Citrus Sinensis ID: 044750

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------66
MAHAIVSSLLDQLKSIAQDQVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGGDNEFMRCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSLLNGQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENLLRLHLVFDGVVDGEGEEGRRKNEKDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCEHLPPLGKLPLEKLQLYILKSVKRVGNEFLGIEESSEDDPSSSSSSSSVTAFPKLKSLDIGGMEELEEWNYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQSTALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPNYLLRTTTLQELIIHRCPLLENRYREGEGEDWHKISHIPYIESEW
ccHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHccccccccccccccHHHHHHccccccccccccccccccccccccEEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEccHHHHHHHHHHHHHHEEEEEEccccccccccccccEEEEEEEEccccccccccccccccEEEEcccccccccccccHHHHccccccEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHccccccEEccccccccccccHHHHccccccEEEcccccccccccccccccccccccccEEEccccccccccccccccccccccEEEEEcccccccccHHHHccccccccccEEEEEEcccccccccccccccccHHHHHHccccccccccEEEEEcccccccccccccccccEEEEEccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccHHHHHHccccccccccccccccEEEcc
cHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHccHccccccccccHHHHHEcHccccccHHHHHHHHHHHcccccccEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEEEEEcccEccccHcccccccEEEEEccccccccccccHHHHHccccEEEEEEcccccccccccHHHHHcccccccccHcEEEEcccccccccccccccccccEEEEEcccHHHHHccHHHcccccccEEEEccccccccccccccccccccEEEEEEccccccccccccHHHHHcHHHcccEEEcccccccccHHHHHHcccccccccEEEEEccccccccccHccccccccHHHHHcccccccccEEEEEcccccccccccccccccEEEEEccccccccccccccccccEEEEcccccccEccHHHcccccccHcccccccccccccccccccEEEEcccccHHcccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccccHccccccccccccccccccEEEEccccccccccHcccccccccEEEEcccHHHHHcccccccccccccccccEEEEcc
MAHAIVSSLLDQLKSIAQDQVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLllsyndlpsnsmvkqcfsycavfpkdhymhkKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQefetyggdnefmrckMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKvrhlglnfeggaplpmsiyGLNRLRTLLiydkgpslrssilpglFSKLACLRALVIRQlssfshpspnfirEIPENIGKLIHLKYLNLSELCIERLPETLCELYNLrkldirrcpnlrelpaGIGKLMNMRsllngqtyslkympigisKLTSLRTLEKFVvgggvdggstcRLESLKNLQLLRKCGieglsnvshldeaeRIGLHNMENLLRLHLVFDgvvdgegeegrrknEKDKQLLEALQphlnveelqicfyggdifpkwLTSLTYLRELnlwfcfncehlpplgklpleKLQLYILKSVKRVGNeflgieesseddpssssssssvtafpklksldiggmeELEEWNYRITRkenisimprlsslwirgcpklkalpdyLLQSTALQELRIYFCDLLeelpiledrkttdiprlssleigycpklkvlpnyllrTTTLQELIIHRcpllenryregegedwhkishipyiesew
MAHAIVSSLLDQLKSIAQDQVIGnllrskctvkEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGGDNEFMRCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLssfshpspnFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNlrkldirrcpnLRELPAGIGKLMNMRSLLNGQTYSLKYMPIGISKLTSLRTLEKFVVgggvdggstCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENLLRLHLVFDGVVDGEGEEGRRKNEKDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCEHLPPLGKLPLEKLQLYILKSVKRVGNEFLGieesseddpssssssssvtafpklksldiggmeELEEWNYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQSTALQELRIYFCDLLeelpiledrkttdiprlssleigycpklkvlPNYLLRTTTLQELIIHRCPLLENRyregegedwhkishipyiesew
MAHAIVSSLLDQLKSIAQDQVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKDHYMHKKELIDMWMAQGYLNAeedeememvgeeYFNILATHSFFQEFETYGGDNEFMRCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSLLNGQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENLLRLHLVFdgvvdgegeegRRKNEKDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCEHlpplgklpleklqlYILKSVKRVGNEFLGIeesseddpssssssssVTAFPKLKSLDIGGMEELEEWNYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQSTALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPNYLLRTTTLQELIIHRCPLLENRYREGEGEDWHKISHIPYIESEW
*****VSSLLDQLKSIAQDQVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGGDNEFMRCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSLLNGQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENLLRLHLVFDGVVD*****************EALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCEHLPPLGKLPLEKLQLYILKSVKRVGNEFLGI*************************LDIGGMEELEEWNYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQSTALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPNYLLRTTTLQELIIHRCPLLENRYREGEGEDWHKISHIPYI****
MAHAIVSSLLDQLKSIAQDQVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGGDNEFMRCKMHDIVHDFAQFVSRKECLWLEIDGN******SFGDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSLLNGQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENLLRLHLVFDGVVD***********KDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCEHLPPLGKLPLEKLQLYILKSVKRVGNEFLGIEES****************FPKLKSLDIGGMEELEEWNYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQSTALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPNYLLRTTTLQELIIHRCPLLENRYR*GEGEDWHKISHIPYIESEW
MAHAIVSSLLDQLKSIAQDQVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGGDNEFMRCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSLLNGQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENLLRLHLVFDGVVD***********KDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCEHLPPLGKLPLEKLQLYILKSVKRVGNEFLGI******************AFPKLKSLDIGGMEELEEWNYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQSTALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPNYLLRTTTLQELIIHRCPLLENRYREGEGEDWHKISHIPYIESEW
MAHAIVSSLLDQLKSIAQDQVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGGDNEFMRCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSLLNGQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENLLRLHLVFDGVVDGEGEEGRRKNEKDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCEHLPPLGKLPLEKLQLYILKSVKRVGNEFLGIEESSEDDPSSSSSSSSVTAFPKLKSLDIGGMEELEEWNYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQSTALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPNYLLRTTTLQELIIHRCPLLENRYREGEGEDWHKISHIPYIESEW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHAIVSSLLDQLKSIAQDQVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAVFPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGGDNEFMRCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSLLNGQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENLLRLHLVFDGVVDGEGEEGRRKNEKDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCEHLPPLGKLPLEKLQLYILKSVKRVGNEFLGIEESSEDDPSSSSSSSSVTAFPKLKSLDIGGMEELEEWNYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQSTALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPNYLLRTTTLQELIIHRCPLLENRYREGEGEDWHKISHIPYIESEW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query658 2.2.26 [Sep-21-2011]
Q7XA39988 Putative disease resistan N/A no 0.855 0.569 0.318 1e-65
Q7XA42979 Putative disease resistan N/A no 0.861 0.579 0.315 7e-65
Q7XBQ9970 Disease resistance protei N/A no 0.860 0.583 0.318 2e-62
Q7XA40992 Putative disease resistan N/A no 0.861 0.571 0.307 4e-60
Q9LRR41054 Putative disease resistan yes no 0.799 0.499 0.309 8e-56
Q9LRR5 1424 Putative disease resistan no no 0.778 0.359 0.324 1e-48
Q38834852 Disease resistance RPP13- no no 0.588 0.454 0.282 9e-26
Q8W3K3910 Putative disease resistan no no 0.724 0.524 0.279 1e-22
Q39214926 Disease resistance protei no no 0.407 0.289 0.294 4e-21
P0DI181049 Probable disease resistan no no 0.866 0.543 0.256 5e-20
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function desciption
 Score =  251 bits (642), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 224/704 (31%), Positives = 320/704 (45%), Gaps = 141/704 (20%)

Query: 20  QVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAV 79
           + +G LLR K    EW+ + ++E+W + +    +L  L LSY+ LP +  ++QCF+YCAV
Sbjct: 356 KTLGGLLRFKREESEWEHVRDNEIWSLPQDESSILPALRLSYHHLPLD--LRQCFAYCAV 413

Query: 80  FPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGGDNEFM 139
           FPKD  M K+ LI +WMA G+L ++ + E+E VG E +N L   SFFQE E   G+  F 
Sbjct: 414 FPKDTKMIKENLITLWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEAKSGNTYF- 472

Query: 140 RCKMHDIVHDFAQ--FVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIY 197
             K+HD++HD A   F +   C      GN   +  +  D    + + F           
Sbjct: 473 --KIHDLIHDLATSLFSASASC------GNIREI--NVKDYKHTVSIGF----------- 511

Query: 198 GLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENIGK 257
                          ++ SS  P L  K   LR L +    S+S      + ++P +IG 
Sbjct: 512 --------------AAVVSSYSPSLLKKFVSLRVLNL----SYSK-----LEQLPSSIGD 548

Query: 258 LIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSLLNGQTY 317
           L+HL+YL+LS      LPE LC+L NL+ LD+  C +L  LP    KL ++R L+     
Sbjct: 549 LLHLRYLDLSCNNFRSLPERLCKLQNLQTLDVHNCYSLNCLPKQTSKLSSLRHLVVDGC- 607

Query: 318 SLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDE 377
            L   P  I  LT L+TL  F+VG         +L  LKNL L     I  L  V +  +
Sbjct: 608 PLTSTPPRIGLLTCLKTLGFFIVG----SKKGYQLGELKNLNLCGSISITHLERVKNDTD 663

Query: 378 AERIGLHNMENLLRLHLVFDGVVDGEGEEGRRKNEKDKQLLEALQPHLNVEELQICFYGG 437
           AE   L    NL  L + +D   DG      R   K+ ++LEAL+PH N++ L+I  +GG
Sbjct: 664 AE-ANLSAKANLQSLSMSWDN--DGPN----RYESKEVKVLEALKPHPNLKYLEIIAFGG 716

Query: 438 DIFPKWL--TSLTYLRELNLWFCFNCEHLPPLGKLP-LEKLQLYILKSVKRVGNEFLGIE 494
             FP W+  + L  +  + +  C NC  LPP G+LP LE L+L          N    +E
Sbjct: 717 FRFPSWINHSVLEKVISVRIKSCKNCLCLPPFGELPCLENLELQ---------NGSAEVE 767

Query: 495 ESSEDDPSSSSSSSSVTAFPKLKSLDI-------GGMEE--------LEEW--------- 530
              EDD  S  S+    +FP LK L I       G M+E        LEE          
Sbjct: 768 YVEEDDVHSRFSTRR--SFPSLKKLRIWFFRSLKGLMKEEGEEKFPMLEEMAILYCPLFV 825

Query: 531 --------------NYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQS--------- 567
                         N       +IS +  L+SL I    +  +LP+ +  S         
Sbjct: 826 FPTLSSVKKLEVHGNTNTRGLSSISNLSTLTSLRIGANYRATSLPEEMFTSLTNLEFLSF 885

Query: 568 ----------------TALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKV 611
                            AL+ L+I  CD LE  P   ++    +  L+ L + YC  LK 
Sbjct: 886 FDFKNLKDLPTSLTSLNALKRLQIESCDSLESFP---EQGLEGLTSLTQLFVKYCKMLKC 942

Query: 612 LPNYLLRTTTLQELIIHRCPLLENRYREGEGEDWHKISHIPYIE 655
           LP  L   T L  L +  CP +E R  +  GEDWHKI+HIP ++
Sbjct: 943 LPEGLQHLTALTNLGVSGCPEVEKRCDKEIGEDWHKIAHIPNLD 986
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query658
359482769 904 PREDICTED: putative disease resistance p 0.820 0.597 0.409 1e-113
359482790 923 PREDICTED: putative disease resistance p 0.817 0.582 0.407 1e-112
359482788 903 PREDICTED: putative disease resistance p 0.822 0.599 0.422 1e-111
359482792 922 PREDICTED: putative disease resistance p 0.813 0.580 0.430 1e-110
224114824 941 cc-nbs-lrr resistance protein [Populus t 0.820 0.573 0.397 1e-108
359482784 919 PREDICTED: putative disease resistance p 0.794 0.569 0.437 1e-108
359482794 880 PREDICTED: putative disease resistance p 0.785 0.587 0.441 1e-108
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.800 0.557 0.430 1e-108
224110248 888 cc-nbs-lrr resistance protein [Populus t 0.831 0.615 0.402 1e-107
147825450 927 hypothetical protein VITISV_000086 [Viti 0.826 0.586 0.402 1e-107
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  416 bits (1069), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 264/644 (40%), Positives = 361/644 (56%), Gaps = 104/644 (16%)

Query: 20  QVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAV 79
           + +GNLLR K + +EW+ +L SE+W+++E  + +   LLLSY DLP    +++CFS+CAV
Sbjct: 357 KTLGNLLRIKNSEEEWKNVLNSEVWQLDEFERDISPALLLSYYDLPP--AIQRCFSFCAV 414

Query: 80  FPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGGDNEFM 139
           FPKD  + + ELI +WMAQ YL ++  +EMEMVG  YF  LA  SFFQ+FE    D   +
Sbjct: 415 FPKDSVIVRAELIKLWMAQSYLKSDGRKEMEMVGRTYFEYLAARSFFQDFEK-DTDGNII 473

Query: 140 RCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIYGL 199
           RC+MHDIVHDFAQF+++ EC  +E+D  K+  ++ F  K+RH  L      P   S   +
Sbjct: 474 RCEMHDIVHDFAQFLTQNECFIVEVDNQKKGSMDLFFQKIRHATLVVRESTPNFASTCNM 533

Query: 200 NRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENIGKLI 259
             L TLL  +   +  S +L  L   L CLRAL +         S ++I E+P+ +GKLI
Sbjct: 534 KNLHTLLAKE---AFDSRVLEAL-GNLTCLRALDL--------SSNDWIEELPKEVGKLI 581

Query: 260 HLKYLNLSEL-CIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSLLNGQTYS 318
           HL+YLNLS    +  LPET+C+LYNL+ L+I  C +L++LP  +GKL+N+R L N  T S
Sbjct: 582 HLRYLNLSWCESLRELPETICDLYNLQTLNIEGCSSLQKLPHAMGKLINLRHLEN-YTRS 640

Query: 319 LKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLR-KCGIEGLSNVSHLDE 377
           LK +P GI +L+SL+TL+ F+V     G   C++  L+NL  LR +  +EGL  V    E
Sbjct: 641 LKGLPKGIGRLSSLQTLDVFIVSS--HGNDECQIGDLRNLNNLRGRLSVEGLDEVKDAGE 698

Query: 378 AERIGLHNMENLLRLHLVFDGVVDGEGEEGRRKNEKDKQLLEALQPHLNVEELQICFYGG 437
            E+  L N     R+H  +  +  GE        E  K + EALQPH N++ L I  YG 
Sbjct: 699 PEKAELKN-----RVHFQYLTLEFGE-------KEGTKGVAEALQPHPNLKSLGIVDYGD 746

Query: 438 DIFPKWL--TSLTYLRELNLWFCFNCEHLPPLGKLP-LEKLQLYILKSVKRVGNEFLGIE 494
             +P W+  +SL  L+ L+LWFC  C  LPPLG+LP LEKL ++ +  VK +G+EFLG  
Sbjct: 747 REWPNWMMGSSLAQLKILHLWFCKRCPCLPPLGQLPVLEKLYIWGMDGVKYIGSEFLG-- 804

Query: 495 ESSEDDPSSSSSSSSVTAFPKLKSLDIGGMEELEEWNYRITRKENISIMPRLSSLWIRGC 554
                        SS T FPKLK L I G+ EL++W   I  KE  SIMP L+ L +RGC
Sbjct: 805 -------------SSSTVFPKLKELAISGLVELKQWE--IKEKEERSIMPCLNHLIMRGC 849

Query: 555 PKLKALPDYLLQSTALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPN 614
           PKL+ LPD++LQ T LQ+L I         PIL+ R   DI                   
Sbjct: 850 PKLEGLPDHVLQRTPLQKLDIAGS------PILKRRYRKDI------------------- 884

Query: 615 YLLRTTTLQELIIHRCPLLENRYREGEGEDWHKISHIPYIESEW 658
                                      GED HKISHIP +E E+
Sbjct: 885 ---------------------------GEDRHKISHIPEVEVEY 901

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114824|ref|XP_002332291.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832453|gb|EEE70930.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482794|ref|XP_002268547.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110248|ref|XP_002333128.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834939|gb|EEE73388.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query658
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.618 0.386 0.312 3.7e-50
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.588 0.271 0.323 4.6e-40
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.539 0.197 0.285 6.9e-28
TAIR|locus:5049561821049 AT1G58848 [Arabidopsis thalian 0.196 0.122 0.393 7.3e-23
TAIR|locus:28269781049 AT1G59218 [Arabidopsis thalian 0.196 0.122 0.393 7.3e-23
TAIR|locus:2025916906 AT1G59780 "AT1G59780" [Arabido 0.610 0.443 0.265 2.3e-20
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.446 0.319 0.289 7.9e-20
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.370 0.263 0.287 1.8e-19
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.524 0.385 0.284 2.4e-19
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.121 0.084 0.333 6.2e-19
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 460 (167.0 bits), Expect = 3.7e-50, Sum P(2) = 3.7e-50
 Identities = 137/439 (31%), Positives = 216/439 (49%)

Query:    20 QVIGNLLRSKCTVKEWQRILESEMWKVEEIRKGLLAPLLLSYNDLPSNSMVKQCFSYCAV 79
             + +G +LR +  V EW+R+L S +W +   +  LL  L +SY  LP++  +K+CF+YC++
Sbjct:   378 KTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVLRVSYYYLPAH--LKRCFAYCSI 435

Query:    80 FPKDHYMHKKELIDMWMAQGYLNAXXXXXXXXXXXX-YFNILATHSFFQEFETYGGDNEF 138
             FPK H   K +++ +WMA+G+L               YF+ L + S  Q+ +T       
Sbjct:   436 FPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTKT------- 488

Query:   139 MRCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPMSIYG 198
              R  MHD +++ AQF S +     E DG K  V     ++ R+L    +  A  PM    
Sbjct:   489 -RYIMHDFINELAQFASGEFSSKFE-DGCKLQV----SERTRYLSYLRDNYAE-PMEFEA 541

Query:   199 LNR---LRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPENI 255
             L     LRT L      S RS  L  + S+   L  L   ++ S SH     I  +P + 
Sbjct:   542 LREVKFLRTFLPLSLTNSSRSCCLDQMVSE-KLLPTLTRLRVLSLSHYK---IARLPPDF 597

Query:   256 GKLI-HLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMRSL-LN 313
              K I H ++L+LS   +E+LP++LC +YNL+ L +  C +L+ELP  I  L+N+R L L 
Sbjct:   598 FKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLI 657

Query:   314 GQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVS 373
             G    L+ MP    +L SL+TL  F V    DG     L  L +L    K  I  L  V 
Sbjct:   658 GT--KLRQMPRRFGRLKSLQTLTTFFVSAS-DGSRISELGGLHDLH--GKLKIVELQRVV 712

Query:   374 HLDEAERIGLHNMENLLRLHLVFXXXXXXXXXXXR-RKNEKDKQLLEALQPHLNVEELQI 432
              + +A    L++ ++L  +  V+              + + + ++ E L+PH ++E+L I
Sbjct:   713 DVADAAEANLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAI 772

Query:   433 CFYGGDIFPKWLTSLTYLR 451
               Y G  FP WL+  ++ R
Sbjct:   773 ERYKGRRFPDWLSDPSFSR 791
GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00003247001
SubName- Full=Chromosome undetermined scaffold_141, whole genome shotgun sequence; (923 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query658
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-17
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score = 82.8 bits (205), Expect = 2e-17
 Identities = 32/86 (37%), Positives = 56/86 (65%), Gaps = 4/86 (4%)

Query: 21  VIGNLLRSKCTVKEWQRILESEMWKVEEIR--KGLLAPLLLSYNDLPSNSMVKQCFSYCA 78
           V+G LL  K TV+EW+ +LE    ++        +L+ L LSY++LP +  +K+CF Y A
Sbjct: 200 VLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMH--LKRCFLYLA 257

Query: 79  VFPKDHYMHKKELIDMWMAQGYLNAE 104
           +FP+D+ + K++LI +W+A+G++   
Sbjct: 258 LFPEDYNIRKEQLIKLWIAEGFVIPS 283

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 658
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.75
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.52
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.45
KOG0617264 consensus Ras suppressor protein (contains leucine 99.41
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.39
KOG4237498 consensus Extracellular matrix protein slit, conta 99.35
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.16
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.14
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.1
KOG4341483 consensus F-box protein containing LRR [General fu 98.99
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.68
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.68
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.67
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.65
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.47
PLN03150623 hypothetical protein; Provisional 98.42
KOG4341483 consensus F-box protein containing LRR [General fu 98.4
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.33
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.31
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.31
PLN03150623 hypothetical protein; Provisional 98.29
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.27
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.26
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.21
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.16
PRK15386 426 type III secretion protein GogB; Provisional 98.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.05
PRK15386 426 type III secretion protein GogB; Provisional 97.95
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.82
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.43
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.25
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.22
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.09
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.97
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.85
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.79
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.77
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.73
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.69
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.6
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.58
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.08
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.08
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.91
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.82
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.3
KOG1947 482 consensus Leucine rich repeat proteins, some prote 95.23
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.91
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.83
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.69
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.23
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.73
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.62
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.0
smart0037026 LRR Leucine-rich repeats, outliers. 91.61
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.61
smart0037026 LRR Leucine-rich repeats, outliers. 88.13
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.13
KOG0473326 consensus Leucine-rich repeat protein [Function un 87.04
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 84.82
PRK04841903 transcriptional regulator MalT; Provisional 84.43
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-54  Score=470.72  Aligned_cols=432  Identities=26%  Similarity=0.330  Sum_probs=303.7

Q ss_pred             hhhhHHHHHHhhCC-HHHHHHHHhhhcCCCCHHHHHHHHhccccc----cccccCcchHHHHhhccCCCCCCchhhHHhh
Q 044750            2 AHAIVSSLLDQLKS-IAQDQVIGNLLRSKCTVKEWQRILESEMWK----VEEIRKGLLAPLLLSYNDLPSNSMVKQCFSY   76 (658)
Q Consensus         2 ~~~~~~~i~~~c~g-Plai~~ig~~L~~~~~~~~W~~~~~~~~~~----~~~~~~~i~~~L~~sY~~L~~~~~~k~cFl~   76 (658)
                      +.++|++||+||+| |||++|||++|++|.++++|+++.+.+.+.    ..++.+.|+++|++|||+||+  ++|.||+|
T Consensus       341 i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~--~lK~CFLy  418 (889)
T KOG4658|consen  341 IEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPE--ELKSCFLY  418 (889)
T ss_pred             HHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhH--HHHHHHHh
Confidence            46899999999999 999999999999999999999998866555    333457799999999999996  99999999


Q ss_pred             hcCCCCCceeCHHHHHHHHHHcCCcCCCc-chhHHHHHHHHHHHHHhccCceeeeecCCCCeeceEEcCHHHHHHHHHhh
Q 044750           77 CAVFPKDHYMHKKELIDMWMAQGYLNAEE-DEEMEMVGEEYFNILATHSFFQEFETYGGDNEFMRCKMHDIVHDFAQFVS  155 (658)
Q Consensus        77 ~~~fp~~~~i~~~~Li~~w~~~g~~~~~~-~~~~~~~~~~~~~~L~~~~ll~~~~~~~~~~~~~~~~mhdl~~d~~~~~~  155 (658)
                      ||+|||||+|++++||.|||||||+.+.+ +..+++.|+.|+.+|+.++|++.....  ++.. +|+|||++||+|.+++
T Consensus       419 calFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~-~~kmHDvvRe~al~ia  495 (889)
T KOG4658|consen  419 CALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--GRKE-TVKMHDVVREMALWIA  495 (889)
T ss_pred             hccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--ccee-EEEeeHHHHHHHHHHh
Confidence            99999999999999999999999999955 588999999999999999999987654  3444 7999999999999999


Q ss_pred             c-----cceEEEecC-CCcccccccCCCceEEEEEEcCCCCCCCccccCCCcceEEEeecCCCCcccccccccccCCCcc
Q 044750          156 R-----KECLWLEID-GNKESVINSFGDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACL  229 (658)
Q Consensus       156 ~-----~~~~~~~~~-~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~L  229 (658)
                      +     +++.+.... +....+....+..+|++++.++.+...+.. ..+++|++|.+.+|.... ......+|..|+.|
T Consensus       496 s~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~-~~~~~L~tLll~~n~~~l-~~is~~ff~~m~~L  573 (889)
T KOG4658|consen  496 SDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGS-SENPKLRTLLLQRNSDWL-LEISGEFFRSLPLL  573 (889)
T ss_pred             ccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCC-CCCCccceEEEeecchhh-hhcCHHHHhhCcce
Confidence            9     565444432 222233333467899999999988755544 366799999999986311 13345678999999


Q ss_pred             cEEEEccccCCCCCCccccccccccccCCCccceeecCCccccccchhhhcCCCCcEeecCCCCCCCCCCcccccccCCc
Q 044750          230 RALVIRQLSSFSHPSPNFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKLMNMR  309 (658)
Q Consensus       230 r~L~L~~~~~l~~~~~~~~~~lp~~~~~l~~L~~L~L~~~~i~~lp~~i~~L~~L~~L~L~~~~~~~~lp~~i~~L~~L~  309 (658)
                      |||||++        |.....+|.++++|.+||||+++++.+..+|..+++|++|.+|++..+..+..+|.....|++||
T Consensus       574 rVLDLs~--------~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr  645 (889)
T KOG4658|consen  574 RVLDLSG--------NSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLR  645 (889)
T ss_pred             EEEECCC--------CCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhccccc
Confidence            9999943        45678899999999999999999999999999999999999999999887777777677799999


Q ss_pred             eeecCCcccCccCcCcCCCCCCCCccCceeeccCCCCCccccccccccCcccCCceecCccCCCChhhHhhcccCcccCC
Q 044750          310 SLLNGQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENL  389 (658)
Q Consensus       310 ~L~l~~~~~~~~~p~~i~~l~~L~~L~~~~~~~~~~~~~~~~~~~l~~L~~L~~l~i~~~~~~~~~~~~~~~~l~~~~~L  389 (658)
                      +|.+.... ...-...++.+.+|+.|..+......    ...+..+..+..|+.+.+.-.... .........+..+.+|
T Consensus       646 ~L~l~~s~-~~~~~~~l~el~~Le~L~~ls~~~~s----~~~~e~l~~~~~L~~~~~~l~~~~-~~~~~~~~~~~~l~~L  719 (889)
T KOG4658|consen  646 VLRLPRSA-LSNDKLLLKELENLEHLENLSITISS----VLLLEDLLGMTRLRSLLQSLSIEG-CSKRTLISSLGSLGNL  719 (889)
T ss_pred             EEEeeccc-cccchhhHHhhhcccchhhheeecch----hHhHhhhhhhHHHHHHhHhhhhcc-cccceeecccccccCc
Confidence            99987763 11111224445555555433332221    111122222222222111100000 1112223445667777


Q ss_pred             CceEEEecCccCCCCcccccCchhHHHHhhhcCCCCCCceEEEeeeCCCCCChhhhcccccceEEeeCCCCCC
Q 044750          390 LRLHLVFDGVVDGEGEEGRRKNEKDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCE  462 (658)
Q Consensus       390 ~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~p~~~~~l~~L~~L~l~~~~~~~  462 (658)
                      +.|.+..+.+.+..........  ...      .++++.++.+.++.....+.|....++|+.|.+..|...+
T Consensus       720 ~~L~i~~~~~~e~~~~~~~~~~--~~~------~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e  784 (889)
T KOG4658|consen  720 EELSILDCGISEIVIEWEESLI--VLL------CFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLE  784 (889)
T ss_pred             ceEEEEcCCCchhhcccccccc--hhh------hHHHHHHHHhhccccccccchhhccCcccEEEEecccccc
Confidence            7777777664321110000000  000      1223344444444444445555556666666666665544

>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query658
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 9e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 65/151 (43%), Gaps = 15/151 (9%)
Query: 192 LPMSIYGLNRLRTLLI------YDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSP 245
           LP SI  LNRLR L I       +    L S+   G    L  L++L +           
Sbjct: 142 LPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTG------- 194
Query: 246 NFIREIPENIGKLIHLKYLNLSELCIERLPETLCELYNLRKLDIRRCPNLRELPAGIGKL 305
             IR +P +I  L +LK L +    +  L   +  L  L +LD+R C  LR  P   G  
Sbjct: 195 --IRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR 252
Query: 306 MNMRSLLNGQTYSLKYMPIGISKLTSLRTLE 336
             ++ L+     +L  +P+ I +LT L  L+
Sbjct: 253 APLKRLILKDCSNLLTLPLDIHRLTQLEKLD 283
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query658
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 5e-32
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 7e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  130 bits (328), Expect = 5e-32
 Identities = 38/263 (14%), Positives = 87/263 (33%), Gaps = 33/263 (12%)

Query: 21  VIGNLLRSKC-TVKEWQRILESEMWKVEEIRK-----GLLAPLLLSYNDLPSNSMVKQCF 74
           +IG LLR      + + + L+++ +K            L   + +S   L  +  +K  +
Sbjct: 326 LIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLRED--IKDYY 383

Query: 75  SYCAVFPKDHYMHKKELIDMWMAQGYLNAEEDEEMEMVGEEYFNILATHSFFQEFETYGG 134
           +  ++  KD  +  K L  +W  +               E+        S          
Sbjct: 384 TDLSILQKDVKVPTKVLCILWDMETE-----------EVEDILQEFVNKSLLFCDR---- 428

Query: 135 DNEFMRCKMHDIVHDFAQFVSRKECLWLEIDGNKESVINSFGDKVRHLGLNFEGGAPLPM 194
           + +  R  +HD+  DF    +  +   L      + +I  F    +   L+ +    +  
Sbjct: 429 NGKSFRYYLHDLQVDFLTEKNCSQLQDL-----HKKIITQFQRYHQPHTLSPDQEDCMYW 483

Query: 195 SIYGLNRLRTLLIYDKGPSLRSSILPGLFSKLACLRALVIRQLSSFSHPSPNFIREIPEN 254
             +    + +  ++ +  +L  S+            A +I +   + H        + EN
Sbjct: 484 YNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAVSEN 543

Query: 255 IGKLIHLKYLNLSELCIERLPET 277
                  ++L+L+   + R P  
Sbjct: 544 F-----QEFLSLNGHLLGRQPFP 561
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query658
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.82
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.79
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.72
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.65
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.62
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.62
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.61
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.57
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.57
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.56
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.55
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.55
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.55
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.53
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.48
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.47
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.46
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.45
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.45
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.45
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.44
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.43
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.43
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.43
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.41
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.4
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.37
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.35
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.35
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.34
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.33
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.32
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.32
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.31
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.3
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.3
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.29
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.27
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.24
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.23
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.23
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.23
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.19
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.18
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.18
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.1
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.96
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.94
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.91
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.9
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.87
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.87
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.81
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.77
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.73
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.48
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.47
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.44
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.05
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.03
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.97
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.69
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.62
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.52
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.94
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.66
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-33  Score=316.54  Aligned_cols=434  Identities=18%  Similarity=0.149  Sum_probs=235.1

Q ss_pred             CCceEEEEEEcCCCCCCCccccCCCcceEEEeecCCCCcccccccccccC-CCcccEEEEccccCCCCCCcccccccccc
Q 044750          176 GDKVRHLGLNFEGGAPLPMSIYGLNRLRTLLIYDKGPSLRSSILPGLFSK-LACLRALVIRQLSSFSHPSPNFIREIPEN  254 (658)
Q Consensus       176 ~~~~~~l~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~-l~~Lr~L~L~~~~~l~~~~~~~~~~lp~~  254 (658)
                      ..+++.+.+.++.+....+.. .+++|+.|++.+|...   +..+..+.. +++|++|++      ++  +...+.+|..
T Consensus       246 l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~---~~ip~~~~~~~~~L~~L~L------s~--n~l~~~~p~~  313 (768)
T 3rgz_A          246 CTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFT---GEIPDFLSGACDTLTGLDL------SG--NHFYGAVPPF  313 (768)
T ss_dssp             CSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEE---ESCCCCSCTTCTTCSEEEC------CS--SEEEECCCGG
T ss_pred             CCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccC---CccCHHHHhhcCcCCEEEC------cC--CcCCCccchH
Confidence            345666666666543211111 5566666666655422   122333322 355666665      22  1222244555


Q ss_pred             ccCCCccceeecCCcccc-ccchh-hhcCCCCcEeecCCCCCCCCCCccccccc-CCceeecC-----------------
Q 044750          255 IGKLIHLKYLNLSELCIE-RLPET-LCELYNLRKLDIRRCPNLRELPAGIGKLM-NMRSLLNG-----------------  314 (658)
Q Consensus       255 ~~~l~~L~~L~L~~~~i~-~lp~~-i~~L~~L~~L~L~~~~~~~~lp~~i~~L~-~L~~L~l~-----------------  314 (658)
                      ++++++|++|++++|.+. .+|.. ++++++|++|++++|.....+|..+..++ +|+.|+++                 
T Consensus       314 ~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~  393 (768)
T 3rgz_A          314 FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK  393 (768)
T ss_dssp             GGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTT
T ss_pred             HhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhccc
Confidence            555555555555555554 45543 55555555555555543334555554444 44444444                 


Q ss_pred             ---------CcccCccCcCcCCCCCCCCccCceeeccCCCCCccccccccccCcccCCceecCccCCCChhhHhhcccCc
Q 044750          315 ---------QTYSLKYMPIGISKLTSLRTLEKFVVGGGVDGGSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHN  385 (658)
Q Consensus       315 ---------~~~~~~~~p~~i~~l~~L~~L~~~~~~~~~~~~~~~~~~~l~~L~~L~~l~i~~~~~~~~~~~~~~~~l~~  385 (658)
                               +|.....+|..++.+++|+.|++...  ...+..+..+   ..+++|+.+.+....    +....+..+..
T Consensus       394 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N--~l~~~~p~~l---~~l~~L~~L~L~~n~----l~~~~p~~~~~  464 (768)
T 3rgz_A          394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN--YLSGTIPSSL---GSLSKLRDLKLWLNM----LEGEIPQELMY  464 (768)
T ss_dssp             CCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSS--EEESCCCGGG---GGCTTCCEEECCSSC----CCSCCCGGGGG
T ss_pred             CCccEEECCCCccccccCHHHhcCCCCCEEECcCC--cccCcccHHH---hcCCCCCEEECCCCc----ccCcCCHHHcC
Confidence                     44333344444555555555542211  1111112222   223333333333321    11122233555


Q ss_pred             ccCCCceEEEecCccCCCCcccccCchhHHHHhhhcCCCCCCceEEEeeeCCC-CCChhhhcccccceEEeeCCCCCCCC
Q 044750          386 MENLLRLHLVFDGVVDGEGEEGRRKNEKDKQLLEALQPHLNVEELQICFYGGD-IFPKWLTSLTYLRELNLWFCFNCEHL  464 (658)
Q Consensus       386 ~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~-~~p~~~~~l~~L~~L~l~~~~~~~~l  464 (658)
                      +++|+.|+++++.+..              ..+..+..+++|+.|++.++... .+|.++..+++|++|++++|...+.+
T Consensus       465 l~~L~~L~L~~N~l~~--------------~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~  530 (768)
T 3rgz_A          465 VKTLETLILDFNDLTG--------------EIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI  530 (768)
T ss_dssp             CTTCCEEECCSSCCCS--------------CCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEEC
T ss_pred             CCCceEEEecCCcccC--------------cCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcC
Confidence            6667777776665211              12234455678888888887765 56888888888888888888776555


Q ss_pred             C-CCCCcc-ccceeccccccceEeCccccCCCCCCC--------------------------------------------
Q 044750          465 P-PLGKLP-LEKLQLYILKSVKRVGNEFLGIEESSE--------------------------------------------  498 (658)
Q Consensus       465 ~-~~~~lp-L~~L~l~~~~~l~~~~~~~~~~~~~~~--------------------------------------------  498 (658)
                      | .++.++ |+.|+++++.....++..+........                                            
T Consensus       531 p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~  610 (768)
T 3rgz_A          531 PAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTR  610 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGT
T ss_pred             CHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccc
Confidence            5 366777 888888766533222221111000000                                            


Q ss_pred             ------CCCCCCCCCCcccCCCCcceeeecCCccccccccccccccccCcCcccceeeeeCCCCCCCCCccccCCCCcce
Q 044750          499 ------DDPSSSSSSSSVTAFPKLKSLDIGGMEELEEWNYRITRKENISIMPRLSSLWIRGCPKLKALPDYLLQSTALQE  572 (658)
Q Consensus       499 ------~~~~~~~~~~~~~~~~~L~~L~L~~~~~L~~~~~~~~~~~~~~~~~~L~~L~L~~c~~l~~lp~~~~~l~~L~~  572 (658)
                            ...-.+.+|..+..+++|+.|+++++      ...+..|..++.+++|+.|+|++|...+.+|..++++++|+.
T Consensus       611 ~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N------~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~  684 (768)
T 3rgz_A          611 NPCNITSRVYGGHTSPTFDNNGSMMFLDMSYN------MLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNI  684 (768)
T ss_dssp             CCSCTTSCEEEEECCCSCSSSBCCCEEECCSS------CCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             cccccccceecccCchhhhccccccEEECcCC------cccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCE
Confidence                  00001223455667788888888887      333344677888888999999888777788888888889999


Q ss_pred             EEEccCCCCCCCcCCCccccCCCCCCCeeeccCCCCccccCCCCCCCCCccEEEEecChhHH----HhhcCCCCCCcccc
Q 044750          573 LRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPNYLLRTTTLQELIIHRCPLLE----NRYREGEGEDWHKI  648 (658)
Q Consensus       573 L~l~~c~~l~~~p~l~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~l~~c~~l~----~~~~~~~~~~~~~i  648 (658)
                      |+|++|.....+|    ..+..+++|++|++++|+....+|... .+.++....+.+||.+.    ..|..+.+++|++|
T Consensus       685 LdLs~N~l~g~ip----~~l~~l~~L~~L~ls~N~l~g~iP~~~-~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~  759 (768)
T 3rgz_A          685 LDLSSNKLDGRIP----QAMSALTMLTEIDLSNNNLSGPIPEMG-QFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHH  759 (768)
T ss_dssp             EECCSSCCEECCC----GGGGGCCCCSEEECCSSEEEEECCSSS-SGGGSCGGGGCSCTEEESTTSCCCCSCC-------
T ss_pred             EECCCCcccCcCC----hHHhCCCCCCEEECcCCcccccCCCch-hhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCC
Confidence            9999888877888    477888889999999887666777642 23344444455665332    26899999999999


Q ss_pred             cCcCceE
Q 044750          649 SHIPYIE  655 (658)
Q Consensus       649 ~~~~~~~  655 (658)
                      +|+|.+.
T Consensus       760 ~~~~~~~  766 (768)
T 3rgz_A          760 QRSHHHH  766 (768)
T ss_dssp             -------
T ss_pred             CCccccC
Confidence            9999875
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 658
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.004
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.6 bits (101), Expect = 4e-05
 Identities = 33/260 (12%), Positives = 79/260 (30%), Gaps = 16/260 (6%)

Query: 229 LRALVIRQLSSFSHPSPNFIREIPENIGKLIHLKYLNLSELCI--ERLPETLCELYNLRK 286
              L+ + + +F  P  +F+ +          +++++LS   I    L   L +   L+ 
Sbjct: 17  TGRLLSQGVIAFRCPR-SFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQN 75

Query: 287 LDIRRCPNLRELPAGIGKLMNMRSLLNGQTYSLKYMPIGISKLTSLRTLEKFVVGGGVDG 346
           L +        +   + K  N+  L            +  + L+S   L++  +    D 
Sbjct: 76  LSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFAL-QTLLSSCSRLDELNLSWCFDF 134

Query: 347 GSTCRLESLKNLQLLRKCGIEGLSNVSHLDEAERIGLHNMENLLRLHLVFDGVVDGEGEE 406
                  ++ ++              +         +    NL+ L L    ++  +  +
Sbjct: 135 TEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQ 194

Query: 407 GRRKNEKDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCEHLPP 466
                            +L    L  C+         L  +  L+ L ++       L  
Sbjct: 195 EF-----------FQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQL 243

Query: 467 LGK-LPLEKLQLYILKSVKR 485
           L + LP  ++      ++ R
Sbjct: 244 LKEALPHLQINCSHFTTIAR 263
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query658
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.79
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.64
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.64
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.57
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.5
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.44
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.29
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.28
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.25
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.24
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.24
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.23
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.21
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.21
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.18
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.15
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.12
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.04
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.0
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.0
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.94
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.83
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.77
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.37
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.88
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.56
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.79
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.38
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.77
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.24
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.86  E-value=7.1e-21  Score=194.27  Aligned_cols=190  Identities=23%  Similarity=0.231  Sum_probs=137.1

Q ss_pred             cCcccCCCceEEEecCccCCCCcccccCchhHHHHhhhcCCCCCCceEEEeeeCCCCCChhhhcccccceEEeeCCCCCC
Q 044750          383 LHNMENLLRLHLVFDGVVDGEGEEGRRKNEKDKQLLEALQPHLNVEELQICFYGGDIFPKWLTSLTYLRELNLWFCFNCE  462 (658)
Q Consensus       383 l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~p~~~~~l~~L~~L~l~~~~~~~  462 (658)
                      ...+++++.+.++.+.+..                .......++++.|.+.++....+ +.+..+++|+.|++++|. ..
T Consensus       193 ~~~l~~~~~l~l~~n~i~~----------------~~~~~~~~~L~~L~l~~n~l~~~-~~l~~l~~L~~L~l~~n~-l~  254 (384)
T d2omza2         193 LAKLTNLESLIATNNQISD----------------ITPLGILTNLDELSLNGNQLKDI-GTLASLTNLTDLDLANNQ-IS  254 (384)
T ss_dssp             GGGCTTCSEEECCSSCCCC----------------CGGGGGCTTCCEEECCSSCCCCC-GGGGGCTTCSEEECCSSC-CC
T ss_pred             cccccccceeeccCCccCC----------------CCcccccCCCCEEECCCCCCCCc-chhhcccccchhccccCc-cC
Confidence            3456677777776654211                01123457888999988877664 467788999999999986 44


Q ss_pred             CCCCCCCcc-ccceeccccccceEeCccccCCCCCCCCCCCCCCCCCcccCCCCcceeeecCCccccccccccccccccC
Q 044750          463 HLPPLGKLP-LEKLQLYILKSVKRVGNEFLGIEESSEDDPSSSSSSSSVTAFPKLKSLDIGGMEELEEWNYRITRKENIS  541 (658)
Q Consensus       463 ~l~~~~~lp-L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~L~~~~~~~~~~~~~~  541 (658)
                      .++.++..+ |+.|.++++...        +.              ..+..++.++.+.+.++ .++.       ...+.
T Consensus       255 ~~~~~~~~~~L~~L~l~~~~l~--------~~--------------~~~~~~~~l~~l~~~~n-~l~~-------~~~~~  304 (384)
T d2omza2         255 NLAPLSGLTKLTELKLGANQIS--------NI--------------SPLAGLTALTNLELNEN-QLED-------ISPIS  304 (384)
T ss_dssp             CCGGGTTCTTCSEEECCSSCCC--------CC--------------GGGTTCTTCSEEECCSS-CCSC-------CGGGG
T ss_pred             CCCcccccccCCEeeccCcccC--------CC--------------Ccccccccccccccccc-cccc-------ccccc
Confidence            555677778 888888765421        11              11346788888888876 3332       22356


Q ss_pred             cCcccceeeeeCCCCCCCCCccccCCCCcceEEEccCCCCCCCcCCCccccCCCCCCCeeeccCCCCccccCCCCCCCCC
Q 044750          542 IMPRLSSLWIRGCPKLKALPDYLLQSTALQELRIYFCDLLEELPILEDRKTTDIPRLSSLEIGYCPKLKVLPNYLLRTTT  621 (658)
Q Consensus       542 ~~~~L~~L~L~~c~~l~~lp~~~~~l~~L~~L~l~~c~~l~~~p~l~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~l~~  621 (658)
                      .+++++.|++++| .+..++ .+..+++|++|++++|. ++.++     .+..+++|++|++++|+ ++.+++ +.++++
T Consensus       305 ~~~~l~~L~ls~n-~l~~l~-~l~~l~~L~~L~L~~n~-l~~l~-----~l~~l~~L~~L~l~~N~-l~~l~~-l~~l~~  374 (384)
T d2omza2         305 NLKNLTYLTLYFN-NISDIS-PVSSLTKLQRLFFANNK-VSDVS-----SLANLTNINWLSAGHNQ-ISDLTP-LANLTR  374 (384)
T ss_dssp             GCTTCSEEECCSS-CCSCCG-GGGGCTTCCEEECCSSC-CCCCG-----GGGGCTTCCEEECCSSC-CCBCGG-GTTCTT
T ss_pred             hhcccCeEECCCC-CCCCCc-ccccCCCCCEEECCCCC-CCCCh-----hHcCCCCCCEEECCCCc-CCCChh-hccCCC
Confidence            7899999999998 556665 37889999999999995 56666     57789999999999995 667665 788999


Q ss_pred             ccEEEEecC
Q 044750          622 LQELIIHRC  630 (658)
Q Consensus       622 L~~L~l~~c  630 (658)
                      |+.|++++|
T Consensus       375 L~~L~L~~N  383 (384)
T d2omza2         375 ITQLGLNDQ  383 (384)
T ss_dssp             CSEEECCCE
T ss_pred             CCEeeCCCC
Confidence            999999875
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure