Citrus Sinensis ID: 044796


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
KALNEANEAKLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEAKEGQSASEKKEVAPAPEMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKILEFDPSNNQAKRTILRKLKEMGNSILGRFGMSTDNFKAVKDPNTGAYSISFQK
cHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHccccHHHHHcccHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHcHHHHHHHcccccccccccccc
ccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccEEEEccccccEEEEEEc
KALNEANEAKLEGNKLFAEGKYEEALLQYEVALRVAsvperaesasapeakegqsasekkevapapemAELRSIChsnrgicflklGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKIlefdpsnnqAKRTILRKLKEMGNSilgrfgmstdnfkavkdpntgaysisfqk
kalneaneaklegnklfaegKYEEALLQYEVALRVASVPeraesasapeakegqsasekkevapAPEMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKkilefdpsnnQAKRTILRKLKEMGNSILGrfgmstdnfkavkdpntgaysisfqk
KALNEANEAKLEGNKLFAEGKYEEALLQYEVALRvasvperaesasapeaKEGQSASEKKEVAPAPEMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKILEFDPSNNQAKRTILRKLKEMGNSILGRFGMSTDNFKAVKDPNTGAYSISFQK
***************LFAEGKYEEALLQYEVALRVA***********************************RSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKILEF**********ILRKL****NSILGRFG***********************
*ALNEANEAKLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEAKEGQSASEKKEVAPAPEMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKILEFDPSNNQAKRTILRKLKEMGNSILGRFGMSTDNFKAVKDPNTGA**ISFQK
********AKLEGNKLFAEGKYEEALLQYEVALRVAS*****************************EMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKILEFDPSNNQAKRTILRKLKEMGNSILGRFGMSTDNFKAVKDPNTGAYSISFQK
*ALNEANEAKLEGNKLFAEGKYEEALLQYEVALRVASVPER*E***********************EMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKILEFDPSNNQAKRTILRKLKEMGNSILGRFGMSTDNFKAVKDPNTGAYSISFQK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KALNEANEAKLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEAKEGQSASEKKEVAPAPEMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRxxxxxxxxxxxxxxxxxxxxxLEFDPSNNQAKRTILRKLKEMGNSILGRFGMSTDNFKAVKDPNTGAYSISFQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
Q91Z38292 Tetratricopeptide repeat yes no 0.790 0.503 0.357 1e-24
Q99614292 Tetratricopeptide repeat yes no 0.817 0.520 0.363 2e-24
Q3ZBR5292 Tetratricopeptide repeat yes no 0.817 0.520 0.353 6e-24
Q02790459 Peptidyl-prolyl cis-trans no no 0.682 0.276 0.372 3e-15
Q9QVC8458 Peptidyl-prolyl cis-trans no no 0.682 0.277 0.365 6e-15
P30416458 Peptidyl-prolyl cis-trans no no 0.682 0.277 0.365 6e-15
Q9TRY0459 Peptidyl-prolyl cis-trans no no 0.688 0.278 0.356 1e-14
A4K2V0 309 Mitochondrial import rece no no 0.677 0.407 0.344 1e-13
O94826 608 Mitochondrial import rece no no 0.677 0.207 0.335 1e-13
Q80ZX8 901 Sperm-associated antigen no no 0.704 0.145 0.347 2e-13
>sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=2 SV=1 Back     alignment and function desciption
 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/193 (35%), Positives = 102/193 (52%), Gaps = 46/193 (23%)

Query: 10  KLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEAKEGQSASEKKEVAPAPEMA 69
           K EGN+ F  G Y EA   Y  AL                           ++ PA    
Sbjct: 120 KEEGNERFKRGDYMEAESSYSQAL---------------------------QMCPAC-FQ 151

Query: 70  ELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAD 129
           + RS+  SNR    +K  K E +I +C+KA++LNPTY++A++RRAE +EK +  +EA+ D
Sbjct: 152 KDRSVLFSNRAAARMKQDKKETAITDCSKAIQLNPTYIRAILRRAELYEKTDKLDEALED 211

Query: 130 MKKILEFDPSNNQAKRTILR------------------KLKEMGNSILGRFGMSTDNFKA 171
            K +LE DPS +QA+   +R                  KLK++GN +L  FG+ST+NF+ 
Sbjct: 212 YKSVLEKDPSVHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQI 271

Query: 172 VKDPNTGAYSISF 184
            +D +TG+YSI+F
Sbjct: 272 KQDSSTGSYSINF 284





Mus musculus (taxid: 10090)
>sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 Back     alignment and function description
>sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 Back     alignment and function description
>sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 Back     alignment and function description
>sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 Back     alignment and function description
>sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 Back     alignment and function description
>sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens GN=TOMM70A PE=1 SV=1 Back     alignment and function description
>sp|Q80ZX8|SPAG1_MOUSE Sperm-associated antigen 1 OS=Mus musculus GN=Spag1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
224142329278 predicted protein [Populus trichocarpa] 0.865 0.579 0.627 2e-66
359806795268 uncharacterized protein LOC100808386 [Gl 0.860 0.597 0.622 4e-65
255585483253 heat shock protein 70 (HSP70)-interactin 0.854 0.628 0.630 2e-64
224091857188 predicted protein [Populus trichocarpa] 0.865 0.856 0.607 6e-63
357505397271 Tetratricopeptide repeat protein [Medica 0.860 0.590 0.596 2e-61
225445748262 PREDICTED: tetratricopeptide repeat prot 0.860 0.610 0.602 1e-60
297802984277 tetratricopeptide repeat-containing prot 0.854 0.574 0.605 5e-60
356527411276 PREDICTED: tetratricopeptide repeat prot 0.860 0.579 0.585 6e-60
211853238261 tetratricopeptide repeat protein [Solanu 0.860 0.613 0.583 1e-59
18087888 548 putative tetratricopeptide repeat protei 0.860 0.291 0.568 1e-59
>gi|224142329|ref|XP_002324511.1| predicted protein [Populus trichocarpa] gi|222865945|gb|EEF03076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/204 (62%), Positives = 148/204 (72%), Gaps = 43/204 (21%)

Query: 1   KALNEANEAKLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEAKEGQSASEKK 60
           + + EANEAKLEGN+LF  G+YEEALLQY+VAL+V          S P+           
Sbjct: 100 RGIEEANEAKLEGNRLFGNGQYEEALLQYDVALQV----------SPPDV---------- 139

Query: 61  EVAPAPEMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKL 120
                P   ELRSICHSNRG+CFLKLGKFE++IKEC+KALELNP+YMKAL+RR EAHEKL
Sbjct: 140 -----PSSIELRSICHSNRGVCFLKLGKFEDTIKECSKALELNPSYMKALVRRGEAHEKL 194

Query: 121 EHFEEAIADMKKILEFDPSNNQAKRTILR------------------KLKEMGNSILGRF 162
           EHFEEAIADMKKILE DPSN+QAKRTI R                  KLK+MGN++LGRF
Sbjct: 195 EHFEEAIADMKKILELDPSNDQAKRTIRRLEPLAAAKREKMNEEMIGKLKDMGNTLLGRF 254

Query: 163 GMSTDNFKAVKDPNTGAYSISFQK 186
           GMS DNFKAV+DPNTG+YSISFQ+
Sbjct: 255 GMSVDNFKAVQDPNTGSYSISFQR 278




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359806795|ref|NP_001241306.1| uncharacterized protein LOC100808386 [Glycine max] gi|255639737|gb|ACU20162.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255585483|ref|XP_002533434.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223526722|gb|EEF28954.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224091857|ref|XP_002309374.1| predicted protein [Populus trichocarpa] gi|222855350|gb|EEE92897.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357505397|ref|XP_003622987.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355498002|gb|AES79205.1| Tetratricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225445748|ref|XP_002272630.1| PREDICTED: tetratricopeptide repeat protein 1 [Vitis vinifera] gi|297743714|emb|CBI36597.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297802984|ref|XP_002869376.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315212|gb|EFH45635.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356527411|ref|XP_003532304.1| PREDICTED: tetratricopeptide repeat protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|211853238|emb|CAP16663.1| tetratricopeptide repeat protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|18087888|gb|AAL59042.1|AC087182_25 putative tetratricopeptide repeat protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
TAIR|locus:2118776277 TPR1 "tetratricopeptide repeat 0.494 0.332 0.720 3.6e-42
UNIPROTKB|B6GVA2261 int106 "Tetratricopeptide repe 0.462 0.329 0.732 3.3e-31
UNIPROTKB|G4MWP2283 MGG_01886 "Uncharacterized pro 0.198 0.130 0.648 3.4e-19
RGD|1303049 610 Tomm70a "translocase of outer 0.543 0.165 0.378 3.6e-17
UNIPROTKB|O94826 608 TOMM70A "Mitochondrial import 0.543 0.166 0.378 4.6e-17
ASPGD|ASPL0000002635275 AN9498 [Emericella nidulans (t 0.204 0.138 0.631 4.6e-17
UNIPROTKB|Q08E34 609 TOMM70A "Translocase of outer 0.543 0.165 0.378 4.6e-17
MGI|MGI:106295 611 Tomm70a "translocase of outer 0.543 0.165 0.368 9.8e-17
UNIPROTKB|Q15785309 TOMM34 "Mitochondrial import r 0.548 0.330 0.310 1.4e-16
MGI|MGI:1914077292 Ttc1 "tetratricopeptide repeat 0.548 0.349 0.403 2.9e-16
TAIR|locus:2118776 TPR1 "tetratricopeptide repeat 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 3.6e-42, Sum P(2) = 3.6e-42
 Identities = 67/93 (72%), Positives = 80/93 (86%)

Query:    62 VAPAPEMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLE 121
             V   PE  ELRSIC+ NRG+CFLKLGK EE+IKECTKALELNPTY KAL+RRAEAHEKLE
Sbjct:   135 VQELPESIELRSICYLNRGVCFLKLGKCEETIKECTKALELNPTYNKALVRRAEAHEKLE 194

Query:   122 HFEEAIADMKKILEFDPSNNQAKRTILRKLKEM 154
             HFE+A+ D+KKILE DPSN+QA++ I R+L+ +
Sbjct:   195 HFEDAVTDLKKILELDPSNDQARKGI-RRLEPL 226


GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=ISM
GO:0051879 "Hsp90 protein binding" evidence=IPI
UNIPROTKB|B6GVA2 int106 "Tetratricopeptide repeat protein" [Solanum lycopersicum (taxid:4081)] Back     alignment and assigned GO terms
UNIPROTKB|G4MWP2 MGG_01886 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
RGD|1303049 Tomm70a "translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O94826 TOMM70A "Mitochondrial import receptor subunit TOM70" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ASPGD|ASPL0000002635 AN9498 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E34 TOMM70A "Translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:106295 Tomm70a "translocase of outer mitochondrial membrane 70 homolog A (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q15785 TOMM34 "Mitochondrial import receptor subunit TOM34" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914077 Ttc1 "tetratricopeptide repeat domain 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-13
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-11
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 9e-08
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 1e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-06
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 8e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-05
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 1e-04
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 6e-04
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.001
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.002
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.003
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.003
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 62.0 bits (151), Expect = 4e-13
 Identities = 39/133 (29%), Positives = 57/133 (42%), Gaps = 33/133 (24%)

Query: 7   NEAKLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEAKEGQSASEKKEVAPAP 66
                 GN  +  G Y+EAL  YE AL +                              P
Sbjct: 1   EALLNLGNLYYKLGDYDEALEYYEKALELD-----------------------------P 31

Query: 67  EMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEA 126
           + A+     + N    + KLGK+EE++++  KALEL+P   KA      A+ KL  +EEA
Sbjct: 32  DNAD----AYYNLAAAYYKLGKYEEALEDYEKALELDPDNAKAYYNLGLAYYKLGKYEEA 87

Query: 127 IADMKKILEFDPS 139
           +   +K LE DP+
Sbjct: 88  LEAYEKALELDPN 100


Length = 100

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
KOG4234271 consensus TPR repeat-containing protein [General f 99.88
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.88
KOG1126638 consensus DNA-binding cell division cycle control 99.88
KOG0553304 consensus TPR repeat-containing protein [General f 99.88
PRK15359144 type III secretion system chaperone protein SscB; 99.85
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.83
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.82
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.82
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.81
PRK15359144 type III secretion system chaperone protein SscB; 99.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.8
KOG1125579 consensus TPR repeat-containing protein [General f 99.79
KOG1126638 consensus DNA-binding cell division cycle control 99.79
PRK11189296 lipoprotein NlpI; Provisional 99.79
PRK12370553 invasion protein regulator; Provisional 99.78
PRK10370198 formate-dependent nitrite reductase complex subuni 99.77
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.76
PRK12370 553 invasion protein regulator; Provisional 99.76
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.76
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.75
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.74
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.73
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.73
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.73
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.73
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.72
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.72
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.72
KOG1125579 consensus TPR repeat-containing protein [General f 99.72
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.72
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.71
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.71
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.71
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.7
KOG0553 304 consensus TPR repeat-containing protein [General f 99.7
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.7
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.7
PRK11788389 tetratricopeptide repeat protein; Provisional 99.7
PRK11189 296 lipoprotein NlpI; Provisional 99.69
KOG0547606 consensus Translocase of outer mitochondrial membr 99.67
PLN02789320 farnesyltranstransferase 99.67
PLN02789320 farnesyltranstransferase 99.67
PRK10370198 formate-dependent nitrite reductase complex subuni 99.67
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.67
KOG1129478 consensus TPR repeat-containing protein [General f 99.66
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.66
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.65
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.64
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.63
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.62
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.62
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.62
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.61
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.61
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.61
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.6
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.6
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.58
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.57
PRK14574 822 hmsH outer membrane protein; Provisional 99.56
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.56
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.55
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.55
KOG2076 895 consensus RNA polymerase III transcription factor 99.55
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.54
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.54
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.54
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.53
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.53
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.53
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.53
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.53
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.51
PRK15331165 chaperone protein SicA; Provisional 99.51
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.51
KOG2003 840 consensus TPR repeat-containing protein [General f 99.51
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.5
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.5
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.49
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.49
PRK10803263 tol-pal system protein YbgF; Provisional 99.48
KOG1129478 consensus TPR repeat-containing protein [General f 99.47
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.47
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.46
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.45
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.45
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.45
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.45
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.44
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.44
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.44
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.44
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.43
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 99.42
KOG2003 840 consensus TPR repeat-containing protein [General f 99.42
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 99.41
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 99.41
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.4
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.4
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.4
PF12688120 TPR_5: Tetratrico peptide repeat 99.39
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.38
PF13512142 TPR_18: Tetratricopeptide repeat 99.38
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.38
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.38
PF1337173 TPR_9: Tetratricopeptide repeat 99.38
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.38
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.37
PRK11906458 transcriptional regulator; Provisional 99.35
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.34
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.34
KOG4555175 consensus TPR repeat-containing protein [Function 99.34
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.33
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.33
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.32
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 99.31
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.31
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.31
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.29
PRK15331165 chaperone protein SicA; Provisional 99.29
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.29
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.27
PRK10803263 tol-pal system protein YbgF; Provisional 99.27
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.25
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 99.24
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.24
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.23
KOG2076 895 consensus RNA polymerase III transcription factor 99.22
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 99.22
PF12688120 TPR_5: Tetratrico peptide repeat 99.22
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.21
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.21
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.2
PF1337173 TPR_9: Tetratricopeptide repeat 99.19
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.18
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.18
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.16
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.16
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.15
PRK14574 822 hmsH outer membrane protein; Provisional 99.14
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.13
PF06552186 TOM20_plant: Plant specific mitochondrial import r 99.12
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.09
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.07
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.03
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.02
PF06552186 TOM20_plant: Plant specific mitochondrial import r 99.02
KOG4234271 consensus TPR repeat-containing protein [General f 99.02
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.01
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.01
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.99
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.99
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.99
PRK11906458 transcriptional regulator; Provisional 98.98
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.98
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.97
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.97
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.97
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.96
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.94
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.91
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.91
COG4700251 Uncharacterized protein conserved in bacteria cont 98.89
PF1342844 TPR_14: Tetratricopeptide repeat 98.88
PF13512142 TPR_18: Tetratricopeptide repeat 98.87
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.84
PF1342844 TPR_14: Tetratricopeptide repeat 98.81
KOG4555175 consensus TPR repeat-containing protein [Function 98.79
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.79
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 98.78
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.78
PF1343134 TPR_17: Tetratricopeptide repeat 98.75
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.75
PLN03077 857 Protein ECB2; Provisional 98.74
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.72
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.7
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.69
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.68
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.66
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.65
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.65
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.65
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.63
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.58
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.58
COG4700251 Uncharacterized protein conserved in bacteria cont 98.57
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.56
PLN03218 1060 maturation of RBCL 1; Provisional 98.56
PLN03218 1060 maturation of RBCL 1; Provisional 98.53
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.52
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.51
PF1343134 TPR_17: Tetratricopeptide repeat 98.47
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.45
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.43
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.42
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.41
KOG2471 696 consensus TPR repeat-containing protein [General f 98.38
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.36
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.35
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.33
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.33
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.3
KOG1915677 consensus Cell cycle control protein (crooked neck 98.3
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.29
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.27
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.26
PRK10941269 hypothetical protein; Provisional 98.26
COG2976207 Uncharacterized protein conserved in bacteria [Fun 98.25
PRK04841 903 transcriptional regulator MalT; Provisional 98.25
PRK04841 903 transcriptional regulator MalT; Provisional 98.24
KOG1586288 consensus Protein required for fusion of vesicles 98.24
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 98.23
PLN03077 857 Protein ECB2; Provisional 98.22
KOG1585 308 consensus Protein required for fusion of vesicles 98.21
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.2
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.18
KOG1586288 consensus Protein required for fusion of vesicles 98.17
KOG1310 758 consensus WD40 repeat protein [General function pr 98.17
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.14
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.11
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.1
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.08
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.07
KOG4507 886 consensus Uncharacterized conserved protein, conta 98.06
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.06
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.03
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 98.03
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.02
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 98.01
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 98.0
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.99
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 97.98
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.93
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.91
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.91
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.91
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.89
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.85
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.84
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.75
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.74
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.74
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.73
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.72
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 97.72
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.7
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.68
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.64
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.63
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.61
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.59
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.53
COG4976 287 Predicted methyltransferase (contains TPR repeat) 97.5
KOG4814 872 consensus Uncharacterized conserved protein [Funct 97.48
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.46
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.45
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 97.45
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.45
PRK10941269 hypothetical protein; Provisional 97.44
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.44
KOG2471 696 consensus TPR repeat-containing protein [General f 97.42
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.41
COG2912269 Uncharacterized conserved protein [Function unknow 97.4
KOG3364149 consensus Membrane protein involved in organellar 97.33
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.32
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 97.32
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.28
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.28
KOG1550 552 consensus Extracellular protein SEL-1 and related 97.28
KOG3364149 consensus Membrane protein involved in organellar 97.25
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.25
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.17
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.16
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.16
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 97.15
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.15
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 97.13
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.12
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 97.12
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.08
KOG4814 872 consensus Uncharacterized conserved protein [Funct 97.06
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.04
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.0
KOG1310 758 consensus WD40 repeat protein [General function pr 96.91
KOG2300 629 consensus Uncharacterized conserved protein [Funct 96.91
COG5191 435 Uncharacterized conserved protein, contains HAT (H 96.91
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.9
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.9
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.85
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.84
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.8
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 96.79
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 96.78
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.76
KOG1585308 consensus Protein required for fusion of vesicles 96.73
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.69
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.69
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 96.67
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.67
KOG2300 629 consensus Uncharacterized conserved protein [Funct 96.59
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.58
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 96.54
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.51
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 96.49
KOG1550552 consensus Extracellular protein SEL-1 and related 96.44
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 96.39
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.36
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.35
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.32
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 96.24
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.2
COG3629280 DnrI DNA-binding transcriptional activator of the 96.19
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.19
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 96.16
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.16
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.13
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.12
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.08
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.07
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 96.06
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.06
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 96.02
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 95.84
KOG0529 421 consensus Protein geranylgeranyltransferase type I 95.8
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.64
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 95.57
KOG1839 1236 consensus Uncharacterized protein CLU1/cluA/TIF31 95.55
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.48
COG2912269 Uncharacterized conserved protein [Function unknow 95.41
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 95.29
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.2
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.2
COG3629280 DnrI DNA-binding transcriptional activator of the 95.18
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.06
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 95.05
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.02
KOG0529 421 consensus Protein geranylgeranyltransferase type I 94.94
COG3947361 Response regulator containing CheY-like receiver a 94.93
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 94.92
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 94.5
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 94.44
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 94.32
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 94.18
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 94.14
COG4455 273 ImpE Protein of avirulence locus involved in tempe 94.02
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.75
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 93.59
COG5191 435 Uncharacterized conserved protein, contains HAT (H 93.51
KOG1258577 consensus mRNA processing protein [RNA processing 93.39
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 93.24
COG3947361 Response regulator containing CheY-like receiver a 93.24
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 93.16
KOG2041 1189 consensus WD40 repeat protein [General function pr 92.9
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 92.82
PF0421269 MIT: MIT (microtubule interacting and transport) d 92.73
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 92.63
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 92.56
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 92.54
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 92.49
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 92.43
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 92.38
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 92.25
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 92.18
smart00299140 CLH Clathrin heavy chain repeat homology. 92.13
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.93
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.82
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.76
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 91.67
KOG2581 493 consensus 26S proteasome regulatory complex, subun 91.65
KOG1258 577 consensus mRNA processing protein [RNA processing 91.41
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 91.4
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 91.21
PHA02537230 M terminase endonuclease subunit; Provisional 90.76
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 90.71
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 90.13
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 89.55
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 89.54
PF07219108 HemY_N: HemY protein N-terminus; InterPro: IPR0108 89.27
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 89.12
COG3014 449 Uncharacterized protein conserved in bacteria [Fun 89.01
KOG3783546 consensus Uncharacterized conserved protein [Funct 88.89
PF12753404 Nro1: Nuclear pore complex subunit Nro1; InterPro: 88.89
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 88.87
smart0074577 MIT Microtubule Interacting and Trafficking molecu 88.46
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 88.22
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 88.14
KOG3783546 consensus Uncharacterized conserved protein [Funct 88.05
cd0267979 MIT_spastin MIT: domain contained within Microtubu 87.73
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 87.27
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 87.18
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 87.13
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 87.02
PF1285434 PPR_1: PPR repeat 86.84
cd0265675 MIT MIT: domain contained within Microtubule Inter 86.67
PF0421269 MIT: MIT (microtubule interacting and transport) d 85.57
COG4941415 Predicted RNA polymerase sigma factor containing a 85.57
KOG2422 665 consensus Uncharacterized conserved protein [Funct 85.54
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 85.51
KOG2581 493 consensus 26S proteasome regulatory complex, subun 85.34
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 84.96
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 84.88
PRK15490 578 Vi polysaccharide biosynthesis protein TviE; Provi 84.86
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 84.62
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 84.35
KOG1463411 consensus 26S proteasome regulatory complex, subun 84.29
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 84.15
KOG4014248 consensus Uncharacterized conserved protein (conta 84.14
KOG3616 1636 consensus Selective LIM binding factor [Transcript 84.07
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 84.0
PF02064121 MAS20: MAS20 protein import receptor; InterPro: IP 83.65
KOG2041 1189 consensus WD40 repeat protein [General function pr 83.64
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 83.38
COG4259121 Uncharacterized protein conserved in bacteria [Fun 83.31
PF07219108 HemY_N: HemY protein N-terminus; InterPro: IPR0108 83.06
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 82.6
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 82.36
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 82.15
COG4455 273 ImpE Protein of avirulence locus involved in tempe 81.45
smart0067136 SEL1 Sel1-like repeats. These represent a subfamil 81.24
KOG3616 1636 consensus Selective LIM binding factor [Transcript 80.56
PF0123931 PPTA: Protein prenyltransferase alpha subunit repe 80.54
PF15469182 Sec5: Exocyst complex component Sec5 80.33
PF07163 309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 80.15
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=99.89  E-value=1.3e-22  Score=150.54  Aligned_cols=165  Identities=18%  Similarity=0.267  Sum_probs=143.3

Q ss_pred             HHHHHHHhHhHHHHcccHHHHHHHHHHHHhccCCChhhhhccchhh-hhcCchhHH----HhhCCCcchhHHHHHHHHHH
Q 044796            5 EANEAKLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEA-KEGQSASEK----KEVAPAPEMAELRSICHSNR   79 (186)
Q Consensus         5 ~a~~~~~~g~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~~~-~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~   79 (186)
                      -.+++.++|+.+-..|+..+|..+|.+++.+.|.++++..++|.++ ..+..+.+.    +++...|.    .+.+..++
T Consensus       319 F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~----~aaa~nNL  394 (966)
T KOG4626|consen  319 FPDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPE----FAAAHNNL  394 (966)
T ss_pred             chHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChh----hhhhhhhH
Confidence            3578889999999999999999999999999999999999999887 445554444    44555554    44889999


Q ss_pred             HHHHhhhccHHHHHHHHHHHHhcCcccHHHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHHhh
Q 044796           80 GICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKILEFDPSNNQAKRTILRKLKEMGNSIL  159 (186)
Q Consensus        80 a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~  159 (186)
                      |.+|.++|++++|+.+|++++.+.|+..+++.++|.+|..+|+.+.|+.+|.+|+.++|...+++.+|+.++..     .
T Consensus       395 a~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kD-----s  469 (966)
T KOG4626|consen  395 ASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKD-----S  469 (966)
T ss_pred             HHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhc-----c
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999     9


Q ss_pred             ccccccchhhhhcccCCCC
Q 044796          160 GRFGMSTDNFKAVKDPNTG  178 (186)
Q Consensus       160 ~~~~~A~~~~~~~~~~~~~  178 (186)
                      |...+||..|+.++..+|+
T Consensus       470 Gni~~AI~sY~~aLklkPD  488 (966)
T KOG4626|consen  470 GNIPEAIQSYRTALKLKPD  488 (966)
T ss_pred             CCcHHHHHHHHHHHccCCC
Confidence            9999999999999644443



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF07219 HemY_N: HemY protein N-terminus; InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG3014 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12753 Nro1: Nuclear pore complex subunit Nro1; InterPro: IPR024318 In fission yeast, Nro1 is a positive regulator of the stability of Sre1N, the sterol regulatory element-binding protein, which is an ER membrane-bound transcription factor that controls adaptation to low oxygen-growth [] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02064 MAS20: MAS20 protein import receptor; InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>COG4259 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07219 HemY_N: HemY protein N-terminus; InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>smart00671 SEL1 Sel1-like repeats Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF01239 PPTA: Protein prenyltransferase alpha subunit repeat; InterPro: IPR002088 Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein Back     alignment and domain information
>PF15469 Sec5: Exocyst complex component Sec5 Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 1e-13
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 3e-13
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 1e-10
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 3e-10
2if4_A338 Crystal Structure Of A Multi-Domain Immunophilin Fr 2e-09
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 3e-09
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-08
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-07
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 4e-08
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 4e-08
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-08
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 6e-08
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 6e-08
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 6e-08
2gw1_A 514 Crystal Structure Of The Yeast Tom70 Length = 514 9e-08
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 2e-07
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 6e-07
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 7e-07
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 5e-06
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 1e-06
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 1e-05
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 3e-06
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 4e-06
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 1e-05
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-05
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 2e-05
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 2e-05
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 3e-05
1wao_1 477 Pp5 Structure Length = 477 3e-05
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 1e-04
3as8_A186 Mama Msr-1 P41212 Length = 186 1e-04
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 2e-04
4apo_A165 Aip Tpr Domain In Complex With Human Tomm20 Peptide 4e-04
3asd_A200 Mama R50e Mutant Length = 200 4e-04
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 4e-04
3as4_A186 Mama Amb-1 C2221 Length = 186 5e-04
4aif_A144 Aip Tpr Domain In Complex With Human Hsp90 Peptide 5e-04
3ieg_A359 Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A L 5e-04
3asg_A186 Mama D159k Mutant 2 Length = 186 8e-04
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure

Iteration: 1

Score = 72.4 bits (176), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 51/145 (35%), Positives = 71/145 (48%), Gaps = 18/145 (12%) Query: 3 LNEANEAKLEGNKLFAEGKYEEALLQYEVALRXXXXXXXXXXXXXXXXKEGQSASEKKEV 62 L ++ K G F EGKY++ALLQY+ + E ++E+ + Sbjct: 144 LEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEY-------------ESSFSNEEAQK 190 Query: 63 APAPEMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEH 122 A A LR H N +C LKL F +I+ C KALEL+ K L RR EAH + Sbjct: 191 AQA-----LRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVND 245 Query: 123 FEEAIADMKKILEFDPSNNQAKRTI 147 FE A AD +K+L+ P+N AK + Sbjct: 246 FELARADFQKVLQLYPNNKAAKTQL 270
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|3AS8|A Chain A, Mama Msr-1 P41212 Length = 186 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|4APO|A Chain A, Aip Tpr Domain In Complex With Human Tomm20 Peptide Length = 165 Back     alignment and structure
>pdb|3ASD|A Chain A, Mama R50e Mutant Length = 200 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|3AS4|A Chain A, Mama Amb-1 C2221 Length = 186 Back     alignment and structure
>pdb|4AIF|A Chain A, Aip Tpr Domain In Complex With Human Hsp90 Peptide Length = 144 Back     alignment and structure
>pdb|3IEG|A Chain A, Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A Length = 359 Back     alignment and structure
>pdb|3ASG|A Chain A, Mama D159k Mutant 2 Length = 186 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-35
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-34
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-08
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-31
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-30
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-30
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-30
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-30
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 9e-29
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-28
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-27
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-16
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-09
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-26
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 9e-08
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-26
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-25
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-22
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-16
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-10
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 8e-25
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 3e-24
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-24
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 1e-23
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-22
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 3e-17
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-17
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 1e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-11
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 3e-22
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 5e-10
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-21
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-20
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-15
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-12
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-12
2gw1_A 514 Mitochondrial precursor proteins import receptor; 9e-07
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-19
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-09
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-19
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 8e-12
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-18
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-14
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-15
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-14
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-14
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-14
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-15
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-15
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 8e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-14
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-14
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-12
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-15
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-10
3u4t_A 272 TPR repeat-containing protein; structural genomics 6e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-15
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-12
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-15
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-10
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-15
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-12
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-10
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 3e-15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-15
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-09
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 2e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-15
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-11
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-10
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-10
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-14
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-14
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-13
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-14
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 8e-14
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-13
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-12
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-14
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-13
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-12
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-14
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 1e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-14
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-14
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-14
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-13
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-08
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 8e-14
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 2e-13
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-12
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-11
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-13
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 4e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-11
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-11
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 6e-13
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-12
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-13
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-09
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-12
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 7e-12
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-11
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-11
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-11
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-09
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-11
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-09
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-09
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-09
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 4e-09
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 5e-07
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 9e-09
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 6e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-07
4g1t_A 472 Interferon-induced protein with tetratricopeptide 3e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-04
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 7e-04
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 8e-04
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
 Score =  121 bits (305), Expect = 1e-35
 Identities = 36/151 (23%), Positives = 60/151 (39%), Gaps = 15/151 (9%)

Query: 3   LNEANEAKLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEAKEGQSASEKKEV 62
           L      + +GN+LF +  Y+EA+  Y  AL         E    PE  E          
Sbjct: 8   LKSVEALRQKGNELFVQKDYKEAIDAYRDALTRLDTLILREKPGEPEWVE---------- 57

Query: 63  APAPEMAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEH 122
                +       ++N   C+L +G   E+ +  ++ L+   T  KAL RRA+A      
Sbjct: 58  -----LDRKNIPLYANMSQCYLNIGDLHEAEETSSEVLKREETNEKALFRRAKARIAAWK 112

Query: 123 FEEAIADMKKILEFDPSNNQAKRTILRKLKE 153
            +EA  D+K +L   P+        ++ + E
Sbjct: 113 LDEAEEDLKLLLRNHPAAASVVAREMKIVTE 143


>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.96
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.94
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.94
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.91
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.91
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.91
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.91
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.9
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.89
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.89
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.89
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.88
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.88
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.88
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.88
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.88
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.88
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.88
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.88
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.88
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.88
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.88
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.88
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.87
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.87
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.87
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.86
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.86
3u4t_A272 TPR repeat-containing protein; structural genomics 99.86
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.86
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.86
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.86
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.86
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.86
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.86
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.86
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.86
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.86
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.86
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.85
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.85
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.84
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.84
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.84
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.84
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.84
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.84
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.84
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.84
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.84
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.83
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.83
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.83
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.83
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.83
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.83
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.82
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.82
3u4t_A272 TPR repeat-containing protein; structural genomics 99.82
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.81
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.81
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.81
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.81
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.81
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.81
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.81
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.81
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.8
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.8
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.8
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.8
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.8
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.8
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.79
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.79
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.79
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.79
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.79
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.78
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.78
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.78
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.78
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.78
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.77
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.77
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.77
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.76
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.76
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.76
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.76
3k9i_A117 BH0479 protein; putative protein binding protein, 99.76
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.75
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.75
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.74
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.74
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.74
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.74
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.74
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.73
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.73
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.72
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.72
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.72
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.72
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.72
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.71
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.71
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.71
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.7
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.7
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.7
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.69
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.69
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.68
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.68
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.67
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.67
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.67
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.67
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.67
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.67
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.67
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.67
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.67
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.66
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.66
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.66
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.66
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 99.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.65
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.65
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 99.65
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.65
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.64
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.64
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.64
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.64
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.63
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.63
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.63
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.62
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.62
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.62
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.62
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.62
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.61
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.61
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 99.61
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.61
3k9i_A117 BH0479 protein; putative protein binding protein, 99.61
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.6
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.57
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.56
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.55
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.55
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.55
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.55
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.54
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.54
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.54
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.53
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.53
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.53
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 99.51
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.51
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.51
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.45
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.44
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.43
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.42
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 99.41
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.39
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 99.39
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.38
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.33
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.33
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.33
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.3
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.27
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.27
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.27
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.25
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.24
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.22
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.18
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.18
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.17
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.13
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.12
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.11
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.08
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 99.06
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.02
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.98
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.91
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.9
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.9
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.86
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.8
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.76
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.72
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.7
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.68
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.4
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.38
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.35
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.28
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.25
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.23
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.23
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.13
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.97
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.88
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.77
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.73
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 97.67
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 97.61
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 97.21
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.9
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.84
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 96.82
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 96.77
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.67
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.6
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 96.6
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.54
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.51
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 96.43
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 96.41
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.73
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.67
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.65
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 95.25
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.62
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.11
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.97
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 93.84
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.45
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 93.45
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.33
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.9
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.58
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 91.48
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 91.46
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 91.09
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 90.7
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 90.62
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 90.59
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 90.37
3t5v_B 455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 88.88
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 88.8
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 88.62
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 88.44
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 87.29
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 86.6
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 86.34
1om2_A95 Protein (mitochondrial import receptor subunit TOM 86.25
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 84.62
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 84.58
2ijq_A161 Hypothetical protein; structural genomics, PSI, pr 83.29
1om2_A95 Protein (mitochondrial import receptor subunit TOM 81.95
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 81.56
2cwy_A94 Hypothetical protein TTHA0068; structural genomics 80.65
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
Probab=99.96  E-value=1.8e-28  Score=162.49  Aligned_cols=169  Identities=14%  Similarity=0.139  Sum_probs=150.8

Q ss_pred             hHHHHHHHhHhHHHHcccHHHHHHHHHHHHhccCCChhhhhccchhh-hhcCchhHHHhhCCCcchhHHHHHHHHHHHHH
Q 044796            4 NEANEAKLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEA-KEGQSASEKKEVAPAPEMAELRSICHSNRGIC   82 (186)
Q Consensus         4 ~~a~~~~~~g~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~   82 (186)
                      +.+..++.+|.++...|++++|+.+|+++++++|+++.++..+|.++ ..++.+.+...+.......+..+.++..+|.+
T Consensus         3 e~~~iy~~lG~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~   82 (184)
T 3vtx_A            3 ETTTIYMDIGDKKRTKGDFDGAIRAYKKVLKADPNNVETLLKLGKTYMDIGLPNDAIESLKKFVVLDTTSAEAYYILGSA   82 (184)
T ss_dssp             -CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHhcCchhHHHHHHHHHH
Confidence            35788999999999999999999999999999999999999999887 55666555555444444444456899999999


Q ss_pred             HhhhccHHHHHHHHHHHHhcCcccHHHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHHhhccc
Q 044796           83 FLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKILEFDPSNNQAKRTILRKLKEMGNSILGRF  162 (186)
Q Consensus        83 ~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~~~~  162 (186)
                      +...++++.|+..+.+++..+|+++.++..+|.++..+|++++|+..|+++++++|+++.++..+|.++..     +|++
T Consensus        83 ~~~~~~~~~a~~~~~~a~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~lg~~~~~-----~g~~  157 (184)
T 3vtx_A           83 NFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEG-----KGLR  157 (184)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH-----TTCH
T ss_pred             HHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHhCCchhHHHHHHHHHHhcchhhhHHHHHHHHHHH-----CCCH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999     9999


Q ss_pred             cccchhhhhcccCCC
Q 044796          163 GMSTDNFKAVKDPNT  177 (186)
Q Consensus       163 ~~A~~~~~~~~~~~~  177 (186)
                      ++|+.+|+++++.+|
T Consensus       158 ~~A~~~~~~al~~~p  172 (184)
T 3vtx_A          158 DEAVKYFKKALEKEE  172 (184)
T ss_dssp             HHHHHHHHHHHHTTH
T ss_pred             HHHHHHHHHHHhCCc
Confidence            999999999964443



>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2ijq_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.88A {Haloarcula marismortui} SCOP: a.246.2.1 Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>2cwy_A Hypothetical protein TTHA0068; structural genomics, conserved hypothetical protein, NPPSFA; 1.85A {Thermus thermophilus} SCOP: a.246.2.1 PDB: 2cxd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-15
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-10
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-10
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-07
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 2e-10
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 6e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 9e-10
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 9e-09
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.001
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-08
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-08
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-08
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-07
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 8e-08
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 1e-07
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 8e-04
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.001
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 2e-07
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-07
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 0.001
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 4e-07
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 4e-06
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 6e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-05
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 9e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-05
d1xnfa_ 259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.003
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 6e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 8e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 71.6 bits (174), Expect = 1e-15
 Identities = 28/147 (19%), Positives = 57/147 (38%), Gaps = 5/147 (3%)

Query: 13  GNKLFAEGKYEEALLQYEVALRVASVPERAESASA---PEAKEGQSASEKKEVAPAPEMA 69
               + +G  + A+  Y  A+ +   P   ++         ++G  A  +     A  + 
Sbjct: 244 ACVYYEQGLIDLAIDTYRRAIELQ--PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC 301

Query: 70  ELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAD 129
              +   +N      + G  EE+++   KALE+ P +  A    A   ++    +EA+  
Sbjct: 302 PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMH 361

Query: 130 MKKILEFDPSNNQAKRTILRKLKEMGN 156
            K+ +   P+   A   +   LKEM +
Sbjct: 362 YKEAIRISPTFADAYSNMGNTLKEMQD 388


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.91
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.91
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.89
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.89
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.87
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.86
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.86
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.86
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.83
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.81
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.81
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.8
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.79
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.78
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.78
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.78
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.75
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.74
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.7
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.65
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.65
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.64
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.63
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.63
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.63
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.62
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.6
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.55
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.55
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.53
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.47
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.38
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.35
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 99.34
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.29
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.26
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.17
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.14
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 99.12
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.11
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.96
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.78
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.44
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.31
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.04
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 95.13
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.1
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 92.44
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 92.02
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 90.08
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 88.03
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 86.9
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 86.23
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 85.2
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 84.93
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 84.87
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 80.05
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Hop
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=5.2e-24  Score=129.73  Aligned_cols=114  Identities=29%  Similarity=0.434  Sum_probs=108.4

Q ss_pred             HHHHHHHhHhHHHHcccHHHHHHHHHHHHhccCCChhhhhccchhhhhcCchhHHHhhCCCcchhHHHHHHHHHHHHHHh
Q 044796            5 EANEAKLEGNKLFAEGKYEEALLQYEVALRVASVPERAESASAPEAKEGQSASEKKEVAPAPEMAELRSICHSNRGICFL   84 (186)
Q Consensus         5 ~a~~~~~~g~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~   84 (186)
                      +++.++..|+.++..|++++|+.+|.++|+.+|.                                 ++.+|..+|.++.
T Consensus         2 ~~~~l~~~g~~~~~~g~~~eAi~~~~~al~~~p~---------------------------------~~~~~~~~a~~~~   48 (117)
T d1elwa_           2 QVNELKEKGNKALSVGNIDDALQCYSEAIKLDPH---------------------------------NHVLYSNRSAAYA   48 (117)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT---------------------------------CHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCc---------------------------------chhhhhccccccc
Confidence            5678899999999999999999999999999999                                 3389999999999


Q ss_pred             hhccHHHHHHHHHHHHhcCcccHHHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCCChHHHHHHHHHH
Q 044796           85 KLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIADMKKILEFDPSNNQAKRTILRKL  151 (186)
Q Consensus        85 ~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~  151 (186)
                      .+|++++|+..++++++++|+++.+|+.+|.++..+|++++|+..|+++++++|+++.++..++.+.
T Consensus        49 ~~~~~~~A~~~~~~al~~~p~~~~~~~~~g~~~~~~~~~~~A~~~~~~a~~~~p~~~~~~~~l~~l~  115 (117)
T d1elwa_          49 KKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNME  115 (117)
T ss_dssp             HHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCTTCHHHHHHHHHHH
T ss_pred             ccccccccchhhhhHHHhccchhhHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999999999999999888653



>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure