Citrus Sinensis ID: 044797


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MASKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILERMFLISSSIDCFTYLFLVKNEFFIDKKVNISGQEIHWGYLKINYFIRVMTDGH
cccEEEEEccccccHHHHHHHHHcccEEEEEcccHHHHHHHHHccccccccHHHHHccccEEEEEcccHHHHHHHHccccccccccccccEEEEcccccHHHHHHHHHHHHHccccEEEccccccHHHHHccEEEEEEccccccHHHHcccccEEEEcccccHHHHHHHcccc
ccccEEEEEcccccHHHHHHHHHcccEEEEEEccHHHHHHHHHccccEcccHHHHHHcccEEEEEccccHHHHHHHcccccHHcccccccEEEEcccccHHHHHHHHHHHHHcccEEEEcccccccHHHcccEEEEEEccccHEEEEEEEcccEEEEEEEEEEEEEEEEcccc
maskvgfvgldeYSVDMAASLIRSGykvqafeisdplVDKFFMlggirsaspmdagkdVSALVVVISHvdqiddiffghEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILERMFLISSSIDCFTYLFLVKneffidkkvnisgqeihwgYLKINYFIRVMTDGH
MASKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILERMFLISSSIDCFTYLFLVKNEFFIDKKVnisgqeihwgylkINYFIRVMTDGH
MASKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILERMFLISSSIDCFTYLFLVKNEFFIDKKVNISGQEIHWGYLKINYFIRVMTDGH
****VGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILERMFLISSSIDCFTYLFLVKNEFFIDKKVNISGQEIHWGYLKINYFIRVM****
*ASKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILERMFLISSSIDCFTYLFLVKNEFFIDKKVNISGQEIHWGYLKINYFIRVMTDG*
MASKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILERMFLISSSIDCFTYLFLVKNEFFIDKKVNISGQEIHWGYLKINYFIRVMTDGH
**SKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILERMFLISSSIDCFTYLFLVKNEFFIDKKVNISGQEIHWGYLKINYFIRVMT***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILERMFLISSSIDCFTYLFLVKNEFFIDKKVNISGQEIHWGYLKINYFIRVMTDGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
P0A9V9 298 Uncharacterized oxidoredu yes no 0.601 0.348 0.288 1e-09
P0A9V8 298 Uncharacterized oxidoredu N/A no 0.601 0.348 0.288 1e-09
P29266 335 3-hydroxyisobutyrate dehy yes no 0.624 0.322 0.309 2e-07
Q99L13 335 3-hydroxyisobutyrate dehy yes no 0.624 0.322 0.290 8e-07
Q9L7S0 298 Uncharacterized oxidoredu yes no 0.589 0.342 0.254 2e-06
Q9V8M5 324 Probable 3-hydroxyisobuty yes no 0.664 0.354 0.273 2e-06
Q9SUC0 347 Probable 3-hydroxyisobuty no no 0.589 0.293 0.288 3e-06
P77161 292 2-hydroxy-3-oxopropionate N/A no 0.601 0.356 0.247 6e-06
Q54CX6 321 Probable 3-hydroxyisobuty yes no 0.589 0.317 0.225 2e-05
O34948 288 Uncharacterized oxidoredu yes no 0.612 0.368 0.216 4e-05
>sp|P0A9V9|YIHU_SHIFL Uncharacterized oxidoreductase YihU OS=Shigella flexneri GN=yihU PE=3 SV=1 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 58/104 (55%)

Query: 3   SKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSAL 62
           + + F+GL +    MA++L++ G++++ F+++   V      G   +A+P  A KD   +
Sbjct: 2   AAIAFIGLGQMGSPMASNLLQQGHQLRVFDVNAEAVRHLVDKGATPAANPAQAAKDAEFI 61

Query: 63  VVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKL 106
           + ++ + D + ++ FG  GV +GL   A++I  STI P    KL
Sbjct: 62  ITMLPNGDLVRNVLFGENGVCEGLSTDALVIDMSTIHPLQTDKL 105





Shigella flexneri (taxid: 623)
EC: 1EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|P0A9V8|YIHU_ECOLI Uncharacterized oxidoreductase YihU OS=Escherichia coli (strain K12) GN=yihU PE=3 SV=1 Back     alignment and function description
>sp|P29266|3HIDH_RAT 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hibadh PE=1 SV=3 Back     alignment and function description
>sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Hibadh PE=2 SV=1 Back     alignment and function description
>sp|Q9L7S0|YIHU_SALTY Uncharacterized oxidoreductase YihU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yihU PE=3 SV=1 Back     alignment and function description
>sp|Q9V8M5|3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG15093 PE=2 SV=2 Back     alignment and function description
>sp|Q9SUC0|3HIDH_ARATH Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=At4g20930 PE=2 SV=3 Back     alignment and function description
>sp|P77161|GLXR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) GN=glxR PE=2 SV=1 Back     alignment and function description
>sp|Q54CX6|3HIDH_DICDI Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=hibA PE=3 SV=1 Back     alignment and function description
>sp|O34948|YKWC_BACSU Uncharacterized oxidoreductase YkwC OS=Bacillus subtilis (strain 168) GN=ykwC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
297734349 1509 unnamed protein product [Vitis vinifera] 0.658 0.075 0.646 6e-35
359491523 1377 PREDICTED: uncharacterized protein LOC10 0.641 0.080 0.622 1e-30
356522861 1376 PREDICTED: uncharacterized protein LOC10 0.624 0.078 0.590 1e-29
297850224 1376 ketose-bisphosphate aldolase class-II fa 0.653 0.082 0.584 4e-29
22329645 1373 ketose-bisphosphate aldolase class-II-li 0.641 0.080 0.603 9e-27
334182667 1393 ketose-bisphosphate aldolase class-II-li 0.641 0.079 0.603 1e-26
186478598 1374 ketose-bisphosphate aldolase class-II-li 0.641 0.080 0.598 2e-25
115467448 1376 Os06g0258900 [Oryza sativa Japonica Grou 0.612 0.077 0.458 4e-19
218197924 1376 hypothetical protein OsI_22435 [Oryza sa 0.612 0.077 0.458 4e-19
242092654 1379 hypothetical protein SORBIDRAFT_10g00936 0.618 0.077 0.460 7e-19
>gi|297734349|emb|CBI15596.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 75/116 (64%), Positives = 94/116 (81%), Gaps = 2/116 (1%)

Query: 1   MASK--VGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKD 58
           MAS   VGFVGLD+ S+++AASLIR+GY V+AFEI  PL+D F  LGG+R  +P++ GKD
Sbjct: 1   MASSGAVGFVGLDDLSLELAASLIRAGYAVKAFEIFGPLMDGFLKLGGVRCTTPLETGKD 60

Query: 59  VSALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFTGNL 114
           VSALVV+ISH DQI++IFF  EG L GL K AVII++STILP+++QKLEK  TGNL
Sbjct: 61  VSALVVLISHADQINNIFFSDEGALGGLAKNAVIIVRSTILPANIQKLEKRLTGNL 116




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359491523|ref|XP_002278967.2| PREDICTED: uncharacterized protein LOC100262718 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356522861|ref|XP_003530061.1| PREDICTED: uncharacterized protein LOC100779987 [Glycine max] Back     alignment and taxonomy information
>gi|297850224|ref|XP_002892993.1| ketose-bisphosphate aldolase class-II family protein [Arabidopsis lyrata subsp. lyrata] gi|297338835|gb|EFH69252.1| ketose-bisphosphate aldolase class-II family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22329645|ref|NP_173263.2| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] gi|18176246|gb|AAL60010.1| unknown protein [Arabidopsis thaliana] gi|22136930|gb|AAM91809.1| unknown protein [Arabidopsis thaliana] gi|332191573|gb|AEE29694.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334182667|ref|NP_001185028.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] gi|332191575|gb|AEE29696.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186478598|ref|NP_001117303.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] gi|332191574|gb|AEE29695.1| ketose-bisphosphate aldolase class-II-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115467448|ref|NP_001057323.1| Os06g0258900 [Oryza sativa Japonica Group] gi|52077150|dbj|BAD46196.1| putative fructose/tagatose bisphosphate aldolase [Oryza sativa Japonica Group] gi|113595363|dbj|BAF19237.1| Os06g0258900 [Oryza sativa Japonica Group] gi|215695410|dbj|BAG90601.1| unnamed protein product [Oryza sativa Japonica Group] gi|222635346|gb|EEE65478.1| hypothetical protein OsJ_20876 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|218197924|gb|EEC80351.1| hypothetical protein OsI_22435 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|242092654|ref|XP_002436817.1| hypothetical protein SORBIDRAFT_10g009360 [Sorghum bicolor] gi|241915040|gb|EER88184.1| hypothetical protein SORBIDRAFT_10g009360 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
UNIPROTKB|Q48PA9 301 PSPPH_0457 "3-hydroxyisobutyra 0.670 0.385 0.279 9.8e-11
UNIPROTKB|Q5ZLI9 333 HIBADH "Uncharacterized protei 0.624 0.324 0.336 2.2e-10
TIGR_CMR|SPO_2560 299 SPO_2560 "2-hydroxy-3-oxopropi 0.618 0.357 0.277 4.5e-10
ASPGD|ASPL0000044129 434 AN2335 [Emericella nidulans (t 0.589 0.235 0.303 5.1e-10
RGD|708399 335 Hibadh "3-hydroxyisobutyrate d 0.618 0.319 0.324 1.7e-09
UNIPROTKB|G4NKB0 444 MGG_03097 "Oxidoreductase" [Ma 0.624 0.243 0.306 3e-09
UNIPROTKB|Q2KEY5 558 MGCH7_ch7g901 "Putative unchar 0.624 0.193 0.306 4.4e-09
ZFIN|ZDB-GENE-040426-1582 329 hibadhb "3-hydroxyisobutyrate 0.583 0.306 0.330 1.6e-08
MGI|MGI:1889802 335 Hibadh "3-hydroxyisobutyrate d 0.624 0.322 0.290 1.7e-08
UNIPROTKB|J9P680174 J9P680 "Uncharacterized protei 0.618 0.614 0.297 4.2e-08
UNIPROTKB|Q48PA9 PSPPH_0457 "3-hydroxyisobutyrate dehydrogenase family protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
 Score = 154 (59.3 bits), Expect = 9.8e-11, P = 9.8e-11
 Identities = 33/118 (27%), Positives = 61/118 (51%)

Query:     1 MASK-VGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDV 59
             M +K VG +GL    + +A SL+RSG+ V A ++   + + F   GG+   SP       
Sbjct:     1 MTNKNVGVIGLGAMGLGIARSLLRSGFTVHACDVRSSVTEAFAQEGGVACQSPASMAAAC 60

Query:    60 SALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKL-EKTFTGNLTF 116
               ++ V+ + +Q + + FG  G +  L+ G ++I  +T+ P+   +L E+    NL +
Sbjct:    61 DVIITVVVNAEQTETVLFGENGAIAALRPGCLVIGCATVAPTFAVELGERLAAQNLLY 118




GO:0008152 "metabolic process" evidence=ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=ISS
UNIPROTKB|Q5ZLI9 HIBADH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2560 SPO_2560 "2-hydroxy-3-oxopropionate reductase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
ASPGD|ASPL0000044129 AN2335 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
RGD|708399 Hibadh "3-hydroxyisobutyrate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G4NKB0 MGG_03097 "Oxidoreductase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KEY5 MGCH7_ch7g901 "Putative uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1582 hibadhb "3-hydroxyisobutyrate dehydrogenase b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1889802 Hibadh "3-hydroxyisobutyrate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9P680 J9P680 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 3e-48
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 1e-21
PRK15461 296 PRK15461, PRK15461, NADH-dependent gamma-hydroxybu 2e-14
pfam03446163 pfam03446, NAD_binding_2, NAD binding domain of 6- 2e-12
TIGR01505 291 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropiona 6e-12
COG2084 286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase 1e-10
PRK11559 296 PRK11559, garR, tartronate semialdehyde reductase; 2e-10
TIGR01692 288 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogen 1e-09
PRK15059 292 PRK15059, PRK15059, tartronate semialdehyde reduct 4e-08
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
 Score =  166 bits (423), Expect = 3e-48
 Identities = 72/111 (64%), Positives = 88/111 (79%)

Query: 1   MASKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVS 60
            A  VGFVGLD  S ++A+SL+RSG+KVQAFEIS PL++KF  LGG R  SP +A KD +
Sbjct: 3   SAGVVGFVGLDSLSFELASSLLRSGFKVQAFEISTPLMEKFCELGGHRCDSPAEAAKDAA 62

Query: 61  ALVVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEKTFT 111
           ALVVV+SH DQ+DD+FFG EG  KGLQKGAVI+++STILP  +QKLEK  T
Sbjct: 63  ALVVVLSHPDQVDDVFFGDEGAAKGLQKGAVILIRSTILPLQLQKLEKKLT 113


Length = 1378

>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|185358 PRK15461, PRK15461, NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>gnl|CDD|130569 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>gnl|CDD|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|185019 PRK15059, PRK15059, tartronate semialdehyde reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 100.0
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 100.0
KOG0409 327 consensus Predicted dehydrogenase [General functio 100.0
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 99.97
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.97
PRK15059 292 tartronate semialdehyde reductase; Provisional 99.97
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 99.97
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 99.96
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 99.96
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.96
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 99.96
PLN02858 1378 fructose-bisphosphate aldolase 99.96
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.95
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.95
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.95
PLN02858 1378 fructose-bisphosphate aldolase 99.95
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.95
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 99.94
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.93
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.93
PLN02688266 pyrroline-5-carboxylate reductase 99.92
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.91
PRK07680273 late competence protein ComER; Validated 99.89
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.88
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.86
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.86
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.85
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.84
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 99.83
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.83
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.83
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 99.82
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.81
PRK12557 342 H(2)-dependent methylenetetrahydromethanopterin de 99.79
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.79
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.78
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.78
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.78
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.78
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.77
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.77
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.76
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.76
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.76
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.76
TIGR01724 341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.76
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 99.74
PRK07417279 arogenate dehydrogenase; Reviewed 99.73
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 99.73
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.72
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.72
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.72
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 99.71
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.71
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.7
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.7
PRK08507275 prephenate dehydrogenase; Validated 99.69
PRK08655 437 prephenate dehydrogenase; Provisional 99.69
PRK06545 359 prephenate dehydrogenase; Validated 99.68
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.66
PLN02256304 arogenate dehydrogenase 99.65
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 99.64
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.64
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.63
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 99.62
PRK07574385 formate dehydrogenase; Provisional 99.6
PLN03139386 formate dehydrogenase; Provisional 99.58
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 99.58
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.58
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.58
PLN02712 667 arogenate dehydrogenase 99.57
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.57
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 99.56
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.56
PRK13243333 glyoxylate reductase; Reviewed 99.55
PRK12480330 D-lactate dehydrogenase; Provisional 99.54
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.54
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.53
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.53
PLN02353 473 probable UDP-glucose 6-dehydrogenase 99.53
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.52
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.51
PRK06436303 glycerate dehydrogenase; Provisional 99.51
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 99.49
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.49
PLN02712 667 arogenate dehydrogenase 99.49
PRK08605332 D-lactate dehydrogenase; Validated 99.48
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 99.48
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.48
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 99.48
PRK05479 330 ketol-acid reductoisomerase; Provisional 99.46
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 99.46
PRK13403 335 ketol-acid reductoisomerase; Provisional 99.46
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.45
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 99.44
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 99.44
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 99.43
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 99.42
PRK08269 314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.42
PLN02928347 oxidoreductase family protein 99.4
PRK11730 715 fadB multifunctional fatty acid oxidation complex 99.39
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 99.38
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 99.38
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 99.37
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 99.37
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 99.36
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 99.36
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.36
PRK13302271 putative L-aspartate dehydrogenase; Provisional 99.36
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 99.36
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.35
PRK08818 370 prephenate dehydrogenase; Provisional 99.34
PRK13304265 L-aspartate dehydrogenase; Reviewed 99.34
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 99.33
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 99.31
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 99.3
PRK06487317 glycerate dehydrogenase; Provisional 99.29
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.29
PRK06932314 glycerate dehydrogenase; Provisional 99.28
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 99.27
PLN02306386 hydroxypyruvate reductase 99.27
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 99.25
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 99.25
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 99.23
PRK06141314 ornithine cyclodeaminase; Validated 99.19
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 99.16
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.15
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.14
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 99.13
COG4007 340 Predicted dehydrogenase related to H2-forming N5,N 99.09
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.07
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.07
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 99.0
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 98.98
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 98.98
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.97
PRK00048257 dihydrodipicolinate reductase; Provisional 98.96
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 98.95
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.94
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.93
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.91
PTZ00075476 Adenosylhomocysteinase; Provisional 98.9
PRK13303265 L-aspartate dehydrogenase; Provisional 98.88
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 98.88
COG0673 342 MviM Predicted dehydrogenases and related proteins 98.86
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 98.85
PRK07340304 ornithine cyclodeaminase; Validated 98.84
PLN02494477 adenosylhomocysteinase 98.84
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.83
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.83
PRK05225 487 ketol-acid reductoisomerase; Validated 98.82
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 98.79
TIGR00036266 dapB dihydrodipicolinate reductase. 98.79
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 98.78
PRK06407301 ornithine cyclodeaminase; Provisional 98.78
PRK06823315 ornithine cyclodeaminase; Validated 98.78
PRK08618325 ornithine cyclodeaminase; Validated 98.76
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.75
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.74
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 98.74
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.74
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 98.73
PRK10206 344 putative oxidoreductase; Provisional 98.72
PRK11579 346 putative oxidoreductase; Provisional 98.69
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 98.68
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.67
PRK06046326 alanine dehydrogenase; Validated 98.67
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 98.66
PRK06223 307 malate dehydrogenase; Reviewed 98.65
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 98.65
PRK07589346 ornithine cyclodeaminase; Validated 98.64
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 98.62
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.62
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 98.62
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.61
PRK08291330 ectoine utilization protein EutC; Validated 98.58
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 98.56
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 98.56
PRK06444197 prephenate dehydrogenase; Provisional 98.55
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 98.54
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 98.53
PRK12549284 shikimate 5-dehydrogenase; Reviewed 98.53
PRK06199379 ornithine cyclodeaminase; Validated 98.53
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 98.51
PLN00203519 glutamyl-tRNA reductase 98.51
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 98.47
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 98.44
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 98.43
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 98.42
PTZ00117 319 malate dehydrogenase; Provisional 98.41
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 98.41
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 98.41
TIGR00745 293 apbA_panE 2-dehydropantoate 2-reductase. This mode 98.4
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 98.4
KOG2305 313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 98.39
PRK04148134 hypothetical protein; Provisional 98.39
COG0569225 TrkA K+ transport systems, NAD-binding component [ 98.39
PRK10669558 putative cation:proton antiport protein; Provision 98.38
KOG2741 351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 98.38
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.36
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 98.36
PRK13940414 glutamyl-tRNA reductase; Provisional 98.35
PTZ00082 321 L-lactate dehydrogenase; Provisional 98.35
PRK03659601 glutathione-regulated potassium-efflux system prot 98.33
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 98.32
PRK08300 302 acetaldehyde dehydrogenase; Validated 98.32
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 98.31
PRK06270 341 homoserine dehydrogenase; Provisional 98.31
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.31
PRK06349 426 homoserine dehydrogenase; Provisional 98.3
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 98.29
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 98.29
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 98.29
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.28
PRK09496 453 trkA potassium transporter peripheral membrane com 98.28
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 98.26
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 98.26
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 98.26
PRK06718202 precorrin-2 dehydrogenase; Reviewed 98.26
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 98.25
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 98.24
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.24
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 98.23
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.22
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.2
PRK03562621 glutathione-regulated potassium-efflux system prot 98.16
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 98.16
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 98.12
KOG2711 372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 98.11
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 98.1
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 98.08
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 98.06
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 98.04
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 98.03
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.03
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 98.02
cd01483143 E1_enzyme_family Superfamily of activating enzymes 98.01
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 98.0
PRK06719157 precorrin-2 dehydrogenase; Validated 98.0
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.97
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.95
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 97.91
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 97.91
PRK08374 336 homoserine dehydrogenase; Provisional 97.91
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.9
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.89
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 97.89
PRK14982340 acyl-ACP reductase; Provisional 97.89
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.89
PRK09496453 trkA potassium transporter peripheral membrane com 97.88
PRK15076 431 alpha-galactosidase; Provisional 97.87
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.86
PLN02602 350 lactate dehydrogenase 97.85
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.85
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.84
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.83
PLN02477410 glutamate dehydrogenase 97.82
CHL00194 317 ycf39 Ycf39; Provisional 97.81
COG2910211 Putative NADH-flavin reductase [General function p 97.81
PRK09414445 glutamate dehydrogenase; Provisional 97.81
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.78
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 97.77
PRK12550272 shikimate 5-dehydrogenase; Reviewed 97.77
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 97.75
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.74
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.73
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.72
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 97.71
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 97.7
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.7
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 97.68
PRK14030445 glutamate dehydrogenase; Provisional 97.67
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.67
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 97.67
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.66
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.65
PRK06392 326 homoserine dehydrogenase; Provisional 97.64
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 97.63
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.63
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.62
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 97.62
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 97.61
PRK14031444 glutamate dehydrogenase; Provisional 97.61
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 97.61
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 97.6
PRK05086 312 malate dehydrogenase; Provisional 97.6
PRK08306 296 dipicolinate synthase subunit A; Reviewed 97.6
KOG3007333 consensus Mu-crystallin [Amino acid transport and 97.59
PRK05678 291 succinyl-CoA synthetase subunit alpha; Validated 97.58
PRK05442 326 malate dehydrogenase; Provisional 97.57
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 97.57
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.55
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.53
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 97.53
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 97.52
PLN00112 444 malate dehydrogenase (NADP); Provisional 97.52
COG2344211 AT-rich DNA-binding protein [General function pred 97.51
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 97.51
PRK00676338 hemA glutamyl-tRNA reductase; Validated 97.5
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 97.5
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 97.5
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 97.5
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 97.49
KOG2666 481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 97.49
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 97.49
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.49
PRK02318 381 mannitol-1-phosphate 5-dehydrogenase; Provisional 97.49
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 97.47
PRK09880343 L-idonate 5-dehydrogenase; Provisional 97.47
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.47
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 97.46
TIGR01757 387 Malate-DH_plant malate dehydrogenase, NADP-depende 97.46
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.45
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 97.44
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 97.44
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.43
TIGR01771 299 L-LDH-NAD L-lactate dehydrogenase. This model repr 97.43
PLN00106 323 malate dehydrogenase 97.43
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.42
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 97.42
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.41
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 97.41
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 97.41
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.41
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 97.41
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 97.4
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.4
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.37
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 97.37
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 97.36
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 97.36
TIGR01019 286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 97.34
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 97.34
PTZ00325 321 malate dehydrogenase; Provisional 97.33
PRK05562223 precorrin-2 dehydrogenase; Provisional 97.32
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 97.32
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 97.32
PLN02383 344 aspartate semialdehyde dehydrogenase 97.3
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 97.29
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 97.28
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.25
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 97.25
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 97.25
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.24
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 97.24
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 97.23
PRK08017256 oxidoreductase; Provisional 97.22
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.22
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 97.22
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 97.18
PLN02353473 probable UDP-glucose 6-dehydrogenase 97.18
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 97.17
COG0773 459 MurC UDP-N-acetylmuramate-alanine ligase [Cell env 97.16
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 97.15
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 97.15
PRK08328231 hypothetical protein; Provisional 97.14
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 97.11
PRK03815 401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.11
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 97.1
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 97.07
PLN00016 378 RNA-binding protein; Provisional 97.07
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.05
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.04
PRK08223287 hypothetical protein; Validated 97.03
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 97.01
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 97.01
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 97.01
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 97.01
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.0
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.0
PRK06813 346 homoserine dehydrogenase; Validated 97.0
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.99
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 96.99
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.98
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 96.97
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 96.97
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.97
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.96
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 96.95
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.94
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.94
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.94
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 96.93
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.92
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 96.91
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 96.91
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.91
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 96.9
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 96.9
PLN02427 386 UDP-apiose/xylose synthase 96.9
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 96.89
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 96.89
PRK08955 334 glyceraldehyde-3-phosphate dehydrogenase; Validate 96.89
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.88
COG5495289 Uncharacterized conserved protein [Function unknow 96.87
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 96.85
PRK05993 277 short chain dehydrogenase; Provisional 96.84
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.83
PRK07024257 short chain dehydrogenase; Provisional 96.83
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.83
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 96.83
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.82
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.81
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 96.81
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 96.8
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 96.8
PRK09291257 short chain dehydrogenase; Provisional 96.8
TIGR02853 287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.8
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 96.79
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.79
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 96.79
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 96.78
PLN03209 576 translocon at the inner envelope of chloroplast su 96.77
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 96.77
PRK10537393 voltage-gated potassium channel; Provisional 96.76
PRK06182273 short chain dehydrogenase; Validated 96.75
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.74
PRK07326237 short chain dehydrogenase; Provisional 96.74
PLN02214 342 cinnamoyl-CoA reductase 96.72
PRK10637 457 cysG siroheme synthase; Provisional 96.72
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 96.72
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 96.71
PRK07074257 short chain dehydrogenase; Provisional 96.7
PLN02740381 Alcohol dehydrogenase-like 96.7
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 96.69
PRK08163 396 salicylate hydroxylase; Provisional 96.68
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 96.66
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 96.66
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 96.65
PRK06482 276 short chain dehydrogenase; Provisional 96.65
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 96.64
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 96.64
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 96.63
PRK07454241 short chain dehydrogenase; Provisional 96.63
PRK06180 277 short chain dehydrogenase; Provisional 96.63
PRK08643256 acetoin reductase; Validated 96.62
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.62
PRK05865 854 hypothetical protein; Provisional 96.62
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 96.6
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 96.6
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 96.6
PRK10538248 malonic semialdehyde reductase; Provisional 96.59
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 96.58
TIGR01851 310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 96.57
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.57
TIGR02360 390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 96.55
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 96.54
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 96.53
PRK05868 372 hypothetical protein; Validated 96.53
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 96.53
PLN02178375 cinnamyl-alcohol dehydrogenase 96.52
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.52
PLN02695 370 GDP-D-mannose-3',5'-epimerase 96.51
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 96.51
PRK07774250 short chain dehydrogenase; Provisional 96.51
PRK12814 652 putative NADPH-dependent glutamate synthase small 96.51
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 96.51
PLN02896 353 cinnamyl-alcohol dehydrogenase 96.5
TIGR01081 448 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl 96.5
PRK07236 386 hypothetical protein; Provisional 96.49
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.49
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 96.49
PRK05693 274 short chain dehydrogenase; Provisional 96.48
PRK06753 373 hypothetical protein; Provisional 96.48
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 96.48
PRK11728 393 hydroxyglutarate oxidase; Provisional 96.48
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 96.48
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 96.47
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 96.47
PRK12779 944 putative bifunctional glutamate synthase subunit b 96.47
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.45
COG3804 350 Uncharacterized conserved protein related to dihyd 96.45
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 96.45
PRK07890258 short chain dehydrogenase; Provisional 96.44
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 96.43
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 96.41
PLN02650 351 dihydroflavonol-4-reductase 96.4
PRK12320 699 hypothetical protein; Provisional 96.39
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 96.39
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 96.39
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 96.39
PRK08243 392 4-hydroxybenzoate 3-monooxygenase; Validated 96.39
PRK05866293 short chain dehydrogenase; Provisional 96.38
PRK08219227 short chain dehydrogenase; Provisional 96.38
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 96.37
PRK07411 390 hypothetical protein; Validated 96.37
PLN02686 367 cinnamoyl-CoA reductase 96.37
PRK06139 330 short chain dehydrogenase; Provisional 96.35
PF01494 356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.35
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 96.34
PLN02586360 probable cinnamyl alcohol dehydrogenase 96.34
PRK06475 400 salicylate hydroxylase; Provisional 96.34
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.33
PRK12939250 short chain dehydrogenase; Provisional 96.3
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 96.3
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 96.3
PRK14851 679 hypothetical protein; Provisional 96.29
PRK06947248 glucose-1-dehydrogenase; Provisional 96.28
PRK07109 334 short chain dehydrogenase; Provisional 96.28
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 96.27
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
Probab=100.00  E-value=4.8e-36  Score=229.95  Aligned_cols=167  Identities=21%  Similarity=0.335  Sum_probs=155.8

Q ss_pred             CeEEEEeCChhhHHHHHHHHHCCCeEEEEcCChHH-HHHHHHcCCceecChhhhhcCCCEEEEeccChhhhhhhhcCccc
Q 044797            3 SKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPL-VDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEG   81 (173)
Q Consensus         3 ~~IgiiG~G~mG~~ia~~l~~~g~~V~~~d~~~~~-~~~~~~~g~~~~~~~~~~~~~~dvii~~v~~~~~~~~v~~~~~~   81 (173)
                      +||+|||+|.||.+||++|.++||+|++|||++++ .+.+.+.|.....++.++++++|+||+|+|++++++++++++++
T Consensus         1 ~kIafIGLG~MG~pmA~~L~~aG~~v~v~~r~~~ka~~~~~~~Ga~~a~s~~eaa~~aDvVitmv~~~~~V~~V~~g~~g   80 (286)
T COG2084           1 MKIAFIGLGIMGSPMAANLLKAGHEVTVYNRTPEKAAELLAAAGATVAASPAEAAAEADVVITMLPDDAAVRAVLFGENG   80 (286)
T ss_pred             CeEEEEcCchhhHHHHHHHHHCCCEEEEEeCChhhhhHHHHHcCCcccCCHHHHHHhCCEEEEecCCHHHHHHHHhCccc
Confidence            58999999999999999999999999999999999 66667779999999999999999999999999999999998889


Q ss_pred             hhhcCCCCCEEEEcCCCCHHHHHHHHHHHhcCCceeeece-------------eeeeecCHhhHHHHHHHHHhhCC-cee
Q 044797           82 VLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILER-------------MFLISSSIDCFTYLFLVKNEFFI-DKK  147 (173)
Q Consensus        82 i~~~l~~g~~ii~~st~~~~~~~~l~~~l~~~g~~~v~~~-------------~~~~~g~~~~~~~~~~~~~~~g~-~~~  147 (173)
                      +.+.+++|+++||+||++|...+++.+.++++|.+|++++             ++++||+++.+++++|+|+.+|. +.+
T Consensus        81 ~~~~~~~G~i~IDmSTisp~~a~~~a~~~~~~G~~~lDAPVsGg~~~A~~GtLtimvGG~~~~f~r~~pvl~~~g~~i~~  160 (286)
T COG2084          81 LLEGLKPGAIVIDMSTISPETARELAAALAAKGLEFLDAPVSGGVPGAAAGTLTIMVGGDAEAFERAKPVLEAMGKNIVH  160 (286)
T ss_pred             hhhcCCCCCEEEECCCCCHHHHHHHHHHHHhcCCcEEecCccCCchhhhhCceEEEeCCCHHHHHHHHHHHHHhcCceEE
Confidence            9999999999999999999999999999999999999875             88999999999999999999997 789


Q ss_pred             ecCCCchHhHhHHhHhhhHhhhh
Q 044797          148 VNISGQEIHWGYLKINYFIRVMT  170 (173)
Q Consensus       148 ~g~~Gsg~a~~~~~~~~~~~~~~  170 (173)
                      +|+.|+|.+ .++++|.++-...
T Consensus       161 ~G~~G~G~~-~Kl~nn~l~~~~~  182 (286)
T COG2084         161 VGPVGAGQA-AKLANNILLAGNI  182 (286)
T ss_pred             ECCCCchHH-HHHHHHHHHHHHH
Confidence            999999987 6788988876544



>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>KOG3007 consensus Mu-crystallin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
3pef_A 287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 6e-07
2i9p_A 319 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 5e-06
2gf2_A 296 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 6e-06
1yb4_A 295 Crystal Structure Of The Tartronic Semialdehyde Red 9e-06
3pdu_A 287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 8e-05
>pdb|3PEF|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Metallireducens In Complex With Nadp+ Length = 287 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 27/103 (26%), Positives = 53/103 (51%) Query: 4 KVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALV 63 K GF+GL MA +L+++G V + S ++ LG R+A+P + + Sbjct: 3 KFGFIGLGIMGSAMAKNLVKAGCSVTIWNRSPEKAEELAALGAERAATPXEVVESCPVTF 62 Query: 64 VVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKL 106 +++ +++ FG GVL+G+ +G + ST+ P+ Q++ Sbjct: 63 AMLADPAAAEEVCFGKHGVLEGIGEGRGYVDMSTVDPATSQRI 105
>pdb|2I9P|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Complexed With Nad+ Length = 319 Back     alignment and structure
>pdb|2GF2|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Length = 296 Back     alignment and structure
>pdb|1YB4|A Chain A, Crystal Structure Of The Tartronic Semialdehyde Reductase From Salmonella Typhimurium Lt2 Length = 295 Back     alignment and structure
>pdb|3PDU|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Sulfurreducens In Complex With Nadp+ Length = 287 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 8e-17
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 8e-16
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 7e-15
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 7e-14
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 2e-13
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 3e-12
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 6e-12
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 9e-12
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 2e-11
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 3e-11
3qha_A 296 Putative oxidoreductase; seattle structural genomi 6e-11
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 7e-11
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 3e-08
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 2e-07
4ezb_A 317 Uncharacterized conserved protein; structural geno 1e-06
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 2e-06
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 8e-05
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Length = 303 Back     alignment and structure
 Score = 74.9 bits (185), Expect = 8e-17
 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 1/106 (0%)

Query: 4   KVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSA-SPMDAGKDVSAL 62
            VG VGL    +  A S +R+G      +++          G   +A S  +    V AL
Sbjct: 9   HVGIVGLGSMGMGAARSCLRAGLSTWGADLNPQACANLLAEGACGAAASAREFAGVVDAL 68

Query: 63  VVVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQKLEK 108
           V+++ +  Q+  + FG +GV   ++ G+ +++ STI  +  Q++  
Sbjct: 69  VILVVNAAQVRQVLFGEDGVAHLMKPGSAVMVSSTISSADAQEIAA 114


>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Length = 301 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Length = 296 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Length = 296 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Length = 295 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Length = 289 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Length = 317 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Length = 312 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Length = 264 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 100.0
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 100.0
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.96
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 99.96
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.96
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 99.96
3qha_A 296 Putative oxidoreductase; seattle structural genomi 99.96
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 99.96
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.96
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.95
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 99.95
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 99.95
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.94
4ezb_A 317 Uncharacterized conserved protein; structural geno 99.94
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 99.93
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 99.93
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.93
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.92
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.92
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.92
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.92
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.92
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 99.91
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.91
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.9
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.9
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.9
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.89
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.89
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.87
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.86
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.86
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.86
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.86
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.86
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.86
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.85
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.85
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.85
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.84
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 99.83
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.83
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 99.83
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.83
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 99.82
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 99.81
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.81
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 99.81
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.81
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.8
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.8
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.8
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.79
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.79
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.79
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 99.79
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.79
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.78
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.77
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.76
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.76
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.76
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.61
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.75
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 99.74
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.74
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.73
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.72
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.71
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.7
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.69
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.69
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.69
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.68
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.68
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.66
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.66
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.65
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.64
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 99.64
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.63
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.63
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.63
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.63
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.63
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.62
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.62
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.62
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.62
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.62
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.61
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 99.61
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.61
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.61
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.61
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.61
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.6
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 99.59
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.59
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.59
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.58
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.58
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.58
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.58
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.57
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.56
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.56
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.56
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.55
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.55
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.55
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.53
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.53
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 99.53
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 99.52
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 99.52
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.51
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.51
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.51
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.49
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 99.49
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 99.46
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 99.46
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 99.43
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 99.43
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 99.42
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 99.4
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 99.34
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.34
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 99.34
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 99.33
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 99.33
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 99.32
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 99.32
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 99.32
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 99.31
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 99.31
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.31
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.31
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 99.3
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 99.29
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 99.29
2duw_A145 Putative COA-binding protein; ligand binding prote 99.29
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 99.29
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 99.28
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 99.28
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 99.27
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 99.25
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 99.24
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 99.24
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 99.22
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 99.22
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 99.22
1lss_A140 TRK system potassium uptake protein TRKA homolog; 99.21
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 99.19
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 99.18
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 99.17
3c85_A183 Putative glutathione-regulated potassium-efflux S 99.17
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 99.17
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 99.17
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 99.16
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 99.15
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 99.15
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 99.14
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 99.14
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 99.14
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 99.14
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 99.12
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 99.12
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 99.11
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 99.11
1ydw_A 362 AX110P-like protein; structural genomics, protein 99.1
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 99.08
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 99.08
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 99.06
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 99.06
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 99.05
4had_A 350 Probable oxidoreductase protein; structural genomi 99.04
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 99.04
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 99.03
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 99.03
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 99.03
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 99.02
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 99.02
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 99.02
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 99.01
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 99.01
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 99.01
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 99.01
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 99.0
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.99
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 98.99
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 98.99
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 98.99
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 98.98
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.98
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 98.98
1iuk_A140 Hypothetical protein TT1466; structural genomics, 98.97
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 98.97
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 98.97
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.97
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.96
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.95
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.94
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 98.93
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 98.93
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.93
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 98.93
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.93
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 98.92
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 98.91
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 98.91
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.9
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 98.9
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 98.9
4h3v_A 390 Oxidoreductase domain protein; structural genomics 98.89
2d59_A144 Hypothetical protein PH1109; COA binding, structur 98.87
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 98.87
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.85
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 98.84
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 98.84
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.83
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 98.83
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.82
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 98.8
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.79
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 98.78
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 98.76
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 98.75
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.73
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.73
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 98.73
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 98.73
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.72
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 98.71
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 98.7
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 98.7
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 98.69
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 98.68
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.68
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.64
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.62
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 98.62
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.62
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.61
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 98.6
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 98.59
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.59
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 98.59
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 98.59
1id1_A153 Putative potassium channel protein; RCK domain, E. 98.58
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 98.58
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 98.58
3tl2_A 315 Malate dehydrogenase; center for structural genomi 98.58
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 98.57
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 98.57
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 98.57
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.55
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 98.54
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 98.53
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.52
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 98.51
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 98.5
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 98.49
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 98.48
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 98.46
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 98.45
2d4a_B 308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.44
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 98.44
1oi7_A 288 Succinyl-COA synthetase alpha chain; SCS, ligase, 98.44
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.42
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 98.42
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 98.42
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 98.4
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 98.39
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 98.36
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 98.36
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 98.35
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 98.34
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.34
2yv1_A 294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 98.34
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 98.33
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 98.33
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.33
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 98.32
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 98.28
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 98.26
2fp4_A 305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 98.26
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 98.26
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 98.25
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 98.25
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.25
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 98.25
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 98.24
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 98.24
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 98.23
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 98.22
3l07_A285 Bifunctional protein fold; structural genomics, ID 98.21
4g65_A 461 TRK system potassium uptake protein TRKA; structur 98.2
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 98.19
2yv2_A 297 Succinyl-COA synthetase alpha chain; COA-binding d 98.19
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 98.19
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 98.17
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 98.16
3p2o_A285 Bifunctional protein fold; structural genomics, ce 98.16
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 98.16
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 98.16
1o6z_A 303 MDH, malate dehydrogenase; halophilic, ION-binding 98.12
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 98.1
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.09
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 98.08
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 98.07
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 98.07
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.06
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 98.05
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 98.05
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 98.03
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 98.03
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 98.02
1lnq_A336 MTHK channels, potassium channel related protein; 98.01
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 98.01
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 98.0
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.99
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 97.93
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.92
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.91
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.91
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.9
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.89
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.87
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 97.83
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 97.82
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.8
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.79
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.78
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 97.75
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 97.72
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 97.72
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.71
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 97.69
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 97.69
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.68
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.68
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 97.66
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 97.65
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.64
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 97.64
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.64
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.64
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 97.63
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 97.62
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 97.61
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 97.61
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 97.61
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.61
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 97.6
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 97.6
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 97.6
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 97.59
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 97.59
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 97.59
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 97.59
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.58
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.58
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 97.57
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 97.56
2csu_A 457 457AA long hypothetical protein; structural genomi 97.56
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 97.55
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 97.54
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 97.54
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 97.54
1xq6_A253 Unknown protein; structural genomics, protein stru 97.53
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 97.52
1p3d_A 475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 97.52
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 97.52
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 97.5
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 97.5
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 97.49
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.48
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 97.48
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 97.47
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 97.46
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 97.46
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 97.44
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 97.44
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.43
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.43
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 97.43
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 97.42
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 97.42
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 97.41
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 97.4
1up7_A 417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 97.4
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 97.4
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 97.39
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 97.39
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 97.38
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 97.37
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 97.36
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 97.35
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 97.34
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.33
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 97.33
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 97.33
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 97.33
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 97.32
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 97.3
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 97.3
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 97.29
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 97.29
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.28
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 97.27
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 97.27
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 97.26
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 97.25
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 97.25
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 97.24
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 97.24
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.24
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 97.23
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.22
4gx0_A565 TRKA domain protein; membrane protein, ION channel 97.21
4hb9_A 412 Similarities with probable monooxygenase; flavin, 97.2
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 97.2
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 97.2
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 97.19
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 97.18
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.17
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.15
3fbg_A346 Putative arginate lyase; structural genomics, unkn 97.14
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.14
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 97.12
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 97.12
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 97.11
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 97.11
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 97.1
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 97.1
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 97.08
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.08
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.07
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.07
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 97.05
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 97.05
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 97.05
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.03
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 97.03
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.03
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 97.01
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 97.01
3imf_A257 Short chain dehydrogenase; structural genomics, in 97.01
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.01
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.0
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 97.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 96.99
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 96.99
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 96.99
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 96.99
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.98
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 96.98
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 96.98
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 96.98
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 96.97
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 96.97
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 96.96
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 96.96
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 96.96
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 96.96
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.96
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 96.95
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 96.94
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 96.93
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 96.93
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 96.92
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 96.91
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 96.91
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 96.91
4eye_A342 Probable oxidoreductase; structural genomics, niai 96.91
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 96.9
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 96.9
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 96.89
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 96.88
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 96.88
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.88
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 96.85
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 96.85
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.84
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.84
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 96.84
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 96.83
7mdh_A 375 Protein (malate dehydrogenase); chloroplastic mala 96.83
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.82
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 96.82
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 96.82
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 96.82
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 96.82
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.82
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.82
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.82
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.82
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 96.81
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-36  Score=235.76  Aligned_cols=168  Identities=16%  Similarity=0.306  Sum_probs=155.8

Q ss_pred             CCeEEEEeCChhhHHHHHHHHHCCCeEEEEcCChHHHHHHHHcCCceecChhhhhcCCCEEEEeccChhhhhhhhcCccc
Q 044797            2 ASKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEG   81 (173)
Q Consensus         2 ~~~IgiiG~G~mG~~ia~~l~~~g~~V~~~d~~~~~~~~~~~~g~~~~~~~~~~~~~~dvii~~v~~~~~~~~v~~~~~~   81 (173)
                      |+||||||+|+||.+||++|+++||+|++|||++++.+.+.+.|++.++++.|+++++|+||+|+|++++++++++++++
T Consensus         3 M~kIgfIGlG~MG~~mA~~L~~~G~~v~v~dr~~~~~~~l~~~Ga~~a~s~~e~~~~~dvv~~~l~~~~~v~~V~~~~~g   82 (300)
T 3obb_A            3 MKQIAFIGLGHMGAPMATNLLKAGYLLNVFDLVQSAVDGLVAAGASAARSARDAVQGADVVISMLPASQHVEGLYLDDDG   82 (300)
T ss_dssp             CCEEEEECCSTTHHHHHHHHHHTTCEEEEECSSHHHHHHHHHTTCEECSSHHHHHTTCSEEEECCSCHHHHHHHHHSSSS
T ss_pred             cCEEEEeeehHHHHHHHHHHHhCCCeEEEEcCCHHHHHHHHHcCCEEcCCHHHHHhcCCceeecCCchHHHHHHHhchhh
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999987778


Q ss_pred             hhhcCCCCCEEEEcCCCCHHHHHHHHHHHhcCCceeeece-------------eeeeecCHhhHHHHHHHHHhhCC-cee
Q 044797           82 VLKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILER-------------MFLISSSIDCFTYLFLVKNEFFI-DKK  147 (173)
Q Consensus        82 i~~~l~~g~~ii~~st~~~~~~~~l~~~l~~~g~~~v~~~-------------~~~~~g~~~~~~~~~~~~~~~g~-~~~  147 (173)
                      +.+.+++|+++||+||++|.+.+++.+.++++|++|++++             +++++|+++++++++|+|+.+|. +.|
T Consensus        83 ~~~~~~~g~iiId~sT~~p~~~~~~a~~~~~~G~~~lDaPVsGg~~~A~~G~L~imvGG~~~~~~~~~p~l~~~g~~i~~  162 (300)
T 3obb_A           83 LLAHIAPGTLVLECSTIAPTSARKIHAAARERGLAMLDAPVSGGTAGAAAGTLTFMVGGDAEALEKARPLFEAMGRNIFH  162 (300)
T ss_dssp             STTSCCC-CEEEECSCCCHHHHHHHHHHHHTTTCEEEECCEESCHHHHHHTCEEEEEESCHHHHHHHHHHHHHHEEEEEE
T ss_pred             hhhcCCCCCEEEECCCCCHHHHHHHHHHHHHcCCEEEecCCCCCHHHHHhCCEEEEEeCCHHHHHHHHHHHHHhCCCEEE
Confidence            9999999999999999999999999999999999999875             77899999999999999999995 679


Q ss_pred             ecCCCchHhHhHHhHhhhHhhhh
Q 044797          148 VNISGQEIHWGYLKINYFIRVMT  170 (173)
Q Consensus       148 ~g~~Gsg~a~~~~~~~~~~~~~~  170 (173)
                      +|+.|+|.. .++++|+++-++.
T Consensus       163 ~G~~G~g~~-~Kl~~N~l~~~~~  184 (300)
T 3obb_A          163 AGPDGAGQV-AKVCNNQLLAVLM  184 (300)
T ss_dssp             EESTTHHHH-HHHHHHHHHHHHH
T ss_pred             eCCccHHHH-HHHHHHHHHHHHH
Confidence            999999966 5788888876554



>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d1vpda2161 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase 5e-10
d3cuma2162 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase 2e-08
d1pgja2178 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase 1e-04
d1i36a2152 c.2.1.6 (A:1-152) Conserved hypothetical protein M 6e-04
d2pgda2176 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase 0.001
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 161 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Hydroxyisobutyrate dehydrogenase
species: Salmonella typhimurium [TaxId: 90371]
 Score = 53.3 bits (127), Expect = 5e-10
 Identities = 20/102 (19%), Positives = 50/102 (49%)

Query: 4   KVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALV 63
           KVGF+GL      M+ +L+++GY +   + +   +      G   +++     +    ++
Sbjct: 2   KVGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVII 61

Query: 64  VVISHVDQIDDIFFGHEGVLKGLQKGAVIILQSTILPSHMQK 105
            ++ +   + ++  G  G+++G + G V+I  S+I P   ++
Sbjct: 62  TMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASRE 103


>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 162 Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 178 Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 152 Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 100.0
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.98
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.96
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.95
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.93
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.9
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.87
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.87
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.82
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.81
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.8
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.8
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.69
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.68
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.66
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.64
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.61
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.55
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.48
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.48
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.47
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.47
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.47
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 99.45
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.44
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 99.42
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.41
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.37
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.33
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 99.14
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 99.14
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 99.06
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 99.05
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 99.05
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 98.98
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.97
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.96
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.95
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 98.95
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.88
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.87
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 98.83
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 98.8
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.79
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.77
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.74
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 98.73
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.72
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.65
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 98.65
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 98.64
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.64
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.58
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 98.55
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 98.53
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 98.5
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.5
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 98.49
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 98.48
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.47
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.47
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 98.45
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 98.43
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 98.42
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 98.4
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 98.38
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 98.38
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 98.37
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 98.37
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 98.37
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 98.36
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.34
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.27
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.24
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.22
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 98.21
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 98.21
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.2
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 98.2
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 98.2
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 98.19
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 98.14
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 98.13
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 98.13
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 98.13
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 98.12
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 98.12
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 98.09
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 98.09
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 98.09
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 98.09
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 98.09
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 98.05
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.99
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.99
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 97.98
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.98
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.95
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 97.94
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.9
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.85
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.85
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.83
d1id1a_153 Rck domain from putative potassium channel Kch {Es 97.82
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.81
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 97.8
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 97.79
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 97.78
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 97.78
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 97.76
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.73
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.68
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.66
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.66
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 97.62
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 97.61
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 97.6
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 97.58
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.58
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.57
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 97.5
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.49
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.47
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.44
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.43
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 97.43
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 97.42
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.41
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.4
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 97.36
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 97.36
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.34
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 97.32
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 97.3
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.27
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.23
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.23
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.2
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 97.18
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.17
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.17
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.16
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.15
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 97.14
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.14
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.13
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 97.08
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 97.08
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.08
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.05
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 97.05
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.04
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.04
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.02
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.02
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 96.99
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.99
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.98
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.95
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.93
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.93
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.92
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.92
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 96.89
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.86
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.85
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.85
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.84
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.84
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.84
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 96.83
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.82
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.8
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.79
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.78
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 96.78
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.76
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 96.73
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.73
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 96.73
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.73
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.72
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.72
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 96.7
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 96.69
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 96.68
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.68
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.68
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.66
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.65
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.64
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.64
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.62
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.59
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 96.57
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.57
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 96.56
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.55
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.55
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 96.54
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.53
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.53
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.52
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 96.5
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 96.46
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.46
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.45
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 96.45
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.44
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 96.42
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.42
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 96.41
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 96.4
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 96.39
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 96.39
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 96.38
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 96.34
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 96.34
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.33
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 96.33
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.32
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 96.31
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 96.28
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.26
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.24
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.24
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.23
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 96.22
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.2
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.19
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 96.17
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 96.17
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.13
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.1
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 96.09
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 96.08
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 96.08
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.04
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 96.03
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 96.0
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.0
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 95.97
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 95.95
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 95.93
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.9
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 95.85
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 95.83
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.81
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 95.79
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 95.74
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 95.73
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.69
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.68
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 95.68
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 95.62
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 95.55
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 95.47
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.47
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 95.45
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 95.41
d5nula_138 Flavodoxin {Clostridium beijerinckii [TaxId: 1520] 95.4
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 95.39
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 95.34
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 95.29
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 95.26
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 95.25
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 95.21
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 95.15
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 95.15
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 95.13
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.13
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.05
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 95.02
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 94.95
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 94.93
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 94.91
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 94.72
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 94.71
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 94.68
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 94.68
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 94.65
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 94.62
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.57
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.56
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.55
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 94.44
d1l7da2194 Nicotinamide nucleotide transhydrogenase dI compon 94.43
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 94.34
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 94.25
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 94.25
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 94.23
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 94.23
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 94.19
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 94.17
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 94.15
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 94.15
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 94.11
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 94.11
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 94.02
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.92
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 93.89
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.88
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 93.87
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.87
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.84
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 93.78
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 93.74
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.71
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.65
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 93.61
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.6
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 93.58
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 93.52
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 93.49
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 93.49
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.45
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 93.43
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 93.41
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.17
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.12
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 93.1
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 93.03
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 92.91
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 92.83
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 92.79
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 92.78
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 92.73
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 92.72
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 92.67
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 92.66
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.46
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 92.44
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 92.43
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 92.43
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 92.43
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 92.31
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 92.28
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 92.12
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 92.1
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 92.02
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 91.93
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 91.82
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 91.81
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 91.8
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 91.79
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 91.7
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 91.63
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 91.63
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 91.5
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 91.48
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 91.23
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 91.14
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 91.12
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 90.92
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 90.84
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 90.73
d1pjca2193 L-alanine dehydrogenase {Phormidium lapideum [TaxI 90.73
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 90.49
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 90.37
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.27
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 90.15
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 90.05
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 90.0
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 89.89
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 89.86
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.79
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 89.75
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 89.25
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 89.21
d1iowa196 D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge 89.09
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 88.69
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 88.66
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 88.59
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 88.55
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 88.13
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 88.06
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 88.02
d1js1x2161 Transcarbamylase-like protein {Bacteroides fragili 87.99
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 87.76
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 87.71
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 87.17
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 87.14
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 86.52
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 86.12
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 85.96
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 85.9
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 85.63
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.51
d2ftsa3155 Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId 85.23
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 84.94
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 84.92
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 84.52
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 84.23
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 83.99
d2fz5a1137 Flavodoxin {Megasphaera elsdenii [TaxId: 907]} 83.78
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 83.71
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.67
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 83.47
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 83.46
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 83.44
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.37
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 83.35
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 82.94
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.83
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 82.69
d1sqsa_232 Hypothetical protein SP1951 {(Streptococcus pneumo 82.18
d1rtta_174 Hypothetical protein PA1204 {Pseudomonas aeruginos 82.08
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 81.9
d1d4aa_273 NAD(P)H:quinone reductase {Human (Homo sapiens) [T 81.25
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 80.75
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 80.74
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 80.7
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 80.55
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 80.41
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 80.09
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Hydroxyisobutyrate dehydrogenase
species: Salmonella typhimurium [TaxId: 90371]
Probab=100.00  E-value=3.9e-33  Score=197.34  Aligned_cols=147  Identities=14%  Similarity=0.313  Sum_probs=137.5

Q ss_pred             CeEEEEeCChhhHHHHHHHHHCCCeEEEEcCChHHHHHHHHcCCceecChhhhhcCCCEEEEeccChhhhhhhhcCccch
Q 044797            3 SKVGFVGLDEYSVDMAASLIRSGYKVQAFEISDPLVDKFFMLGGIRSASPMDAGKDVSALVVVISHVDQIDDIFFGHEGV   82 (173)
Q Consensus         3 ~~IgiiG~G~mG~~ia~~l~~~g~~V~~~d~~~~~~~~~~~~g~~~~~~~~~~~~~~dvii~~v~~~~~~~~v~~~~~~i   82 (173)
                      |||||||+|+||.+||++|+++|++|++|||++++.+.+.+.+.....++.++++++|+|++|+|++.+++++++..+++
T Consensus         1 MkIgiIGlG~MG~~~A~~L~~~G~~V~~~d~~~~~~~~~~~~~~~~~~~~~e~~~~~d~ii~~v~~~~~v~~v~~~~~~~   80 (161)
T d1vpda2           1 MKVGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVIITMLPNSPHVKEVALGENGI   80 (161)
T ss_dssp             CEEEEECCSTTHHHHHHHHHHTTCEEEEECSCHHHHHHHHHTTCEECSSHHHHHHHCSEEEECCSSHHHHHHHHHSTTCH
T ss_pred             CEEEEEehhHHHHHHHHHHHHCCCeEEEEeCCcchhHHHHHhhhhhcccHHHHHhCCCeEEEEcCCHHHHHHHHhCCcch
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999776778


Q ss_pred             hhcCCCCCEEEEcCCCCHHHHHHHHHHHhcCCceeeece-------------eeeeecCHhhHHHHHHHHHhhCC-ceee
Q 044797           83 LKGLQKGAVIILQSTILPSHMQKLEKTFTGNLTFYILER-------------MFLISSSIDCFTYLFLVKNEFFI-DKKV  148 (173)
Q Consensus        83 ~~~l~~g~~ii~~st~~~~~~~~l~~~l~~~g~~~v~~~-------------~~~~~g~~~~~~~~~~~~~~~g~-~~~~  148 (173)
                      .+.+++|++|+|+||.+|++.+++.+.+++++++|++.+             +++++|+++.+++++++|+.+|. ++|+
T Consensus        81 ~~~~~~g~iiid~sT~~p~~~~~~~~~~~~~g~~~vdapv~gg~~~a~~g~l~~~~gG~~~~~~~~~~il~~~~~~i~~~  160 (161)
T d1vpda2          81 IEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDAPVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHT  160 (161)
T ss_dssp             HHHCCTTCEEEECSCCCHHHHHHHHHHHHTTTCEEEECCEESHHHHHHHTCEEEEEESCHHHHHHHHHHHHTTEEEEEEE
T ss_pred             hhccCCCCEEEECCCCCHHHHHHHHHHHHHcCCceecccccCChhHHhcCCeEEEEcCCHHHHHHHHHHHHHhcCceEEC
Confidence            899999999999999999999999999999999999864             77889999999999999999985 5676


Q ss_pred             c
Q 044797          149 N  149 (173)
Q Consensus       149 g  149 (173)
                      |
T Consensus       161 G  161 (161)
T d1vpda2         161 G  161 (161)
T ss_dssp             E
T ss_pred             C
Confidence            5



>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ftsa3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Back     information, alignment and structure
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4aa_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure