Citrus Sinensis ID: 044868

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460---
MNSPLAFSFPLLLLLLFFFLSSIPSVSTISPHAKKQPPNGMLPSEAETLFKIMDSMSSDQSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRSNPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPAEAYSVKIGIGVSICGSNKNGSLIKPVKKSQAPRGLQKSFSLFPALGAFALHYMLFLV
ccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccccccEEEEEEEccccccccccccEEccccccccccccEEEcccccccccEEEcccccccccccccEEcccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccEEcccccccccccHHHHccccccccccccccccccccHHccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccEEcccccccccccHHHHccccccEEEcccccccccccccHHcccccccEEcccccccHHHHHHHHHHHHcc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEccccccEEEEEEEEEEEEEcccccccccccHHHcccccccEEEEccccccccccccccHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccccccHHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHcHccHHHHHHHEccccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccHccc
mnsplafsFPLLLLLLFFFLssipsvstisphakkqppngmlpsEAETLFKIMDsmssdqswrvsysnpckpgsswpgieckqgndgylhvtrldfgtrpnptckktatfpyqiFSLSYLQSVFFFScfthtkttlsVSADRLYNSSLqqlslrsnpalvgpippqisslKFLQILTLSQnrlngqipvkIFSLNSLVHLDLSYnllagtipvqvgnlRNLVGLdlsynsltgsipstigqlgmlqkldlssnsltgsipdsIDKLSLLAFMALSnnkltgnfpkGLAKLQSLQYFlmddnpmfiplpvEFGILVKLQELRlansgysgsippsfsqlnnlstlslqnnrltgeipvVFGSLSHIYHLnlsrnfldgvvpfNSSFLKRLGrnldlsgnpglclnpaeaysVKIGIGVSicgsnkngslikpvkksqaprglqksfslfPALGAFALHYMLFLV
MNSPLAFSFPLLLLLLFFFLSSIPSVSTisphakkqppngMLPSEAETLFKIMDSMSSDQSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRSNPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPAEAYSVKIGIGVSICGSNKNGSLIKPVKKSQAPRGLQKSFSLFPALGAFALHYMLFLV
MNsplafsfpllllllffflssipsVSTISPHAKKQPPNGMLPSEAETLFKIMDSMSSDQSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVSADrlynsslqqlslrsnPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPsfsqlnnlstlslqnnRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPAEAYSVKIGIGVSICGSNKNGSLIKPVKKSQAPRGLQKSFSLFPALGAFALHYMLFLV
****LAFSFPLLLLLLFFFLSSIP**************************************************SWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRSNPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSI***FSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPAEAYSVKIGIGVSICGSNKNGSLI************QKSFSLFPALGAFALHYMLFL*
*****AF*FPLLLLLLFFFLSSIPSVSTISPH***********SEAETLFKIMDSMSS*QSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRSNPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPAEAYSVKIGIGVSICGSNKNGSLIKPVKKSQAPRGLQKSFSLFPALGAFALHYMLFLV
MNSPLAFSFPLLLLLLFFFLSSIPSVS*************MLPSEAETLFKIMDSM****************GSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRSNPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPAEAYSVKIGIGVSICGSNKNGSLIKP********GLQKSFSLFPALGAFALHYMLFLV
***PLAFSFPLLLLLLFFFLSSIPSVSTISPHAKKQPPNGMLPSEAETLFKIMDSMSSDQSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRSNPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPAEAYSVKIGIGVSICGSNKNGSLIKPVKKSQAPRGLQKSFSLFPALGAFALHYM****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSPLAFSFPLLLLLLFFFLSSIPSVSTISPHAKKQPPNGMLPSEAETLFKIMDSMSSDQSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRSNPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPAEAYSVKIGIGVSICGSNKNGSLIKPVKKSQAPRGLQKSFSLFPALGAFALHYMLFLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query463 2.2.26 [Sep-21-2011]
Q9SSD1496 Protein TOO MANY MOUTHS O no no 0.805 0.752 0.380 2e-57
Q5PP26424 Piriformospora indica-ins no no 0.784 0.856 0.324 6e-42
C0LGV1 1135 LRR receptor-like serine/ no no 0.755 0.308 0.312 2e-37
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.710 0.262 0.318 6e-36
Q9LHP4 1141 Receptor-like protein kin no no 0.516 0.209 0.419 3e-35
Q9SHI2 1101 Leucine-rich repeat recep no no 0.546 0.229 0.377 1e-34
C0LGS2 1136 Probable LRR receptor-lik no no 0.460 0.187 0.401 5e-34
O49318 1124 Probable leucine-rich rep no no 0.585 0.241 0.358 5e-34
Q42371 976 LRR receptor-like serine/ no no 0.611 0.289 0.345 2e-33
Q9FL28 1173 LRR receptor-like serine/ no no 0.619 0.244 0.349 1e-32
>sp|Q9SSD1|TMM_ARATH Protein TOO MANY MOUTHS OS=Arabidopsis thaliana GN=TMM PE=2 SV=1 Back     alignment and function desciption
 Score =  223 bits (568), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 149/392 (38%), Positives = 209/392 (53%), Gaps = 19/392 (4%)

Query: 43  PSEAETLFKIMDSMSSDQSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPN- 101
           P E + ++ IM +  +D  W  +  + C+    W GIEC    D   HV  L FG   + 
Sbjct: 56  PDEQDAVYDIMRATGND--WAAAIPDVCR--GRWHGIECMPDQDNVYHVVSLSFGALSDD 111

Query: 102 ---PTCKKTATFPYQ-IFSLSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRSNP 157
              PTC    ++  + +  L +L+++FF+ C       +     RL  SSLQ L LR N 
Sbjct: 112 TAFPTCDPQRSYVSESLTRLKHLKALFFYRCLGRAPQRIPAFLGRL-GSSLQTLVLREN- 169

Query: 158 ALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGN 217
             +GPIP ++ +L  L++L L +N LNG IP+     + L  LDLS N L G+IP  V  
Sbjct: 170 GFLGPIPDELGNLTNLKVLDLHKNHLNGSIPLSFNRFSGLRSLDLSGNRLTGSIPGFV-- 227

Query: 218 LRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNN 277
           L  L  LDL+ N LTG +P T+   G L K+DLS N +TG IP+SI++L+ L  + LS N
Sbjct: 228 LPALSVLDLNQNLLTGPVPPTLTSCGSLIKIDLSRNRVTGPIPESINRLNQLVLLDLSYN 287

Query: 278 KLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVE--FGILVKLQELRLANSGYSGSIPPSF 335
           +L+G FP  L  L SLQ  ++  N  F     E  F  L  L  L L+N+   GSIP S 
Sbjct: 288 RLSGPFPSSLQGLNSLQALMLKGNTKFSTTIPENAFKGLKNLMILVLSNTNIQGSIPKSL 347

Query: 336 SQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDL 395
           ++LN+L  L L+ N LTGEIP+ F  + H+  L L+ N L G VPF    + R+ R L L
Sbjct: 348 TRLNSLRVLHLEGNNLTGEIPLEFRDVKHLSELRLNDNSLTGPVPFERDTVWRMRRKLRL 407

Query: 396 SGNPGLCLNP----AEAYSVKIGIGVSICGSN 423
             N GLC+N      +A+  K G  V +C + 
Sbjct: 408 YNNAGLCVNRDSDLDDAFGSKSGSTVRLCDAE 439
May participate in the initiation of asymmetric divisions that form stomata by sensing positional cues during epidermal development.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5PP26|PII2_ARATH Piriformospora indica-insensitive protein 2 OS=Arabidopsis thaliana GN=PII-2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query463
359485172427 PREDICTED: LRR receptor-like serine/thre 0.904 0.981 0.730 1e-169
224130356398 predicted protein [Populus trichocarpa] 0.825 0.959 0.761 1e-164
255558758457 serine-threonine protein kinase, plant-t 0.911 0.923 0.756 1e-162
297827983468 leucine-rich repeat family protein [Arab 0.909 0.899 0.684 1e-155
15228004462 receptor like protein 29 [Arabidopsis th 0.946 0.948 0.651 1e-153
449533461446 PREDICTED: LRR receptor-like serine/thre 0.911 0.946 0.663 1e-151
449450874449 PREDICTED: LRR receptor-like serine/thre 0.911 0.939 0.663 1e-151
242054279474 hypothetical protein SORBIDRAFT_03g03352 0.827 0.808 0.573 1e-121
297724271471 Os05g0530701 [Oryza sativa Japonica Grou 0.842 0.828 0.558 1e-119
45642725523 unknown protein [Oryza sativa Japonica G 0.842 0.745 0.558 1e-119
>gi|359485172|ref|XP_002280055.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA-like [Vitis vinifera] gi|147832384|emb|CAN62290.1| hypothetical protein VITISV_017315 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 312/427 (73%), Positives = 352/427 (82%), Gaps = 8/427 (1%)

Query: 41  MLPSEAETLFKIMDSMSSDQSWRVSYSNPCKPGSSWPGIECKQG-NDGYLHVTRLDFGTR 99
           M PSEAETLF IMDSMSSD +WR+S+ NPC   SSWPGIECK G ND  LHV+RLDFG+ 
Sbjct: 1   MDPSEAETLFNIMDSMSSDHTWRISFPNPCNSASSWPGIECKPGQNDKLLHVSRLDFGSP 60

Query: 100 PNPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVS--ADRLYNSSLQQLSLRSNP 157
           PNP+CK TATFP Q+F+L YLQS+FFF CFT TKT +S+   +     SSLQQLSLRSNP
Sbjct: 61  PNPSCKTTATFPSQVFTLPYLQSLFFFHCFTQTKTNISLPLLSHPSNASSLQQLSLRSNP 120

Query: 158 ALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGN 217
           ALVGPIP QISSL  LQILTLSQNRL G+IPV+IFSLNSLVHLDLSYNLL G IP Q+G+
Sbjct: 121 ALVGPIPSQISSLHSLQILTLSQNRLAGRIPVQIFSLNSLVHLDLSYNLLTGPIPPQLGS 180

Query: 218 LRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNN 277
           LRNLVGLDLSYNSL+GSIP TIGQ+G+LQK DLSSN L G+IPDSI+KL+ L FMALS+N
Sbjct: 181 LRNLVGLDLSYNSLSGSIPDTIGQMGLLQKFDLSSNFLVGNIPDSIEKLNSLVFMALSSN 240

Query: 278 KLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQ 337
           +L G FP+GLAKLQSLQYF+MDDNPMFIPLP EFG L+KLQELR+ANSGYSG+IP SFS 
Sbjct: 241 RLGGKFPQGLAKLQSLQYFIMDDNPMFIPLPEEFGKLMKLQELRVANSGYSGTIPTSFSH 300

Query: 338 LNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSG 397
           L NLSTLSLQNNRLTGEIP  FGSLSHIYHLNLSRN L G+VPFNS FLKRLGRNLDLS 
Sbjct: 301 LTNLSTLSLQNNRLTGEIPEGFGSLSHIYHLNLSRNMLAGIVPFNSIFLKRLGRNLDLSA 360

Query: 398 NPGLCLNPAEAYSVKIGIGVSICGSNKNGSLIKPVKKSQAPRGLQKSFSLFP---ALGAF 454
           NPGLCL+P+EAY VK  IGV++CG+N+  S I+P  KS+AP GL KS  L          
Sbjct: 361 NPGLCLSPSEAYGVK--IGVNVCGTNRTVSTIQPFNKSEAPSGLCKSLFLLCFILCTSVL 418

Query: 455 ALHYMLF 461
           ALH++ F
Sbjct: 419 ALHHISF 425

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224130356|ref|XP_002328588.1| predicted protein [Populus trichocarpa] gi|222838570|gb|EEE76935.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558758|ref|XP_002520403.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223540450|gb|EEF42019.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297827983|ref|XP_002881874.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297327713|gb|EFH58133.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15228004|ref|NP_181808.1| receptor like protein 29 [Arabidopsis thaliana] gi|4512674|gb|AAD21728.1| hypothetical protein [Arabidopsis thaliana] gi|66792706|gb|AAY56455.1| At2g42800 [Arabidopsis thaliana] gi|330255076|gb|AEC10170.1| receptor like protein 29 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449533461|ref|XP_004173694.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449450874|ref|XP_004143187.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|242054279|ref|XP_002456285.1| hypothetical protein SORBIDRAFT_03g033520 [Sorghum bicolor] gi|241928260|gb|EES01405.1| hypothetical protein SORBIDRAFT_03g033520 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|297724271|ref|NP_001174499.1| Os05g0530701 [Oryza sativa Japonica Group] gi|48843812|gb|AAT47071.1| putative leucine-rich repeat protein [Oryza sativa Japonica Group] gi|222632326|gb|EEE64458.1| hypothetical protein OsJ_19307 [Oryza sativa Japonica Group] gi|255676514|dbj|BAH93227.1| Os05g0530701 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|45642725|gb|AAS72353.1| unknown protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query463
TAIR|locus:2052367462 RLP29 "receptor like protein 2 0.898 0.900 0.625 1e-132
TAIR|locus:2016319496 TMM "TOO MANY MOUTHS" [Arabido 0.799 0.745 0.341 1.4e-48
TAIR|locus:2139880450 RIC7 "ROP-interactive CRIB mot 0.781 0.804 0.322 3.2e-42
TAIR|locus:2012433432 AT1G68780 [Arabidopsis thalian 0.809 0.868 0.311 4.8e-39
TAIR|locus:2102330475 AT3G25670 [Arabidopsis thalian 0.887 0.865 0.280 4.9e-37
TAIR|locus:2031880424 AT1G13230 [Arabidopsis thalian 0.775 0.846 0.297 1e-36
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.516 0.209 0.398 3.9e-35
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.522 0.219 0.351 6.9e-34
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.479 0.198 0.378 3.2e-33
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.518 0.216 0.352 6.8e-33
TAIR|locus:2052367 RLP29 "receptor like protein 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1301 (463.0 bits), Expect = 1.0e-132, P = 1.0e-132
 Identities = 265/424 (62%), Positives = 305/424 (71%)

Query:    41 MLPSEAETLFKIMDSMSSDQSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRP 100
             M PSE+ETLFKIM+SMSSDQ WR S+ NPC PGSSWPGIECK G D   HV+RLDFG+ P
Sbjct:    35 MPPSESETLFKIMESMSSDQQWRQSHPNPCAPGSSWPGIECKTGPDHLSHVSRLDFGSAP 94

Query:   101 NPTCKKTATFPYQIFSLSYLQSVFFFSCFTHTKTTLSVSADXXXXXXXXXXXXXXXPALV 160
             NP+CK +A+FP  IF+L +LQSVFFF+CFTH  TT+                    P+L 
Sbjct:    95 NPSCKSSASFPSSIFTLPFLQSVFFFNCFTHFPTTIMFPIKLIPNSSLQQLSLRSNPSLS 154

Query:   161 GPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIPVQVGNLRN 220
             G IPP+ISSLK LQILTLSQNRL G IP  IFSL SLVHLDLSYN L G IP+Q+GNL N
Sbjct:   155 GQIPPRISSLKSLQILTLSQNRLTGDIPPAIFSLKSLVHLDLSYNKLTGKIPLQLGNLNN 214

Query:   221 LVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNNKLT 280
             LVGLDLSYNSLTG+IP TI QLGMLQKLDLSSNSL G IP+ ++KL  L+FMALSNNKL 
Sbjct:   215 LVGLDLSYNSLTGTIPPTISQLGMLQKLDLSSNSLFGRIPEGVEKLRSLSFMALSNNKLK 274

Query:   281 GNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPXXXXXXX 340
             G FPKG++ LQSLQYF+MD+NPMF+ LPVE G L KLQEL+L NSGYSG IP        
Sbjct:   275 GAFPKGISNLQSLQYFIMDNNPMFVALPVELGFLPKLQELQLENSGYSGVIPESYTKLTN 334

Query:   341 XXXXXXXXXRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPG 400
                      RLTGEIP  F SL H++HLNLSRN L GVVPF+SSFL+RLG+NLDLSGN G
Sbjct:   335 LSSLSLANNRLTGEIPSGFESLPHVFHLNLSRNLLIGVVPFDSSFLRRLGKNLDLSGNRG 394

Query:   401 LCLNPAEAYSVKIGIGVSICGSN-KNG---SLIKPVKKSQAPRGLQKSF---SLFPALGA 453
             LCLNP + +SV +  GV +CG N  +G   S+    KKSQA R  +  F   +LFP    
Sbjct:   395 LCLNPEDEFSV-VKTGVDVCGKNVSSGGGLSVHSSKKKSQASRYYRSCFFANALFPFALF 453

Query:   454 FALH 457
               LH
Sbjct:   454 LGLH 457
GO:0005886 "plasma membrane" evidence=ISM
GO:0031225 "anchored to membrane" evidence=TAS
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2016319 TMM "TOO MANY MOUTHS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139880 RIC7 "ROP-interactive CRIB motif-containing protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012433 AT1G68780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102330 AT3G25670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031880 AT1G13230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query463
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-43
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-28
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  161 bits (409), Expect = 8e-43
 Identities = 102/246 (41%), Positives = 146/246 (59%), Gaps = 1/246 (0%)

Query: 146 SSLQQLSLRSNPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYN 205
           SSL+ L L  N  LVG IP  +++L  L+ LTL+ N+L GQIP ++  + SL  + L YN
Sbjct: 164 SSLKVLDLGGN-VLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYN 222

Query: 206 LLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDK 265
            L+G IP ++G L +L  LDL YN+LTG IPS++G L  LQ L L  N L+G IP SI  
Sbjct: 223 NLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFS 282

Query: 266 LSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANS 325
           L  L  + LS+N L+G  P+ + +LQ+L+   +  N     +PV    L +LQ L+L ++
Sbjct: 283 LQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSN 342

Query: 326 GYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSF 385
            +SG IP +  + NNL+ L L  N LTGEIP    S  +++ L L  N L+G +P +   
Sbjct: 343 KFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGA 402

Query: 386 LKRLGR 391
            + L R
Sbjct: 403 CRSLRR 408

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 463
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.8
KOG0617264 consensus Ras suppressor protein (contains leucine 99.77
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
KOG4237498 consensus Extracellular matrix protein slit, conta 99.7
PLN03150623 hypothetical protein; Provisional 99.62
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.4
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.39
PLN03150623 hypothetical protein; Provisional 99.39
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.38
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.2
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.2
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.04
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.71
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.57
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.41
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.4
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.37
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.27
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.24
PRK15386 426 type III secretion protein GogB; Provisional 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.9
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.88
PRK15386426 type III secretion protein GogB; Provisional 97.73
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.69
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.61
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.57
KOG4341483 consensus F-box protein containing LRR [General fu 97.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.36
KOG4341483 consensus F-box protein containing LRR [General fu 97.29
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.96
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.94
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.86
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.68
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.25
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.25
KOG4308478 consensus LRR-containing protein [Function unknown 95.94
KOG4308478 consensus LRR-containing protein [Function unknown 95.79
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.17
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.69
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.27
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 91.23
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.97
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 87.96
smart0037026 LRR Leucine-rich repeats, outliers. 87.5
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.5
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.62
smart0037026 LRR Leucine-rich repeats, outliers. 86.24
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.24
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.1
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.06
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.95
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-43  Score=397.14  Aligned_cols=336  Identities=35%  Similarity=0.516  Sum_probs=223.9

Q ss_pred             HHHHHHHHHHHHhCCCC----CCCCCCCCCCCCCCCCccceEeCCCCCCcccEEEEECCCCCCCCCCccccccccccCCC
Q 044868           43 PSEAETLFKIMDSMSSD----QSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFSLS  118 (463)
Q Consensus        43 ~~~~~aLl~~~~~~~~~----~~W~~~~~~~C~~~~~w~gv~C~~~~~~~~~v~~l~L~~~~~~~~~~~g~l~~~l~~l~  118 (463)
                      ++|++||++||+++.++    .+|+. ..|||.    |.||+|+..    ++|++|+|++.     .+.|.+++.+..++
T Consensus        28 ~~~~~~l~~~~~~~~~~~~~~~~w~~-~~~~c~----w~gv~c~~~----~~v~~L~L~~~-----~i~~~~~~~~~~l~   93 (968)
T PLN00113         28 AEELELLLSFKSSINDPLKYLSNWNS-SADVCL----WQGITCNNS----SRVVSIDLSGK-----NISGKISSAIFRLP   93 (968)
T ss_pred             HHHHHHHHHHHHhCCCCcccCCCCCC-CCCCCc----CcceecCCC----CcEEEEEecCC-----CccccCChHHhCCC
Confidence            47999999999998644    46864 357886    999999854    49999999743     45677777888888


Q ss_pred             CCCEEEcccCCCCCccccccccc-ccCCCCccEEEccCCCCCCCCCchhcCCCCCCcEEEeecCCCCCCCccccCCCCCC
Q 044868          119 YLQSVFFFSCFTHTKTTLSVSAD-RLYNSSLQQLSLRSNPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSL  197 (463)
Q Consensus       119 ~L~~L~L~~~~~~~~~~ip~~~~-~l~~~~L~~L~Ls~n~~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  197 (463)
                      +|++|++++|.+  .+.+|..+. .+++  |++|+|++| .+.+.+|.  +.+++|++|+|++|.+++.+|..++++++|
T Consensus        94 ~L~~L~Ls~n~~--~~~ip~~~~~~l~~--L~~L~Ls~n-~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L  166 (968)
T PLN00113         94 YIQTINLSNNQL--SGPIPDDIFTTSSS--LRYLNLSNN-NFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSL  166 (968)
T ss_pred             CCCEEECCCCcc--CCcCChHHhccCCC--CCEEECcCC-ccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCC
Confidence            888888888765  456776654 5665  777777777 66666553  345666666666666666666666666666


Q ss_pred             cEEEcccCCCCCCCchhcCCCCCCCEEEcccCcCCCCCchhhcCCCCcCEEeccCCCCCCCCchhhhcCCCCCEEEeeCC
Q 044868          198 VHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLLAFMALSNN  277 (463)
Q Consensus       198 ~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n  277 (463)
                      ++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..++++++|++|++++|++++.+|..++++++|++|++++|
T Consensus       167 ~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n  246 (968)
T PLN00113        167 KVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYN  246 (968)
T ss_pred             CEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCc
Confidence            66666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             CCCCCCchhhhCCCCCcEeecCCCCCCCCCchhhhCCCCCCEEeccCCCCCCCCccccCCCCcccEEEcccccCCCCchh
Q 044868          278 KLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPV  357 (463)
Q Consensus       278 ~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~  357 (463)
                      .+++.+|..++++++|++|++++|.+.+.+|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+++.+|.
T Consensus       247 ~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~  326 (968)
T PLN00113        247 NLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPV  326 (968)
T ss_pred             eeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCCh
Confidence            66666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             hhCCCCCCCeEEccCCCCCccCCCCchhhhccCCeEeccCCCC
Q 044868          358 VFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPG  400 (463)
Q Consensus       358 ~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~~L~L~~N~~  400 (463)
                      .+..+++|+.|++++|.+++.+|..+..++.+ +.|++++|.+
T Consensus       327 ~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L-~~L~Ls~n~l  368 (968)
T PLN00113        327 ALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNL-TVLDLSTNNL  368 (968)
T ss_pred             hHhcCCCCCEEECcCCCCcCcCChHHhCCCCC-cEEECCCCee
Confidence            66666666666666666666555555555555 5566665543

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query463
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-21
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-18
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-20
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-19
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 9e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-05
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 6e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 7e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 1e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 4e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 4e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 4e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 4e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 4e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 4e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 4e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 7e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 7e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 113/236 (47%), Gaps = 7/236 (2%)
Query: 159 LVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLNSLVHLDLSYNLLAGTIP-VQVGN 217
           L G     IS+   L++L +S N+  G IP     L SL +L L+ N   G IP    G 
Sbjct: 232 LSGDFSRAISTCTELKLLNISSNQFVGPIPP--LPLKSLQYLSLAENKFTGEIPDFLSGA 289
Query: 218 LRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIP-DSIDKLSLLAFMALSN 276
              L GLDLS N   G++P   G   +L+ L LSSN+ +G +P D++ K+  L  + LS 
Sbjct: 290 CDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF 349
Query: 277 NKLTGNFPKGLAKLQ-SLQYFLMDDNPMFIPLPVEFGILVK--LQELRLANSGYSGSIPP 333
           N+ +G  P+ L  L  SL    +  N    P+        K  LQEL L N+G++G IPP
Sbjct: 350 NEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP 409
Query: 334 XXXXXXXXXXXXXXXXRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRL 389
                            L+G IP   GSLS +  L L  N L+G +P    ++K L
Sbjct: 410 TLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 465
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query463
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-42
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-63
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-56
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-53
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-51
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-41
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-39
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-37
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-36
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-26
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-34
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-36
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-34
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-25
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-31
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-29
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-27
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-26
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-26
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-24
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-22
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-17
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-16
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  220 bits (563), Expect = 1e-68
 Identities = 80/263 (30%), Positives = 126/263 (47%), Gaps = 7/263 (2%)

Query: 146 SSLQQLSLRSNP-ALVGPIPPQISSLKFLQILTLS-QNRLNGQIPVKIFSLNSLVHLDLS 203
             +  L L         PIP  +++L +L  L +   N L G IP  I  L  L +L ++
Sbjct: 50  YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYIT 109

Query: 204 YNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSI 263
           +  ++G IP  +  ++ LV LD SYN+L+G++P +I  L  L  +    N ++G+IPDS 
Sbjct: 110 HTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSY 169

Query: 264 DKL-SLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRL 322
                L   M +S N+LTG  P   A L +L +  +  N +     V FG     Q++ L
Sbjct: 170 GSFSKLFTSMTISRNRLTGKIPPTFANL-NLAFVDLSRNMLEGDASVLFGSDKNTQKIHL 228

Query: 323 ANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLSRNFLDGVVPFN 382
           A +  +  +        NL+ L L+NNR+ G +P     L  ++ LN+S N L G +P  
Sbjct: 229 AKNSLAFDL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-Q 286

Query: 383 SSFLKRLGRNLDLSGNPGLCLNP 405
              L+R       + N  LC +P
Sbjct: 287 GGNLQRFD-VSAYANNKCLCGSP 308
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query463
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.98
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.93
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.92
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.85
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.78
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.77
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.77
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.52
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.36
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.08
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.03
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.9
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.87
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.59
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.0
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.48
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.44
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.49
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=2.6e-45  Score=357.70  Aligned_cols=301  Identities=31%  Similarity=0.505  Sum_probs=226.0

Q ss_pred             CCCHHHHHHHHHHHHhCCCC---CCCCCCCCCCCCCCCCccceEeCCCCCCcccEEEEECCCCCCCCCCccccccccccC
Q 044868           40 GMLPSEAETLFKIMDSMSSD---QSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFS  116 (463)
Q Consensus        40 ~~~~~~~~aLl~~~~~~~~~---~~W~~~~~~~C~~~~~w~gv~C~~~~~~~~~v~~l~L~~~~~~~~~~~g~l~~~l~~  116 (463)
                      .|.++|++||++||+++.++   .+|.. +.|||.  +.|.||+|+..+ ..++|++|                      
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~~l~~W~~-~~~~C~--~~w~gv~C~~~~-~~~~l~~L----------------------   55 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPTTLSSWLP-TTDCCN--RTWLGVLCDTDT-QTYRVNNL----------------------   55 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCT-TSCTTT--TCSTTEEECCSS-SCCCEEEE----------------------
T ss_pred             CCCHHHHHHHHHHHHhcCCcccccCCCC-CCCCCc--CCCcceEeCCCC-CCceEEEE----------------------
Confidence            58899999999999999764   47965 357884  359999997531 01244444                      


Q ss_pred             CCCCCEEEcccCCCCCcccccccccccCCCCccEEEccCCCCCCC--CCchhcCCCCCCcEEEeec-CCCCCCCccccCC
Q 044868          117 LSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRSNPALVG--PIPPQISSLKFLQILTLSQ-NRLNGQIPVKIFS  193 (463)
Q Consensus       117 l~~L~~L~L~~~~~~~~~~ip~~~~~l~~~~L~~L~Ls~n~~l~~--~~p~~l~~l~~L~~L~L~~-n~l~~~~p~~l~~  193 (463)
                                                         ++++| .+.+  .+|..++++++|++|++++ |.+.+.+|..+.+
T Consensus        56 -----------------------------------~L~~~-~l~~~~~~~~~l~~l~~L~~L~L~~~n~l~~~~p~~l~~   99 (313)
T 1ogq_A           56 -----------------------------------DLSGL-NLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAK   99 (313)
T ss_dssp             -----------------------------------EEECC-CCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGG
T ss_pred             -----------------------------------ECCCC-CccCCcccChhHhCCCCCCeeeCCCCCcccccCChhHhc
Confidence                                               44444 4555  5556666666666666663 6666666666666


Q ss_pred             CCCCcEEEcccCCCCCCCchhcCCCCCCCEEEcccCcCCCCCchhhcCCCCcCEEeccCCCCCCCCchhhhcCC-CCCEE
Q 044868          194 LNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLS-LLAFM  272 (463)
Q Consensus       194 l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~-~L~~L  272 (463)
                      +++|++|++++|.+++.+|..+.++++|++|++++|.+++.+|..+..+++|++|++++|++++.+|..+..++ +|++|
T Consensus       100 l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L  179 (313)
T 1ogq_A          100 LTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSM  179 (313)
T ss_dssp             CTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEE
T ss_pred             CCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcEE
Confidence            66666666666666666666666666666666666666666666666777777777777777666777777776 77777


Q ss_pred             EeeCCCCCCCCchhhhCCCCCcEeecCCCCCCCCCchhhhCCCCCCEEeccCCCCCCCCccccCCCCcccEEEcccccCC
Q 044868          273 ALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLT  352 (463)
Q Consensus       273 ~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~  352 (463)
                      ++++|.+++.+|..+..++ |++|++++|.+.+..|..+..+++|++|++++|.+++.+|. +..+++|++|++++|+++
T Consensus       180 ~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~-~~~l~~L~~L~Ls~N~l~  257 (313)
T 1ogq_A          180 TISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIY  257 (313)
T ss_dssp             ECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGG-CCCCTTCCEEECCSSCCE
T ss_pred             ECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeecCc-ccccCCCCEEECcCCccc
Confidence            7777777777777777776 88888888888777788888888888888888888866655 778899999999999999


Q ss_pred             CCchhhhCCCCCCCeEEccCCCCCccCCCCchhhhccCCeEeccCCCCCCCCcc
Q 044868          353 GEIPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPA  406 (463)
Q Consensus       353 ~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~~L~L~~N~~~c~~~~  406 (463)
                      +.+|..+..+++|++|++++|+++|.+|.. ..++.+ +.+++++|++.|+.|.
T Consensus       258 ~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~-~~l~~L-~~l~l~~N~~lc~~p~  309 (313)
T 1ogq_A          258 GTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRF-DVSAYANNKCLCGSPL  309 (313)
T ss_dssp             ECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGS-CGGGTCSSSEEESTTS
T ss_pred             CcCChHHhcCcCCCEEECcCCcccccCCCC-cccccc-ChHHhcCCCCccCCCC
Confidence            899999999999999999999999999976 778899 8999999999998654
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 463
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-12
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-07
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 82.7 bits (203), Expect = 8e-18
 Identities = 51/207 (24%), Positives = 86/207 (41%), Gaps = 17/207 (8%)

Query: 192 FSLNSLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLS 251
             L +L  L  + N ++   P+    L NL  L L+ N L      T+  L  L  LDL+
Sbjct: 194 AKLTNLESLIATNNQISDITPLG--ILTNLDELSLNGNQLKD--IGTLASLTNLTDLDLA 249

Query: 252 SNSLTGSIPDSIDKLSLLAFMALSNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEF 311
           +N ++   P  +  L+ L  + L  N+++   P  LA L +L    +++N +        
Sbjct: 250 NNQISNLAP--LSGLTKLTELKLGANQISNISP--LAGLTALTNLELNENQLEDI--SPI 303

Query: 312 GILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGEIPVVFGSLSHIYHLNLS 371
             L  L  L L  +  S   P   S L  L  L   NN+++        +L++I  L+  
Sbjct: 304 SNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAG 359

Query: 372 RNFLDGVVPFNSSFLKRLGRNLDLSGN 398
            N +  + P   + L R+   L L+  
Sbjct: 360 HNQISDLTPL--ANLTRI-TQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query463
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.95
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.62
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.42
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.39
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.91
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.32
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.32
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=4.5e-44  Score=346.50  Aligned_cols=303  Identities=31%  Similarity=0.492  Sum_probs=196.1

Q ss_pred             CCCHHHHHHHHHHHHhCCCC---CCCCCCCCCCCCCCCCccceEeCCCCCCcccEEEEECCCCCCCCCCccccccccccC
Q 044868           40 GMLPSEAETLFKIMDSMSSD---QSWRVSYSNPCKPGSSWPGIECKQGNDGYLHVTRLDFGTRPNPTCKKTATFPYQIFS  116 (463)
Q Consensus        40 ~~~~~~~~aLl~~~~~~~~~---~~W~~~~~~~C~~~~~w~gv~C~~~~~~~~~v~~l~L~~~~~~~~~~~g~l~~~l~~  116 (463)
                      -|.|+|++||++||+++.++   ++|.. ++|||.  +.|.||+|+..+ +.+||++|+|++..     +.|        
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~~-~~d~C~--~~w~gv~C~~~~-~~~~v~~L~L~~~~-----l~g--------   64 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWLP-TTDCCN--RTWLGVLCDTDT-QTYRVNNLDLSGLN-----LPK--------   64 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCCT-TSCTTT--TCSTTEEECCSS-SCCCEEEEEEECCC-----CSS--------
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCCC-CCCCCC--CcCCCeEEeCCC-CcEEEEEEECCCCC-----CCC--------
Confidence            48999999999999999876   58974 469994  349999998643 34588888886321     111        


Q ss_pred             CCCCCEEEcccCCCCCcccccccccccCCCCccEEEccC-CCCCCCCCchhcCCCCCCcEEEeecCCCCCCCccccCCCC
Q 044868          117 LSYLQSVFFFSCFTHTKTTLSVSADRLYNSSLQQLSLRS-NPALVGPIPPQISSLKFLQILTLSQNRLNGQIPVKIFSLN  195 (463)
Q Consensus       117 l~~L~~L~L~~~~~~~~~~ip~~~~~l~~~~L~~L~Ls~-n~~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~  195 (463)
                                      ...+|..++++++  |++|+|++ | .++|.+|.+|+++++|++|+|++|++.+..+..+..+.
T Consensus        65 ----------------~~~lp~~l~~L~~--L~~L~Ls~~N-~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~  125 (313)
T d1ogqa_          65 ----------------PYPIPSSLANLPY--LNFLYIGGIN-NLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIK  125 (313)
T ss_dssp             ----------------CEECCGGGGGCTT--CSEEEEEEET-TEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCT
T ss_pred             ----------------CCCCChHHhcCcc--cccccccccc-ccccccccccccccccchhhhccccccccccccccchh
Confidence                            1233444444444  44444443 3 45556666666666666666666666555555555555


Q ss_pred             CCcEEEcccCCCCCCCchhcCCCCCCCEEEcccCcCCCCCchhhcCCCCcCEEeccCCCCCCCCchhhhcCCCC-CEEEe
Q 044868          196 SLVHLDLSYNLLAGTIPVQVGNLRNLVGLDLSYNSLTGSIPSTIGQLGMLQKLDLSSNSLTGSIPDSIDKLSLL-AFMAL  274 (463)
Q Consensus       196 ~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L-~~L~L  274 (463)
                      +|+++++++|.+.+.+|..+.+++.|+++++++|.+.+.+|                        ..+..+..+ +.+++
T Consensus       126 ~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip------------------------~~~~~l~~l~~~l~~  181 (313)
T d1ogqa_         126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP------------------------DSYGSFSKLFTSMTI  181 (313)
T ss_dssp             TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECC------------------------GGGGCCCTTCCEEEC
T ss_pred             hhcccccccccccccCchhhccCcccceeeccccccccccc------------------------ccccccccccccccc
Confidence            55555555555555555555555555555555555444444                        444444443 45555


Q ss_pred             eCCCCCCCCchhhhCCCCCcEeecCCCCCCCCCchhhhCCCCCCEEeccCCCCCCCCccccCCCCcccEEEcccccCCCC
Q 044868          275 SNNKLTGNFPKGLAKLQSLQYFLMDDNPMFIPLPVEFGILVKLQELRLANSGYSGSIPPSFSQLNNLSTLSLQNNRLTGE  354 (463)
Q Consensus       275 ~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~  354 (463)
                      +.|++++..|..+..+..+ .+++.++...+.+|..+..+++++.+++++|.+.+.+| .+..+++|++|+|++|+++|.
T Consensus       182 ~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~  259 (313)
T d1ogqa_         182 SRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGT  259 (313)
T ss_dssp             CSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEEC
T ss_pred             ccccccccccccccccccc-cccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeeccc
Confidence            5555555555555554433 46666666666666666677777777777777765544 466778888888888888888


Q ss_pred             chhhhCCCCCCCeEEccCCCCCccCCCCchhhhccCCeEeccCCCCCCCCcc
Q 044868          355 IPVVFGSLSHIYHLNLSRNFLDGVVPFNSSFLKRLGRNLDLSGNPGLCLNPA  406 (463)
Q Consensus       355 ~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~~L~L~~N~~~c~~~~  406 (463)
                      +|..++++++|++|+|++|+|+|.+|. +..++.+ +.+++++|+.+|+.|.
T Consensus       260 iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L-~~l~l~~N~~l~g~pl  309 (313)
T d1ogqa_         260 LPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRF-DVSAYANNKCLCGSPL  309 (313)
T ss_dssp             CCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGS-CGGGTCSSSEEESTTS
T ss_pred             CChHHhCCCCCCEEECcCCcccccCCC-cccCCCC-CHHHhCCCccccCCCC
Confidence            888888888888888888888888874 4667788 7888888888887654
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure