R3K5 568 Transport inhibitor respo no no 0.731 0.531 0.451 6e-65
Q0DKP3 587 Transport inhibitor respo no no 0.745 0.524 0.462 3e-57
O04197 592 Coronatine-insensitive pr no no 0.731 0.510 0.290 2e-33
>sp|Q9LTX2|TIR1L_ARATH Transport inhibitor response 1-like protein OS=Arabidopsis thaliana GN=At5g49980 PE=1 SV=1 Back     alignment and function desciption
 Score =  503 bits (1295), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 260/394 (65%), Positives = 302/394 (76%), Gaps = 37/394 (9%)

Query: 1   MRQDLTVQQMSEDDD--RSPPLDLR-------CGAAPSINKARNCSGEAVSGSGSSTSSS 51
           M QD +  +MSEDDD  +SPPLDL        C ++ S NK+RNC    +S S +     
Sbjct: 1   MTQDRS--EMSEDDDDQQSPPLDLPSTAIADPCSSSSSPNKSRNC----ISNSQT----- 49

Query: 52  IPASVPVTVTEYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELF 111
                          +PD VLE VLENVLQFL SR DRNAASLVCKSWWR EALTRSE+F
Sbjct: 50  ---------------FPDHVLENVLENVLQFLDSRCDRNAASLVCKSWWRVEALTRSEVF 94

Query: 112 IGNCYAVSPDRARGRFRRVRSVVLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEK 171
           IGNCYA+SP R   RF+RVRS+VLKGKPRFADFNLMPPDWGA+F PWV  +A AYP LEK
Sbjct: 95  IGNCYALSPARLTQRFKRVRSLVLKGKPRFADFNLMPPDWGANFAPWVSTMAQAYPCLEK 154

Query: 172 VYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVT 231
           V LKRM +TDDDLALLA+SF GFKEL LVCCEGFGT G++ +A+KCR+L+VLDLIE+EVT
Sbjct: 155 VDLKRMFVTDDDLALLADSFPGFKELILVCCEGFGTSGISIVANKCRKLKVLDLIESEVT 214

Query: 232 DDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYR 291
           DDEVDWIS FPE  TCLESL FDCV+  INF+ALE LVARSPFL+KLRLNR VS+ +L+R
Sbjct: 215 DDEVDWISCFPEDVTCLESLAFDCVEAPINFKALEGLVARSPFLKKLRLNRFVSLVELHR 274

Query: 292 LMVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIY 351
           L++ APQLT LGTG +   E  + Q + EPDY AAF ACKS+VCLSGFRE+ P+YL AI+
Sbjct: 275 LLLGAPQLTSLGTGSFSHDE--EPQSEQEPDYAAAFRACKSVVCLSGFRELMPEYLPAIF 332

Query: 352 PVCANLTSLNFSYATITADQLKPVICNCHKLQIF 385
           PVCANLTSLNFSYA I+ D  KP+I NCHKLQ+F
Sbjct: 333 PVCANLTSLNFSYANISPDMFKPIILNCHKLQVF 366

Arabidopsis thaliana (taxid: 3702)
>sp|Q8RWQ8|FBX14_ARATH F-box protein FBX14 OS=Arabidopsis thaliana GN=FBX14 PE=2 SV=1 Back     alignment and function description
>sp|Q570C0|TIR1_ARATH Protein TRANSPORT INHIBITOR RESPONSE 1 OS=Arabidopsis thaliana GN=TIR1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LW29|AFB2_ARATH Protein AUXIN SIGNALING F-BOX 2 OS=Arabidopsis thaliana GN=AFB2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XVM8|TIR1B_ORYSJ Transport inhibitor response 1-like protein Os04g0395600 OS=Oryza sativa subsp. japonica GN=Os04g0395600 PE=2 SV=1 Back     alignment and function description
>sp|Q9LPW7|AFB3_ARATH Protein AUXIN SIGNALING F-BOX 3 OS=Arabidopsis thaliana GN=AFB3 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZR12|GRH1_ARATH GRR1-like protein 1 OS=Arabidopsis thaliana GN=GRH1 PE=1 SV=1 Back     alignment and function description
>sp|Q2R3K5|TIRC_ORYSJ Transport inhibitor response 1-like protein Os11g0515500 OS=Oryza sativa subsp. japonica GN=Os11g0515500 PE=2 SV=1 Back     alignment and function description
>sp|Q0DKP3|TIR1A_ORYSJ Transport inhibitor response 1-like protein Os05g0150500 OS=Oryza sativa subsp. japonica GN=Os05g0150500 PE=2 SV=2 Back     alignment and function description
>sp|O04197|COI1_ARATH Coronatine-insensitive protein 1 OS=Arabidopsis thaliana GN=COI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
224082031 635 f-box family protein [Populus trichocarp 0.881 0.573 0.723 1e-155
13249030 635 F-box containing protein TIR1 [Populus t 0.886 0.576 0.711 1e-153
255545892 635 TRANSPORT INHIBITOR RESPONSE 1 protein, 0.789 0.513 0.788 1e-152
224067017 635 f-box family protein [Populus trichocarp 0.886 0.576 0.719 1e-151
359492916 601 PREDICTED: transport inhibitor response 0.791 0.544 0.801 1e-151
449436966 626 PREDICTED: transport inhibitor response 0.859 0.567 0.669 1e-143
449497026 637 PREDICTED: transport inhibitor response 0.886 0.574 0.648 1e-141
297795767 608 auxin F-box protein 5 [Arabidopsis lyrat 0.847 0.575 0.669 1e-140
18423092 619 transport inhibitor response 1-like prot 0.864 0.576 0.659 1e-140
449437292 623 PREDICTED: transport inhibitor response 0.842 0.558 0.675 1e-137
>gi|224082031|ref|XP_002306554.1| f-box family protein [Populus trichocarpa] gi|222856003|gb|EEE93550.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 280/387 (72%), Positives = 314/387 (81%), Gaps = 23/387 (5%)

Query: 1   MRQDLTVQQMSEDDDRSPPLDLRCGAAPSINKARNCSGEAVSGSGSSTSSSIPASVPVTV 60
           MR D T  +MSEDDDRSPP       + SI    + +     G GS +SS         V
Sbjct: 17  MRDDRT--EMSEDDDRSPP-------SNSITHDSSPTRTCTPGPGSGSSS---------V 58

Query: 61  TEYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSP 120
            EY + YPDQVLE VLENVL FLTSR+DRNAASLVC+SW+R EALTRS+LFIGNCYAVSP
Sbjct: 59  PEYLAPYPDQVLENVLENVLWFLTSRKDRNAASLVCRSWYRVEALTRSDLFIGNCYAVSP 118

Query: 121 DRARGRFRRVRSVVLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSIT 180
            RA  RF R+RSV LKGKPRFADFNLMPP+WGAHF PWV  +A  YPWLEKV+LKRMS+T
Sbjct: 119 KRAMSRFTRIRSVTLKGKPRFADFNLMPPNWGAHFAPWVSAMAMTYPWLEKVHLKRMSVT 178

Query: 181 DDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISL 240
           DDDLALLAESFSGFKEL LVCC+GFGT GLA + S+CRQL+VLDLIE+EV+DDEVDWIS 
Sbjct: 179 DDDLALLAESFSGFKELVLVCCDGFGTSGLAIVVSRCRQLKVLDLIESEVSDDEVDWISC 238

Query: 241 FPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLT 300
           FP+ ETCLESLIFDCVDC I+F+ALE+LVARSP L+KLRLNR+VSI QLYRLMVRAP LT
Sbjct: 239 FPDTETCLESLIFDCVDCPIDFDALERLVARSPSLKKLRLNRYVSIGQLYRLMVRAPHLT 298

Query: 301 HLGTGKYGPSE-VAQ-RQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLT 358
           HLGTG + PSE VAQ  QG   PDY +AFAACKSLVCLSGFRE+ PDYL AI PVCANLT
Sbjct: 299 HLGTGSFSPSEDVAQVEQG---PDYASAFAACKSLVCLSGFRELIPDYLPAINPVCANLT 355

Query: 359 SLNFSYATITADQLKPVICNCHKLQIF 385
           SLNFSYA ++A+QLKP+I NCHKLQIF
Sbjct: 356 SLNFSYAEVSAEQLKPIISNCHKLQIF 382

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|13249030|gb|AAK16647.1|AF139835_1 F-box containing protein TIR1 [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|255545892|ref|XP_002514006.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] gi|223547092|gb|EEF48589.1| TRANSPORT INHIBITOR RESPONSE 1 protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224067017|ref|XP_002302328.1| f-box family protein [Populus trichocarpa] gi|222844054|gb|EEE81601.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359492916|ref|XP_002283927.2| PREDICTED: transport inhibitor response 1-like protein [Vitis vinifera] gi|147845617|emb|CAN80598.1| hypothetical protein VITISV_002642 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436966|ref|XP_004136263.1| PREDICTED: transport inhibitor response 1-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449497026|ref|XP_004160292.1| PREDICTED: transport inhibitor response 1-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297795767|ref|XP_002865768.1| auxin F-box protein 5 [Arabidopsis lyrata subsp. lyrata] gi|297311603|gb|EFH42027.1| auxin F-box protein 5 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18423092|ref|NP_568718.1| transport inhibitor response 1-like protein [Arabidopsis thaliana] gi|75180501|sp|Q9LTX2.1|TIR1L_ARATH RecName: Full=Transport inhibitor response 1-like protein; Short=TIR1-like protein gi|8777429|dbj|BAA97019.1| transport inhibitor response 1 protein [Arabidopsis thaliana] gi|15912307|gb|AAL08287.1| AT5g49980/K9P8_12 [Arabidopsis thaliana] gi|22655002|gb|AAM98092.1| AT5g49980/K9P8_12 [Arabidopsis thaliana] gi|28416503|gb|AAO42782.1| AT5g49980/K9P8_12 [Arabidopsis thaliana] gi|332008497|gb|AED95880.1| transport inhibitor response 1-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449437292|ref|XP_004136426.1| PREDICTED: transport inhibitor response 1-like protein-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
UNIPROTKB|B9RJT7 635 RCOM_1038590 "TRANSPORT INHIBI 0.784 0.510 0.768 2.1e-141
UNIPROTKB|B9H6Y0 635 FBL8 "F-box family protein" [P 0.866 0.563 0.691 4.7e-135
UNIPROTKB|B9GV20 635 FBL7 "F-box family protein" [P 0.866 0.563 0.692 1.6e-134
UNIPROTKB|A5AZ08 601 VITISV_002642 "Putative unchar 0.782 0.537 0.774 3.3e-134
UNIPROTKB|Q9AUH6 635 TIR1 "F-box containing protein 0.866 0.563 0.683 1.8e-133
TAIR|locus:2158824 619 AFB5 "AT5G49980" [Arabidopsis 0.767 0.512 0.714 7.9e-129
TAIR|locus:2135942 623 AFB4 "AT4G24390" [Arabidopsis 0.765 0.507 0.704 9.5e-121
UNIPROTKB|B9S3W2 585 RCOM_0556140 "TRANSPORT INHIBI 0.753 0.531 0.482 2.4e-76
UNIPROTKB|B9IBT6 584 FBL2 "F-box family protein" [P 0.743 0.525 0.479 2.7e-75
UNIPROTKB|B9I9W7 584 FBL1 "F-box family protein" [P 0.743 0.525 0.482 4e-74
UNIPROTKB|B9RJT7 RCOM_1038590 "TRANSPORT INHIBITOR RESPONSE 1 protein, putative" [Ricinus communis (taxid:3988)] Back     alignment and assigned GO terms
 Score = 1337 (475.7 bits), Expect = 2.1e-141, Sum P(2) = 2.1e-141
 Identities = 249/324 (76%), Positives = 276/324 (85%)

Query:    62 EYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPD 121
             +YQ+ YPDQVLE VLENVL FLTSRRDRNAASLVCKSW+R EALTRSELFIGNCYAVS  
Sbjct:    59 DYQAPYPDQVLENVLENVLCFLTSRRDRNAASLVCKSWYRVEALTRSELFIGNCYAVSTR 118

Query:   122 XXXXXXXXXXXXXLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITD 181
                          LKGKPRFADFNLMPP+WGAHF PWV  +  AYPWLEKV+LKRM++TD
Sbjct:   119 RATCRFTRIKSVTLKGKPRFADFNLMPPNWGAHFAPWVTTMGKAYPWLEKVHLKRMTVTD 178

Query:   182 DDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLF 241
             DDLALLAESFSGFKEL LVCC+GFGT GLA +AS+CRQLRVLDLIE+EV DDEVDWIS F
Sbjct:   179 DDLALLAESFSGFKELVLVCCDGFGTSGLAIVASRCRQLRVLDLIESEVADDEVDWISCF 238

Query:   242 PEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTH 301
             PE E CLESLIFDCV+C+INF+ALE+LVARSP L+K+RLNR+VS+ QLYRLM+RAPQLTH
Sbjct:   239 PESEMCLESLIFDCVECSINFDALERLVARSPSLKKIRLNRYVSVSQLYRLMIRAPQLTH 298

Query:   302 LGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLN 361
             LGTG + PS+ A  QG+ EPDY +AFAACKSLVCLSGF+EI  DYL AIYPVCANL SLN
Sbjct:   299 LGTGSFRPSDDAAAQGEQEPDYASAFAACKSLVCLSGFKEILSDYLPAIYPVCANLNSLN 358

Query:   362 FSYATITADQLKPVICNCHKLQIF 385
              SYA ITADQLKP+I NCHKLQ F
Sbjct:   359 LSYANITADQLKPIISNCHKLQTF 382
GO:0000822 "inositol hexakisphosphate binding" evidence=ISS
GO:0009734 "auxin mediated signaling pathway" evidence=ISS
UNIPROTKB|B9H6Y0 FBL8 "F-box family protein" [Populus trichocarpa (taxid:3694)] Back     alignment and assigned GO terms
UNIPROTKB|B9GV20 FBL7 "F-box family protein" [Populus trichocarpa (taxid:3694)] Back     alignment and assigned GO terms
UNIPROTKB|A5AZ08 VITISV_002642 "Putative uncharacterized protein" [Vitis vinifera (taxid:29760)] Back     alignment and assigned GO terms
UNIPROTKB|Q9AUH6 TIR1 "F-box containing protein TIR1" [Populus tremula x Populus tremuloides (taxid:47664)] Back     alignment and assigned GO terms
TAIR|locus:2158824 AFB5 "AT5G49980" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135942 AFB4 "AT4G24390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B9S3W2 RCOM_0556140 "TRANSPORT INHIBITOR RESPONSE 1 protein, putative" [Ricinus communis (taxid:3988)] Back     alignment and assigned GO terms
UNIPROTKB|B9IBT6 FBL2 "F-box family protein" [Populus trichocarpa (taxid:3694)] Back     alignment and assigned GO terms
UNIPROTKB|B9I9W7 FBL1 "F-box family protein" [Populus trichocarpa (taxid:3694)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
FBL8
f-box family protein (664 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 413
KOG4341483 consensus F-box protein containing LRR [General fu 99.95
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.93
KOG4341483 consensus F-box protein containing LRR [General fu 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.51
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.48
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.47
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.44
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.4
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.35
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.32
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.32
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.99
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.92
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.8
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.76
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.73
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.71
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.67
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.66
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.63
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.49
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.49
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.2
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.18
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.14
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.11
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.1
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.02
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.97
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.87
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.84
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.73
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.7
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.69
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.46
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.43
KOG4308 478 consensus LRR-containing protein [Function unknown 97.34
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.27
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.09
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.07
KOG4308 478 consensus LRR-containing protein [Function unknown 96.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 96.8
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.74
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.56
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.52
KOG4237 498 consensus Extracellular matrix protein slit, conta 96.51
KOG0281499 consensus Beta-TrCP (transducin repeats containing 96.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.23
KOG0617264 consensus Ras suppressor protein (contains leucine 96.22
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 96.19
PLN03150623 hypothetical protein; Provisional 96.15
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.79
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.77
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 95.43
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.24
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.11
KOG0617264 consensus Ras suppressor protein (contains leucine 95.06
KOG2997366 consensus F-box protein FBX9 [General function pre 94.84
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 94.82
PRK15386 426 type III secretion protein GogB; Provisional 94.63
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.52
PLN03150623 hypothetical protein; Provisional 94.48
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 93.83
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.67
KOG0472565 consensus Leucine-rich repeat protein [Function un 92.94
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.82
KOG4237498 consensus Extracellular matrix protein slit, conta 92.69
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 92.42
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 92.06
PRK15386 426 type III secretion protein GogB; Provisional 91.66
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 91.39
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 90.33
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 89.1
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.38
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 88.29
PF13013109 F-box-like_2: F-box-like domain 87.94
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 87.11
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 82.25
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 81.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 80.26
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information 
Probab=99.95  E-value=4.8e-28  Score=217.35  Aligned_cols=303  Identities=20%  Similarity=0.281  Sum_probs=239.2

Q ss_pred             cCCCCcchHHHHHHHHHhhcCCcchhhHHHHHhHHHHHhhcCC--CCeEEeccc----ccCChhHHHhcCC-CccEEEec
Q 044749           64 QSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALT--RSELFIGNC----YAVSPDRARGRFR-RVRSVVLK  136 (413)
Q Consensus        64 ~~~LP~e~~~~il~~Ifs~L~~~~d~~~~~~vcr~W~~~~~~~--~~~l~~~~~----~~~~~~~l~~~~~-~l~~l~l~  136 (413)
                      ...||.|    ++..||++| +.+.+++++.+|+.|+..+.+.  |.++.....    .......+..|+. .++.+.+.
T Consensus        72 ~~~LPpE----l~lkvFS~L-Dtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~LSlr  146 (483)
T KOG4341|consen   72 SRSLPPE----LLLKVFSML-DTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKELSLR  146 (483)
T ss_pred             cccCCHH----HHHHHHHHH-hHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCCcceehHhhhhcccccccccc
Confidence            3469999    999999999 6999999999999999876543  222222211    1112244555553 67788888


Q ss_pred             CCCCCcccCCCCCCCCCCchHHHHHHHhhCCCCcEEeeeCC-ccCHHHHHHHHHhCCCCcEEEeCCCCCCChHHHHHHHH
Q 044749          137 GKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRM-SITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIAS  215 (413)
Q Consensus       137 ~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~-~l~~~~l~~l~~~~~~L~~L~L~~c~~~~~~~l~~~~~  215 (413)
                      |+....             ...+..+...||+++.|++.++ .++|..+..+++.|++|+.|.|..|..+++..+..++.
T Consensus       147 G~r~v~-------------~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~  213 (483)
T KOG4341|consen  147 GCRAVG-------------DSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAE  213 (483)
T ss_pred             ccccCC-------------cchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHH
Confidence            765433             3445567779999999999999 89999999999999999999999999999999999999


Q ss_pred             hCCcCcEEEccccc-cccccchhhhccCccCCCcceEEeccccCCCCHHHHHHHHHhCCCCcEEEcccccCh--HHHHHH
Q 044749          216 KCRQLRVLDLIETE-VTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSI--RQLYRL  292 (413)
Q Consensus       216 ~~~~L~~L~L~~~~-i~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~--~~l~~l  292 (413)
                      .|++|+.|++++|. |++.+   +..+..+|..++.+.+.||. ...++.+..+...++-+.++++.+|..+  .++..+
T Consensus       214 gC~kL~~lNlSwc~qi~~~g---v~~~~rG~~~l~~~~~kGC~-e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i  289 (483)
T KOG4341|consen  214 GCRKLKYLNLSWCPQISGNG---VQALQRGCKELEKLSLKGCL-ELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLI  289 (483)
T ss_pred             hhhhHHHhhhccCchhhcCc---chHHhccchhhhhhhhcccc-cccHHHHHHHhccChHhhccchhhhccccchHHHHH
Confidence            99999999999997 88888   88888899999999999997 7788888888888888888888787433  355666


Q ss_pred             HhcCCCCceecccCcCCCcccccCCCChhhHHHHHhhCCCccccc--CCcccChhhHhhHhhcCCCCCEEEeeccc-CCh
Q 044749          293 MVRAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLS--GFREITPDYLSAIYPVCANLTSLNFSYAT-ITA  369 (413)
Q Consensus       293 l~~~p~L~~L~l~~~~~~~~~~~~g~~~~~~~~~~~~~~~L~~L~--~~~~i~~~~l~~l~~~~~~L~~L~Ls~~~-it~  369 (413)
                      -..|..|+.|..++....        .+..+....+++.+|+.|.  +|..+++.++..+..+|+.|+.|++..|. +++
T Consensus       290 ~~~c~~lq~l~~s~~t~~--------~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d  361 (483)
T KOG4341|consen  290 ACGCHALQVLCYSSCTDI--------TDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITD  361 (483)
T ss_pred             hhhhhHhhhhcccCCCCC--------chHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehh
Confidence            667888888887643322        3455555666788888877  88888888888888888888888888888 777


Q ss_pred             hhHHHHHhcCCCCCEEEeecccccCCC
Q 044749          370 DQLKPVICNCHKLQIFGPSIQYVMKDF  396 (413)
Q Consensus       370 ~~l~~l~~~~~~L~~L~l~~c~~i~d~  396 (413)
                      ..+..+..+|+.|+.|.++.|+.|+|.
T Consensus       362 ~tL~sls~~C~~lr~lslshce~itD~  388 (483)
T KOG4341|consen  362 GTLASLSRNCPRLRVLSLSHCELITDE  388 (483)
T ss_pred             hhHhhhccCCchhccCChhhhhhhhhh
Confidence            778888888888888888888888774

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
2p1m_B 594 Tir1-ask1 Complex Structure Length = 594 1e-78
3ogk_B 592 Structure Of Coi1-Ask1 In Complex With Coronatine A 6e-31
>pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594 Back     alignment and structure 
Iteration: 1

 Score =  290 bits (742), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 195/311 (62%), Gaps = 4/311 (1%)
Query: 73  EIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDXXXXXXXXXXX 132
           E VLE+V  F+   +DRN+ SLVCKSW+  E   R ++FIGNCYAVSP            
Sbjct: 11  EEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRS 70
Query: 133 XXLKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFS 192
             LKGKP FADFNL+P  WG +  PW+  ++++Y WLE++ LKRM +TDD L L+A+SF 
Sbjct: 71  VELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFK 130
Query: 193 GFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLI 252
            FK L L  CEGF T GLA IA+ CR L+ LDL E++V D    W+S FP+  T L SL 
Sbjct: 131 NFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLN 190
Query: 253 FDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTHLGTGKYGPSEV 312
             C+   ++F ALE+LV R P L+ L+LNR V + +L  L+ RAPQL  LGTG Y     
Sbjct: 191 ISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGY----T 246
Query: 313 AQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQL 372
           A+ + D       A + CK L CLSGF +  P YL A+Y VC+ LT+LN SYAT+ +  L
Sbjct: 247 AEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDL 306
Query: 373 KPVICNCHKLQ 383
             ++C C KLQ
Sbjct: 307 VKLLCQCPKLQ 317
>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-90
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-13
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 7e-13
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
 Score =  283 bits (725), Expect = 3e-90
 Identities = 155/309 (50%), Positives = 201/309 (65%), Gaps = 4/309 (1%)

Query: 75  VLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDRARGRFRRVRSVV 134
           VLE+V  F+   +DRN+ SLVCKSW+  E   R ++FIGNCYAVSP     RF +VRSV 
Sbjct: 13  VLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVE 72

Query: 135 LKGKPRFADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGF 194
           LKGKP FADFNL+P  WG +  PW+  ++++Y WLE++ LKRM +TDD L L+A+SF  F
Sbjct: 73  LKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNF 132

Query: 195 KELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFD 254
           K L L  CEGF T GLA IA+ CR L+ LDL E++V D    W+S FP+  T L SL   
Sbjct: 133 KVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNIS 192

Query: 255 CVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLTHLGTGKYGPSEVAQ 314
           C+   ++F ALE+LV R P L+ L+LNR V + +L  L+ RAPQL  LGTG Y     A+
Sbjct: 193 CLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGY----TAE 248

Query: 315 RQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKP 374
            + D       A + CK L CLSGF +  P YL A+Y VC+ LT+LN SYAT+ +  L  
Sbjct: 249 VRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVK 308

Query: 375 VICNCHKLQ 383
           ++C C KLQ
Sbjct: 309 LLCQCPKLQ 317
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 100.0
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 100.0
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.75
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.66
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.63
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.45
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.44
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.41
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.35
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.2
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.19
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.11
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.1
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.1
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.1
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.1
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.04
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.03
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.03
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.03
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.01
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.0
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.99
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.99
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.95
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.95
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.95
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.93
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.9
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.89
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.87
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.85
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.79
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.77
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.76
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.73
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.72
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.64
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.64
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.6
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.57
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.48
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.44
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.42
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.39
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.37
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.25
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.23
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.17
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.12
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.11
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.02
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.96
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.96
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.93
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.91
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.91
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 97.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.81
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.8
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.47
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.4
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.32
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.3
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 97.24
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.1
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.03
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.87
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.75
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.56
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 95.99
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 95.92
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 95.01
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 92.86
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 91.99
4gt6_A394 Cell surface protein; leucine rich repeats, putati 89.23
4gt6_A394 Cell surface protein; leucine rich repeats, putati 85.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 84.45
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
Probab=100.00  E-value=2.4e-37  Score=311.97  Aligned_cols=322  Identities=48%  Similarity=0.855  Sum_probs=264.6

Q ss_pred             ccccCCCCcchHHHHHHHHHhhcCCcchhhHHHHHhHHHHHhhcCCCCeEEecccccCChhHHHhcCCCccEEEecCCCC
Q 044749           61 TEYQSQYPDQVLEIVLENVLQFLTSRRDRNAASLVCKSWWRAEALTRSELFIGNCYAVSPDRARGRFRRVRSVVLKGKPR  140 (413)
Q Consensus        61 ~d~~~~LP~e~~~~il~~Ifs~L~~~~d~~~~~~vcr~W~~~~~~~~~~l~~~~~~~~~~~~l~~~~~~l~~l~l~~~~~  140 (413)
                      .|.++.||||    ||.+||+||++.+|+.++++|||+|+++..+.+..+.+.+++...+..+..+|++++.+++++++.
T Consensus         3 ~d~~~~LPde----vL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~   78 (594)
T 2p1m_B            3 KRIALSFPEE----VLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPH   78 (594)
T ss_dssp             -------CHH----HHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSCHHHHHHHCTTCCEEEEECSCG
T ss_pred             ccchhhCCHH----HHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccCHHHHHhhCCCceEEeccCCCc
Confidence            3778899999    999999999559999999999999999987888889998888888888999999999999999999


Q ss_pred             CcccCCCCCCCCCCchHHHHHHHhhCCCCcEEeeeCCccCHHHHHHHHHhCCCCcEEEeCCCCCCChHHHHHHHHhCCcC
Q 044749          141 FADFNLMPPDWGAHFGPWVCVLANAYPWLEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIASKCRQL  220 (413)
Q Consensus       141 ~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~l~~~~l~~l~~~~~~L~~L~L~~c~~~~~~~l~~~~~~~~~L  220 (413)
                      ..++.+.+..|++...+|+..+...+++|++|+|+++.+++..+..++..+++|++|+|.+|..++..++..+..+|++|
T Consensus        79 ~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~~l~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L  158 (594)
T 2p1m_B           79 FADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNL  158 (594)
T ss_dssp             GGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCHHHHHHHHHHCTTCCEEEEESCEEEEHHHHHHHHHHCTTC
T ss_pred             hhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEcHHHHHHHHHhCCCCcEEeCCCcCCCCHHHHHHHHHhCCCC
Confidence            98999999999999999999999999999999999999999999999988999999999999888888899999899999


Q ss_pred             cEEEccccccccccchhhhccCccCCCcceEEeccccCCCCHHHHHHHHHhCCCCcEEEcccccChHHHHHHHhcCCCCc
Q 044749          221 RVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARSPFLRKLRLNRHVSIRQLYRLMVRAPQLT  300 (413)
Q Consensus       221 ~~L~L~~~~i~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~l~~ll~~~p~L~  300 (413)
                      ++|+|++|.+++.+..++..+...+++|++|++.++...++...+..+...+++|++|++++|....++..++..+++|+
T Consensus       159 ~~L~L~~~~i~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~l~~~~~~~~~L~  238 (594)
T 2p1m_B          159 KELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLE  238 (594)
T ss_dssp             CEEECTTCEEECCCGGGGGGSCTTCCCCCEEECTTCCSCCCHHHHHHHHHHCTTCCEEECCTTSCHHHHHHHHHHCTTCS
T ss_pred             CEEeCcCCccCCcchHHHHHHhhcCCcCcEEEecccCCcCCHHHHHHHHHhCCCCcEEecCCCCcHHHHHHHHhcCCcce
Confidence            99999999999988888998988999999999999865688899999988899999999999977888888999999999


Q ss_pred             eecccCcCCCcccccCCCChhhHHHHHhhCCCcccccCCcccChhhHhhHhhcCCCCCEEEeecccCChhhHHHHHhcCC
Q 044749          301 HLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLSGFREITPDYLSAIYPVCANLTSLNFSYATITADQLKPVICNCH  380 (413)
Q Consensus       301 ~L~l~~~~~~~~~~~~g~~~~~~~~~~~~~~~L~~L~~~~~i~~~~l~~l~~~~~~L~~L~Ls~~~it~~~l~~l~~~~~  380 (413)
                      +|+++.+......    .....+...+..|++|+.|+++..+++..++.+...+++|++|+|++|.+++.++..++..|+
T Consensus       239 ~L~l~~~~~~~~~----~~~~~l~~~l~~~~~L~~Ls~~~~~~~~~l~~~~~~~~~L~~L~L~~~~l~~~~l~~~~~~~~  314 (594)
T 2p1m_B          239 ELGTGGYTAEVRP----DVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCP  314 (594)
T ss_dssp             EEECSBCCCCCCH----HHHHHHHHHHHTCTTCCEEECCBTCCGGGGGGGHHHHTTCCEEECTTCCCCHHHHHHHHTTCT
T ss_pred             EcccccccCccch----hhHHHHHHHHhcCCCcccccCCcccchhhHHHHHHhhCCCCEEEccCCCCCHHHHHHHHhcCC
Confidence            9998754321100    012233344566677776654445555566666556667777777766666666666666666


Q ss_pred             CCCEEEeecc
Q 044749          381 KLQIFGPSIQ  390 (413)
Q Consensus       381 ~L~~L~l~~c  390 (413)
                      +|++|++.+|
T Consensus       315 ~L~~L~l~~~  324 (594)
T 2p1m_B          315 KLQRLWVLDY  324 (594)
T ss_dssp             TCCEEEEEGG
T ss_pred             CcCEEeCcCc
Confidence            6666666666
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 413
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.3 bits (97), Expect = 8e-05
 Identities = 15/94 (15%), Positives = 30/94 (31%), Gaps = 5/94 (5%)

Query: 169 LEKVYLKRMSITDDDLALLAESFSGFKELTLVCCEGFGTCGLAFIAS---KCRQLRVLDL 225
           ++ + ++   ++D   A L       + + L  C G        I+S       L  L+L
Sbjct: 4   IQSLDIQCEELSDARWAELLPLLQQCQVVRLDDC-GLTEARCKDISSALRVNPALAELNL 62

Query: 226 IETEVTDDEVDWI-SLFPEGETCLESLIFDCVDC 258
              E+ D  V  +          ++ L       
Sbjct: 63  RSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCL 96

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.85
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.85
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.48
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.45
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.95
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.92
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.85
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.69
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.62
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.55
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.52
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.5
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.47
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.47
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.43
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.41
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.37
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.37
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.31
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.3
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.22
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.14
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.12
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.01
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.91
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.17
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.16
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.13
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.06
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 94.56
d2ifga3156 High affinity nerve growth factor receptor, N-term 94.46
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 94.11
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.85  E-value=1.6e-20  Score=168.76  Aligned_cols=183  Identities=17%  Similarity=0.204  Sum_probs=108.8

Q ss_pred             CCcEEEeCCCCCCChHHHHHHHHhCCcCcEEEccccccccccchhhhccCccCCCcceEEeccccCCCCHHHHHHHHHhC
Q 044749          193 GFKELTLVCCEGFGTCGLAFIASKCRQLRVLDLIETEVTDDEVDWISLFPEGETCLESLIFDCVDCAINFEALEKLVARS  272 (413)
Q Consensus       193 ~L~~L~L~~c~~~~~~~l~~~~~~~~~L~~L~L~~~~i~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~~~~~l~~l~~~~  272 (413)
                      +|++|++++| .++...+..+..+|++|++|+|+++.+++..   +..+. .+++|++|++++|. .+++.++..+...|
T Consensus        47 ~L~~LdLs~~-~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~---~~~l~-~~~~L~~L~Ls~c~-~itd~~l~~l~~~~  120 (284)
T d2astb2          47 RVQHMDLSNS-VIEVSTLHGILSQCSKLQNLSLEGLRLSDPI---VNTLA-KNSNLVRLNLSGCS-GFSEFALQTLLSSC  120 (284)
T ss_dssp             CCCEEECTTC-EECHHHHHHHHTTBCCCSEEECTTCBCCHHH---HHHHT-TCTTCSEEECTTCB-SCCHHHHHHHHHHC
T ss_pred             CCCEEECCCC-ccCHHHHHHHHHhCCCcccccccccCCCcHH---HHHHh-cCCCCcCccccccc-cccccccchhhHHH
Confidence            4666666666 5666666666666666666666666666555   22222 34466666666665 56666666666666


Q ss_pred             CCCcEEEcccccCh--HHHHHHHh-cCCCCceecccCcCCCcccccCCCChhhHHHHHhhCCCccccc--CCcccChhhH
Q 044749          273 PFLRKLRLNRHVSI--RQLYRLMV-RAPQLTHLGTGKYGPSEVAQRQGDTEPDYIAAFAACKSLVCLS--GFREITPDYL  347 (413)
Q Consensus       273 ~~L~~L~l~~~~~~--~~l~~ll~-~~p~L~~L~l~~~~~~~~~~~~g~~~~~~~~~~~~~~~L~~L~--~~~~i~~~~l  347 (413)
                      ++|++|++++|..+  .++...+. .+++|++|.+.++...       ..+..+......|++|+.|.  +|..+++..+
T Consensus       121 ~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~-------i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~  193 (284)
T d2astb2         121 SRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKN-------LQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCF  193 (284)
T ss_dssp             TTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGG-------SCHHHHHHHHHHCTTCSEEECTTCTTCCGGGG
T ss_pred             Hhccccccccccccccccchhhhcccccccchhhhcccccc-------cccccccccccccccccccccccccCCCchhh
Confidence            66666666666332  23333333 3566666666543221       23445555556666666666  5556666666


Q ss_pred             hhHhhcCCCCCEEEeeccc-CChhhHHHHHhcCCCCCEEEeecc
Q 044749          348 SAIYPVCANLTSLNFSYAT-ITADQLKPVICNCHKLQIFGPSIQ  390 (413)
Q Consensus       348 ~~l~~~~~~L~~L~Ls~~~-it~~~l~~l~~~~~~L~~L~l~~c  390 (413)
                      ..+. .+++|++|+|++|. ++++++..+ ..||+|+.|++.+|
T Consensus       194 ~~l~-~~~~L~~L~L~~C~~i~~~~l~~L-~~~~~L~~L~l~~~  235 (284)
T d2astb2         194 QEFF-QLNYLQHLSLSRCYDIIPETLLEL-GEIPTLKTLQVFGI  235 (284)
T ss_dssp             GGGG-GCTTCCEEECTTCTTCCGGGGGGG-GGCTTCCEEECTTS
T ss_pred             hhhc-ccCcCCEEECCCCCCCChHHHHHH-hcCCCCCEEeeeCC
Confidence            6653 46667777776665 666666553 45666777776666
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure