Citrus Sinensis ID: 044882


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-----
AYCSLFPKDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNSISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLYDIQHLRTFLPVTLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIFELPDSIGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKDVGDAKEAQLDGKKNLRELLLRWTLSTDGSSSREAEIEKDVLNMLKPHENLEQFCISGYGGTKFPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWKSAAGHPGSQNSVLKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQLPLSLKNLLIHKCDNIRTLTVEEGIQSSSSRSGLHNLRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVELPSLKEDGLPTNLQSLTIEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMVSFPPKADDKRLGTALPLPASLTSLWISGFPNLERLSSSIVDLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIEEKCRKDGGQYWDLLTHIPDVTIYR
cEEEccccccEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccEEEccccccEEEcHHHHHHHHHHHHccEEEEEcccccccccccccccEEEEEEccccccccccccccccccccEEcccccccccccccHHHHHHHHcccccEEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccHHHcHHHccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHHccccccccEEEEcccccccccHHHHHcccccccccccEEEEEcccccccccHHHHHHHHHHHccccccccccEEEEccccccccccccccccccEEEEEEEcccccccccccccccccccEEEccccccEEEcccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEccccccEEccccccccccccccEEEEEEEccccccccHHHHccccccccccEEEccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEcccccHHHHHHcccccccccccccEEEEEEccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccEEEEcc
cccEEccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEEEEcccccccccccHHHHHHccEEEEEccccccccccHHHHHHHHHHHHccEEEEEEcccccccccccccccHHEEEEEcccccccccccHHHHHHHHHHEEHcccHHHHHccHHHcccccccEEEccccccHHcccccccccccccEccEEEEcccccccHHHHHHHHHcccEEEEEcccccccHHHHHHHcHcccccccEEEEEEccccccccccccccHHHHHHHccccccccEEEEEccccccccccccccccccEEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccccHHEEEHcccHHHHHHcccccccccccccccEEEEEcccccHcccccccccccEEEEEcccccccccccccccccEEEEEcccccEcccccccccccccccEEEEEcccccccccccHHHcccccccEEEEEcccccccccccccccccccEEEEcccccHccccHHHcccHHHcHHHccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccccccccccccccccccEEEEccHHHHHHHHHHccccccccccccEEEEcccccccccccccccccccccccccccccEEEEEcccHcHHHccccccccccHcEEEEcccccccccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEcc
aycslfpkdyefeEEEIILLWCAVGlldhgesgnpsedLGRKFFRELRARSFIQQSSNSISRFLMHDLINDLAQWAAGEIYFRMEYTSEvnkqqsfsenlrhlsyipeycdgvkrfedlYDIQHLRTFlpvtlsnssrghlaysiLPKLFKLQRLRAFslrgyhifelpdsigdlrYLRYLNlsgteirtlPESVNKLYNLHSLLLEDCDRLKKLCADMGnlaklhhlknsntksleempvgigRLTSLQTLCNFvvgkgsgsglRELKLLTHLHgtlnisklenvkdvgdakeaQLDGKKNLRELLLRWTlstdgsssreaEIEKDVLNMlkphenleqfcisgyggtkfptwfgdssfsnlvtlefencdmctalpsvgqlpslkhlAVCGMSRvkrlgsefygndspipflcletlrfedmqewedwiplrsgqgvegfpklRELHILRCSklkgtfpehlpALEMLVIEGCEELLVSVTSLPAlckfisggckkvvwksaaghpgsqnsvlkKIEIRECDalkslpeawmcgtnssledmsirQCHSLTYIAAVQLPLSLKNllihkcdnirtltveegiqssssrsglhnLRQLQEISIrrcgnlvsfpegglpcakltrleiSSCKRLealpkglhnltslqeltigrgvelpslkedglptnlqslTIEGNMEIWKSMIERgrgfhrfsslrqltiincdddmvsfppkaddkrlgtalplpasltslwisgfpnlerlssSIVDLQNlaslylgdcpklkyfpekglpssllqldiwgcplieekcrkdggQYWDllthipdvtiyr
aycslfpkDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNSISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLYDIQHLRTFLPVTLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIFelpdsigdlRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAklhhlknsntkslEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGtlnisklenvkdvgdakeaqldgkknlRELLLRwtlstdgsssreAEIEKDVLNMLKPHENLEQFCISGYGGTKFPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGsefygndspIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWKSAaghpgsqnsvlkkIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQLPLSLKNLLIHKCDNIRTLTVEEgiqssssrsglhnlRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVelpslkedglptnlqsltiEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMVSFPPKADDKRLGTALPLPASLTSLWISGFPNLERLSSSIVDLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIEEkcrkdggqywdllthipdvtiyr
AYCSLFPKDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNSISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLYDIQHLRTFLPVTLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIFELPDSIGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKDVGDAKEAQLDGKKNLRELLLRWTLSTDGSSSREAEIEKDVLNMLKPHENLEQFCISGYGGTKFPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWKSAAGHPGSQNSVLKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQLPLSLKNLLIHKCDNIRTLTVEEGIQSSSSRSGLHNLRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVELPSLKEDGLPTNLQSLTIEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMVSFPPKADDKRLGTALPLPASLTSLWISGFPNLERLSSSIVDLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIEEKCRKDGGQYWDLLTHIPDVTIYR
**CSLFPKDYEFEEEEIILLWCAVGLLDH************KFFRELRARSFIQQSSNSISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLYDIQHLRTFLPVTLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIFELPDSIGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKN*****LEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKDVG**********KNLRELLLRWTL***************VLNMLKPHENLEQFCISGYGGTKFPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWKSAAGHPGSQNSVLKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQLPLSLKNLLIHKCDNIRTLTVEE************NLRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVELPSLKEDGLPTNLQSLTIEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMVSFPP****KRLGTALPLPASLTSLWISGFPNLERLSSSIVDLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIEEKCRKDGGQYWDLLTHIPDVTIY*
AYCSLFPKDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNSISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLYDIQHLRTFLPVTLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIFELPDSIGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKDVGDAKEAQLDGKKNLRELLLRWTLSTDG******EIEKDVLNMLKPHENLEQFCISGYGGTKFPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWK*********NSVLKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQLPLSLKNLLIHKCDNIRTLTVEEGIQSSSSRSGLHNLRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVELPSLKEDGLPTNLQSLTIEGNMEI*************FSSLRQLTIINCDDDMVSFPPKADDKRLGTALPLPASLTSLWISGFPNLERLSSSIVDLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIEEKCRKDGGQYWDLLTHIPDVTIYR
AYCSLFPKDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNSISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLYDIQHLRTFLPVTLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIFELPDSIGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKDVGDAKEAQLDGKKNLRELLLRWTLS********AEIEKDVLNMLKPHENLEQFCISGYGGTKFPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWKSAAGHPGSQNSVLKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQLPLSLKNLLIHKCDNIRTLTVEEG*********LHNLRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVELPSLKEDGLPTNLQSLTIEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMVSFPPKADDKRLGTALPLPASLTSLWISGFPNLERLSSSIVDLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIEEKCRKDGGQYWDLLTHIPDVTIYR
AYCSLFPKDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNSISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLYDIQHLRTFLPVTLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIFELPDSIGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKDVGDAKEAQLDGKKNLRELLLRWTLSTDGSSSREAEIEKDVLNMLKPHENLEQFCISGYGGTKFPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWKSAAGHPGSQNSVLKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQLPLSLKNLLIHKCDNIRTLTVEEGIQSSSSRSGLHNLRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVELPSLKEDGLPTNLQSLTIEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMVSFPPKADDKRLGTALPLPASLTSLWISGFPNLERLSSSIVDLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIEEKCRKDGGQYWDLLTHIPDVTIYR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AYCSLFPKDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNSISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLYDIQHLRTFLPVTLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIFELPDSIGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKDVGDAKEAQLDGKKNLRELLLRWTLSTDGSSSREAEIEKDVLNMLKPHENLEQFCISGYGGTKFPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGNDSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWKSAAGHPGSQNSVLKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQLPLSLKNLLIHKCDNIRTLTVEEGIQSSSSRSGLHNLRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVELPSLKEDGLPTNLQSLTIEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMVSFPPKADDKRLGTALPLPASLTSLWISGFPNLERLSSSIVDLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIEEKCRKDGGQYWDLLTHIPDVTIYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query815 2.2.26 [Sep-21-2011]
Q9LRR41054 Putative disease resistan yes no 0.680 0.526 0.377 8e-98
Q9LRR5 1424 Putative disease resistan no no 0.574 0.328 0.407 2e-90
Q7XBQ9970 Disease resistance protei N/A no 0.644 0.541 0.321 2e-55
Q7XA42979 Putative disease resistan N/A no 0.608 0.506 0.332 5e-53
Q7XA40992 Putative disease resistan N/A no 0.701 0.576 0.309 4e-52
Q7XA39988 Putative disease resistan N/A no 0.639 0.527 0.319 6e-49
P0DI181049 Probable disease resistan no no 0.695 0.540 0.254 3e-16
P0DI171049 Probable disease resistan no no 0.695 0.540 0.254 3e-16
Q38834852 Disease resistance RPP13- no no 0.477 0.456 0.251 9e-14
O81825919 Probable disease resistan no no 0.267 0.237 0.277 1e-13
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  358 bits (920), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 227/602 (37%), Positives = 337/602 (55%), Gaps = 47/602 (7%)

Query: 1    AYCSLFPKDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNSI 60
            AYCS+FPK + FE+++++LLW A G L    S    E+LG ++F EL +RS +Q++    
Sbjct: 431  AYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRSLLQKTK--- 487

Query: 61   SRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLY 120
            +R++MHD IN+LAQ+A+GE   + E   ++      SE  R+LSY+ +       FE L 
Sbjct: 488  TRYIMHDFINELAQFASGEFSSKFEDGCKLQ----VSERTRYLSYLRDNYAEPMEFEALR 543

Query: 121  DIQHLRTFLPVTLSNSSRG-----HLAYSILPKLFKLQRLRAFSLRGYHIFELP-DSIGD 174
            +++ LRTFLP++L+NSSR       ++  +LP L    RLR  SL  Y I  LP D   +
Sbjct: 544  EVKFLRTFLPLSLTNSSRSCCLDQMVSEKLLPTL---TRLRVLSLSHYKIARLPPDFFKN 600

Query: 175  LRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTK 234
            + + R+L+LS TE+  LP+S+  +YNL +LLL  C  LK+L  D+ NL  L +L    TK
Sbjct: 601  ISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTK 660

Query: 235  SLEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKDVGDAKE 294
             L +MP   GRL SLQTL  F V    GS + EL  L  LHG L I +L+ V DV DA E
Sbjct: 661  -LRQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAE 719

Query: 295  AQLDGKKNLRELLLRW----TLSTDGSSSREAEIEKDVLNMLKPHENLEQFCISGYGGTK 350
            A L+ KK+LRE+   W    + S + ++    + E +V   L+PH ++E+  I  Y G +
Sbjct: 720  ANLNSKKHLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRR 779

Query: 351  FPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGN--- 407
            FP W  D SFS +V +    C  CT+LPS+GQLP LK L + GM  ++ +G +FY +   
Sbjct: 780  FPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQ 839

Query: 408  ---DSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHL 464
                   PF  LETLRF+++ +W++W+ +R  +G + FP L++L ILRC +L GT P  L
Sbjct: 840  LRDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRG-DLFPSLKKLFILRCPELTGTLPTFL 898

Query: 465  PALEMLVIEGC-------EELLVSVTSLPALCKFISGGCKKVVWKSAAGHPGSQNSVLKK 517
            P+L  L I  C       +    S  +L  L   I   C  +V       P +  + L K
Sbjct: 899  PSLISLHIYKCGLLDFQPDHHEYSYRNLQTLS--IKSSCDTLV-----KFPLNHFANLDK 951

Query: 518  IEIRECDALKS--LPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQ-LPLSLKNLLIHKCDN 574
            +E+ +C +L S  L    + G N +L ++ I  C +L  +  +  LP +L+ + I  C  
Sbjct: 952  LEVDQCTSLYSLELSNEHLRGPN-ALRNLRINDCQNLQLLPKLNALPQNLQ-VTITNCRY 1009

Query: 575  IR 576
            +R
Sbjct: 1010 LR 1011




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description
>sp|P0DI17|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query815
400131587 1388 FB_MR5 [Malus x robusta] 0.974 0.572 0.374 1e-146
225465962 1290 PREDICTED: putative disease resistance R 0.959 0.606 0.389 1e-146
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.927 0.530 0.400 1e-145
225449872 1322 PREDICTED: putative disease resistance p 0.970 0.598 0.387 1e-145
359495083 1280 PREDICTED: putative disease resistance p 0.954 0.607 0.398 1e-144
225449961 1318 PREDICTED: putative disease resistance p 0.964 0.596 0.388 1e-143
225464007 1327 PREDICTED: putative disease resistance p 0.968 0.594 0.377 1e-141
359495896 1548 PREDICTED: putative disease resistance p 0.953 0.501 0.404 1e-141
147775060 1330 hypothetical protein VITISV_014782 [Viti 0.971 0.595 0.377 1e-140
359495052 1324 PREDICTED: putative disease resistance p 0.969 0.596 0.375 1e-139
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 366/977 (37%), Positives = 503/977 (51%), Gaps = 183/977 (18%)

Query: 1    AYCSLFPKDYEFEEEEIILLWCAVG-LLDHGESGNPSEDLGRKFFRELRARSFIQQSSNS 59
            AYCS+ P DYEFEE+++ILLW A G +L   E     EDLG  +FR+L +RS  Q+S+  
Sbjct: 426  AYCSILPNDYEFEEKQMILLWMAEGFILPRPEDKKQIEDLGADYFRDLVSRSLFQKSTKC 485

Query: 60   ISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLR------HLSYIPEYCDGV 113
            IS+++MHDLI DLA+WAAGEI FR+E     +KQ    E LR      H SYI    DGV
Sbjct: 486  ISKYVMHDLIGDLARWAAGEICFRLE-----DKQNDDGEQLRCFPKARHSSYIRGLSDGV 540

Query: 114  KRFEDLYDIQHLRTFLPV---TLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIFELPD 170
            KRFE   ++++LRTFLP+   +  N     +A+ +LPKL   Q LR  S   Y I ELPD
Sbjct: 541  KRFEVFSELKYLRTFLPLRKDSFWNYLSRQVAFDLLPKL---QYLRVLSFNCYKITELPD 597

Query: 171  SIGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKN 230
            SIGDLRYLRYL+LS T+I +LP+S + LYNL +L+LE C +LK L  DM NL  L HL N
Sbjct: 598  SIGDLRYLRYLDLSYTDITSLPKSTSTLYNLQTLILEGCSKLKALPIDMSNLVNLRHLNN 657

Query: 231  SNTKSLEEMPVGIGRLTSLQTLCNFVVGKGSG---SGLRELKLLTHLHGTLNISKLENVK 287
            SN   LE+MP  +GRL +LQ+L  FVV  G G   SG+REL+ L HL GTL IS+LENV 
Sbjct: 658  SNVSLLEDMPPQLGRLVNLQSLTKFVVSGGGGGDRSGIRELEFLMHLRGTLCISRLENVT 717

Query: 288  DVGDAKEAQLDGKKNLRELLLRWTLSTDGSSSREAEIEKDVLNMLKPHENLEQFCISGYG 347
            DV DA+ A L+ K+ L  L+L W+ S+D       E E  VL+ML+PH  L++  I  Y 
Sbjct: 718  DVEDAQRANLNCKERLDSLVLEWSHSSDTR-----ETESAVLDMLQPHTKLKELTIKSYA 772

Query: 348  GTKFPTWFGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFYGN 407
            G +F +W G   FSN+V +  E C+ C +LP +G+LP LK L + GM+ V+ +G+EFYG 
Sbjct: 773  GKEFSSWVGVPLFSNMVLVRLEECNNCLSLPPLGKLPHLKELYIRGMNAVESVGAEFYGE 832

Query: 408  DSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPAL 467
             S +PF  LETL F DMQ W+ W+P ++      FP L+ L + +CSKL+G  PE+L +L
Sbjct: 833  CS-LPFPLLETLEFVDMQHWKVWLPFQTDHRGSVFPCLKTLLVRKCSKLEGKLPENLDSL 891

Query: 468  EMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWKSAAGHPGSQNSVLKKIEIRECDALK 527
              L I  CEELLVS+ +   L +    GCK VV  +A      +  +L+ + +     L 
Sbjct: 892  ASLEIVKCEELLVSIANYKQLRQLNIDGCKGVVHTAAK----VEFELLESLYLSNISELT 947

Query: 528  SLPEAWMCGTN-SSLEDMSIRQCHSLT------------YIAAVQLPLSLKNLLIH---- 570
            SL    +C    + + D+ I  C  LT             I+  +L +   +LL+     
Sbjct: 948  SLQTGELCRNGLNMVRDLKINGCEELTSSLKNEAILLQQLISLGRLEIEDNSLLVEELGK 1007

Query: 571  KCDNIRTLTV----------EEGIQSSSSRSGLHNLRQLQEISIRRCGNLVSFPEGGLPC 620
            + D +  L +          ++         GL+ L  LQE+ I  C +LVSFP+ GLP 
Sbjct: 1008 EADELLQLQILGCKLEFLKLKKCKNLLKLPEGLNQLSSLQELRIHECSSLVSFPDVGLPP 1067

Query: 621  A----------------------KLTRLEISSCKRLEAL---------PKGLHN------ 643
            +                       L R++I  C+ L +L             HN      
Sbjct: 1068 SLKDIEITECHSLIYFAKSQIPQNLRRIQIRDCRSLRSLVDNEAVGSCSSSSHNCLEYLN 1127

Query: 644  ----------------LTSLQELTIGRGVELPSLKEDGLPTNLQSLTIEGNMEIWKSM-- 685
                            + +L+EL I    +L  L  DGL  N  +  +E N  I +    
Sbjct: 1128 IERCQSLTLLSLSDQLVRALRELDIYDCEQLEFLAPDGLFCNNTNYFLE-NFRIRRCQNL 1186

Query: 686  --IERGRGFHRFSSLRQLTIINCD------DDMVSFPPKAD---DKRLGTALPLPASLTS 734
              + R  G  R S+LR++ I +CD      +DM +F        D R G     PA+LTS
Sbjct: 1187 KSLPRLSGGIRGSNLREIRITDCDRLEALPEDMHNFNSLEKLIIDYREGLTCSFPANLTS 1246

Query: 735  ---------------------------LWISG---------------------------- 739
                                       LWI G                            
Sbjct: 1247 LMIWKVKSCKSLWELEWGLHRLTSLRYLWIGGEDPDMVSFPPDMVRMETLLPKSLTELSI 1306

Query: 740  --FPNLERLSSSIVD-LQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIEEKCRK 796
              FPNL++LSS     L +L SL L DCPKL   P++GLP SL +L I+GCP+++E+C+ 
Sbjct: 1307 GGFPNLKKLSSKGFQFLTSLESLELWDCPKLASIPKEGLPLSLTELCIYGCPVLKERCQP 1366

Query: 797  DGGQYWDLLTHIPDVTI 813
              G+YW  ++HIP + I
Sbjct: 1367 GKGRYWHKISHIPYIDI 1383




Source: Malus x robusta

Species: Malus x robusta

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225465962|ref|XP_002269685.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|225449872|ref|XP_002265429.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495083|ref|XP_003634908.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449961|ref|XP_002271133.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225464007|ref|XP_002264663.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495896|ref|XP_003635111.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147775060|emb|CAN77204.1| hypothetical protein VITISV_014782 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495052|ref|XP_002267579.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query815
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.581 0.332 0.408 6e-115
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.683 0.528 0.39 2.6e-95
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.797 0.360 0.263 3e-24
TAIR|locus:504956483847 AT3G46730 [Arabidopsis thalian 0.307 0.296 0.286 4.8e-15
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.496 0.453 0.262 1.2e-14
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.266 0.241 0.275 3.7e-14
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.647 0.381 0.266 4.7e-14
TAIR|locus:5049561841017 AT1G58807 "AT1G58807" [Arabido 0.358 0.287 0.248 1e-13
TAIR|locus:28270381017 AT1G59124 "AT1G59124" [Arabido 0.358 0.287 0.248 1e-13
TAIR|locus:5049561821049 AT1G58848 [Arabidopsis thalian 0.373 0.289 0.267 1.1e-13
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 867 (310.3 bits), Expect = 6.0e-115, Sum P(2) = 6.0e-115
 Identities = 200/490 (40%), Positives = 280/490 (57%)

Query:     1 AYCSLFPKDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNSI 60
             A CS+FPK + F+ EE++LLW A+ LL    S    ED+G  +  +L A+SF Q+   ++
Sbjct:   423 ALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRLDITM 482

Query:    61 SRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDLY 120
             + F+MHDL+NDLA+  +G+  FR+E   + N  +      RH S+    CD    F  + 
Sbjct:   483 TSFVMHDLMNDLAKAVSGDFCFRLE---DDNIPE-IPSTTRHFSFSRSQCDASVAFRSIC 538

Query:   121 DIQHLRTFLPVTLSNSSRG-HLAYSIL-PKLFKLQRLRAFSLRGYHIFELPDSIGDLRYL 178
               + LRT LP     S     L   +L P L  L  LR  SL  Y I  LP S+  L+ L
Sbjct:   539 GAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLL 598

Query:   179 RYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEE 238
             RYL+LS T+I+ LPE V  L NL +LLL +C  L  L   +  L  L  L    T  L E
Sbjct:   599 RYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTP-LVE 657

Query:   239 MPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLENVKDVGDAKEAQLD 298
             MP GI +L SLQ L NFV+G+ SG+GL ELK L+HL GTL IS+L+NV    +AK+A L 
Sbjct:   658 MPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDAGLK 717

Query:   299 GKKNLRELLLRWTLS----TDGSSSREAEIEKDVLNMLKPHENLEQFCISGYGGTKFPTW 354
              K  L  L+L+WT+       GS +  A  +K+VL ML+PH +L+ FCI  Y G  FP W
Sbjct:   718 RKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKTFCIESYQGGAFPKW 777

Query:   355 FGDSSFSNLVTLEFENCDMCTALPSVGQLPSLKHLAVCGMSRVKRLGSEFY---GNDSPI 411
              GDSSF  + ++   +C++C +LP VGQLPSLK+L++   + ++++G +F+    N   +
Sbjct:   778 LGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKVGLDFFFGENNSRGV 837

Query:   412 PFLCLETLRFEDMQEWEDWIPLRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLV 471
             PF  L+ L+F  M  W++WI      G+  FP L++L I RC  L+  FPE LP+   + 
Sbjct:   838 PFQSLQILKFYGMPRWDEWICPELEDGI--FPCLQKLIIQRCPSLRKKFPEGLPSSTEVT 895

Query:   472 IEGCEELLVS 481
             I  C    VS
Sbjct:   896 ISDCPLRAVS 905


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-08
PLN032101153 PLN03210, PLN03210, Resistant to P 9e-07
PLN03210 1153 PLN03210, PLN03210, Resistant to P 6e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 58.7 bits (142), Expect = 1e-08
 Identities = 58/191 (30%), Positives = 87/191 (45%), Gaps = 16/191 (8%)

Query: 599 LQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVEL 658
           L+ + +  C +LV  P       KL  L++S C+ LE LP G+ NL SL  L +     L
Sbjct: 659 LETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRL 717

Query: 659 PSLKEDGLPTNLQSLTIEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMVSFPPKAD 718
            S  +  + TN+  L ++       + IE      R  +L +L +     +M S     +
Sbjct: 718 KSFPD--ISTNISWLDLDE------TAIEEFPSNLRLENLDELILC----EMKS-EKLWE 764

Query: 719 DKRLGTAL--PLPASLTSLWISGFPNLERLSSSIVDLQNLASLYLGDCPKLKYFPEKGLP 776
             +  T L   L  SLT L++S  P+L  L SSI +L  L  L + +C  L+  P     
Sbjct: 765 RVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINL 824

Query: 777 SSLLQLDIWGC 787
            SL  LD+ GC
Sbjct: 825 ESLESLDLSGC 835


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 815
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.66
KOG4237498 consensus Extracellular matrix protein slit, conta 99.64
KOG4237498 consensus Extracellular matrix protein slit, conta 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.51
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.48
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.45
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.09
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG4341483 consensus F-box protein containing LRR [General fu 99.0
KOG4341483 consensus F-box protein containing LRR [General fu 98.92
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.85
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.78
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.74
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.7
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.7
PRK15386 426 type III secretion protein GogB; Provisional 98.67
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.61
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.6
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.56
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.56
PLN03150623 hypothetical protein; Provisional 98.44
PLN03150623 hypothetical protein; Provisional 98.43
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.36
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.34
PRK15386 426 type III secretion protein GogB; Provisional 98.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.33
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.24
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.23
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.2
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.19
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.11
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.96
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.84
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.73
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.69
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.5
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.45
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.41
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.4
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.4
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.99
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.97
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.91
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.85
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.67
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.63
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.35
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.27
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.03
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.52
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.69
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.3
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.24
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.09
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.0
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.68
smart0037026 LRR Leucine-rich repeats, outliers. 92.16
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.16
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.9
smart0037026 LRR Leucine-rich repeats, outliers. 87.86
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.86
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.6
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=8.7e-41  Score=400.75  Aligned_cols=512  Identities=17%  Similarity=0.209  Sum_probs=242.0

Q ss_pred             ccccCCCceEEccccCCcCcCCCccccccccc-cCCCcccEEEcCCCCcc-ccCccccCCccCCEEecCCCCCC-ccchh
Q 044882          118 DLYDIQHLRTFLPVTLSNSSRGHLAYSILPKL-FKLQRLRAFSLRGYHIF-ELPDSIGDLRYLRYLNLSGTEIR-TLPES  194 (815)
Q Consensus       118 ~~~~~~~Lr~L~~~~~~~~~~~~~~~~~~~~~-~~l~~Lr~L~L~~~~i~-~lp~~~~~l~~L~~L~L~~~~i~-~lp~~  194 (815)
                      .+..+++|+.|.+.++.      +...+|..+ ..+++||+|+|++|++. .+|.  +.+++|++|+|++|.+. .+|..
T Consensus        88 ~~~~l~~L~~L~Ls~n~------~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~  159 (968)
T PLN00113         88 AIFRLPYIQTINLSNNQ------LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPND  159 (968)
T ss_pred             HHhCCCCCCEEECCCCc------cCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChH
Confidence            34456666666555432      333444444 35666666666666654 2332  34566666666666655 55666


Q ss_pred             hhccCCCcEEeccCCccccccchhhcCcCCcceeeccCCCcccccccccccccccccccceeeccCCCCCcccccccccc
Q 044882          195 VNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHL  274 (815)
Q Consensus       195 i~~L~~L~~L~L~~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~~p~~i~~L~~L~~L~~~~~~~~~~~~~~~l~~L~~L  274 (815)
                      ++++++|++|++++|.....+|..++++++|++|++++|...+.+|..++++++|++|+......               
T Consensus       160 ~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l---------------  224 (968)
T PLN00113        160 IGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNL---------------  224 (968)
T ss_pred             HhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCcc---------------
Confidence            66666666666666643445666666666666666666654445555566666666553211100               


Q ss_pred             ccceeeecccccCChhhhhhcccCCCcCCceeeeEEccCCCCCCCchhhHHHHHhhcCCCCCCcccEEEeecCCC-CCCc
Q 044882          275 HGTLNISKLENVKDVGDAKEAQLDGKKNLRELLLRWTLSTDGSSSREAEIEKDVLNMLKPHENLEQFCISGYGGT-KFPT  353 (815)
Q Consensus       275 ~~~l~~~~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~-~~p~  353 (815)
                                     ....+..+..+++|+.|++++|                                   ... .+|.
T Consensus       225 ---------------~~~~p~~l~~l~~L~~L~L~~n-----------------------------------~l~~~~p~  254 (968)
T PLN00113        225 ---------------SGEIPYEIGGLTSLNHLDLVYN-----------------------------------NLTGPIPS  254 (968)
T ss_pred             ---------------CCcCChhHhcCCCCCEEECcCc-----------------------------------eeccccCh
Confidence                           0001111333444445554444                                   332 2344


Q ss_pred             cCCCCCCCCccEEEEecCCCCCCCC-CCCCCCCcCeeeeccCCCceecCccccCCCCCCCCCCcceeeeccccccccccc
Q 044882          354 WFGDSSFSNLVTLEFENCDMCTALP-SVGQLPSLKHLAVCGMSRVKRLGSEFYGNDSPIPFLCLETLRFEDMQEWEDWIP  432 (815)
Q Consensus       354 ~~~~~~l~~L~~L~L~~~~~~~~l~-~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~  432 (815)
                      .+.  .+++|++|++++|.+.+.+| .+..+++|++|++++|.....++. .+.     .+++|+.|.+.+....... .
T Consensus       255 ~l~--~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~-~~~-----~l~~L~~L~l~~n~~~~~~-~  325 (968)
T PLN00113        255 SLG--NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPE-LVI-----QLQNLEILHLFSNNFTGKI-P  325 (968)
T ss_pred             hHh--CCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCCh-hHc-----CCCCCcEEECCCCccCCcC-C
Confidence            433  24555555555555544444 445555555555555422111110 000     0222222222211100000 0


Q ss_pred             cCCCCCcccCCCcceeeeccCcccccCCCCCCCCccEEEEecccCccccCCCCCCcceEEeCCCCccccccccCCCCCCc
Q 044882          433 LRSGQGVEGFPKLRELHILRCSKLKGTFPEHLPALEMLVIEGCEELLVSVTSLPALCKFISGGCKKVVWKSAAGHPGSQN  512 (815)
Q Consensus       433 ~~~~~~~~~~~~L~~L~l~~c~~l~~~lp~~l~~L~~L~l~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~  512 (815)
                          ..+..+++|+.|++++| .+.+.+|..+                  ..+                           
T Consensus       326 ----~~~~~l~~L~~L~L~~n-~l~~~~p~~l------------------~~~---------------------------  355 (968)
T PLN00113        326 ----VALTSLPRLQVLQLWSN-KFSGEIPKNL------------------GKH---------------------------  355 (968)
T ss_pred             ----hhHhcCCCCCEEECcCC-CCcCcCChHH------------------hCC---------------------------
Confidence                11114555555555553 3443444211                  111                           


Q ss_pred             cccceEEEeccCCcccCchhhhcCCCCCcceEEEeccCCchhhhccccccccceEecccccccccccccccccccCcccc
Q 044882          513 SVLKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLTYIAAVQLPLSLKNLLIHKCDNIRTLTVEEGIQSSSSRSG  592 (815)
Q Consensus       513 ~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~l~~~L~~l~l~~~~~L~~l~ls~n~~~~~~~~~  592 (815)
                      ++|+.|++++|.....+|..+  ..+++|+.|++++|.....++.          .+..|++|+.+++++|.+.+..|..
T Consensus       356 ~~L~~L~Ls~n~l~~~~p~~~--~~~~~L~~L~l~~n~l~~~~p~----------~~~~~~~L~~L~L~~n~l~~~~p~~  423 (968)
T PLN00113        356 NNLTVLDLSTNNLTGEIPEGL--CSSGNLFKLILFSNSLEGEIPK----------SLGACRSLRRVRLQDNSFSGELPSE  423 (968)
T ss_pred             CCCcEEECCCCeeEeeCChhH--hCcCCCCEEECcCCEecccCCH----------HHhCCCCCCEEECcCCEeeeECChh
Confidence            223333333333333333333  2344444444444432211110          1223444555555555555555555


Q ss_pred             cCCCCCCceEEeccCCCcccccCCCCCCCCcceEEecccccccccccccCCCCCcCcEEecCCCCCCCCCCC-CCCCCCc
Q 044882          593 LHNLRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCKRLEALPKGLHNLTSLQELTIGRGVELPSLKED-GLPTNLQ  671 (815)
Q Consensus       593 ~~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~-~~~~~L~  671 (815)
                      +..+++|+.|++++|.....+|..+..+++|+.|++++|.+.+.+|..+ ..++|+.|++++|.....+|.. ..+++|+
T Consensus       424 ~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~  502 (968)
T PLN00113        424 FTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELM  502 (968)
T ss_pred             HhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccC
Confidence            5555555555555555444444444455555555555555555544433 2355555555555433333322 3445555


Q ss_pred             eEEEcCCcchhhhhhhcCcCcccCCCccEEEEeccCCCcccCCCCccccccccCCCCCCccceEEecCCCCCccccccCC
Q 044882          672 SLTIEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMVSFPPKADDKRLGTALPLPASLTSLWISGFPNLERLSSSIV  751 (815)
Q Consensus       672 ~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~l~~~~~~~~~L~~L~l~~c~~l~~l~~~~~  751 (815)
                      +|++++|......+    ..+..+++|+.|++++ +.....+|.         .+..+++|+.|++++|+....+|..+.
T Consensus       503 ~L~Ls~N~l~~~~p----~~~~~l~~L~~L~Ls~-N~l~~~~p~---------~~~~l~~L~~L~Ls~N~l~~~~p~~l~  568 (968)
T PLN00113        503 QLKLSENKLSGEIP----DELSSCKKLVSLDLSH-NQLSGQIPA---------SFSEMPVLSQLDLSQNQLSGEIPKNLG  568 (968)
T ss_pred             EEECcCCcceeeCC----hHHcCccCCCEEECCC-CcccccCCh---------hHhCcccCCEEECCCCcccccCChhHh
Confidence            55555554332111    2345566666666665 222222322         234556777777777655556676667


Q ss_pred             CCCCCCeeeeCCCCCCcccCCCCCCCccceeeecCCc
Q 044882          752 DLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCP  788 (815)
Q Consensus       752 ~l~~L~~L~i~~c~~l~~l~~~~~~~~L~~L~i~~c~  788 (815)
                      .+++|+.|++++|+-...+|..+.+.++....+.++|
T Consensus       569 ~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~  605 (968)
T PLN00113        569 NVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNI  605 (968)
T ss_pred             cCcccCEEeccCCcceeeCCCcchhcccChhhhcCCc
Confidence            7777777777776655566654444444444444544



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-07
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 54.7 bits (130), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 53/163 (32%), Positives = 80/163 (49%), Gaps = 19/163 (11%) Query: 515 LKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSLT--YIAAVQLPLSLKNLLIHKC 572 L+++ IR C L LPE + T++S E + SL + LP S+ NL Sbjct: 152 LRELSIRACPELTELPEP-LASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANL----- 205 Query: 573 DNIRTLTVEEGIQSSSSRSGLHNLRQLQEISIRRCGNLVSFPE--GGLPCAKLTRLEISS 630 N+++L + S+ +H+L +L+E+ +R C L ++P GG A L RL + Sbjct: 206 QNLKSLKIRNSPLSALG-PAIHHLPKLEELDLRGCTALRNYPPIFGGR--APLKRLILKD 262 Query: 631 CKRLEALPKGLHNLTSLQELTIGRGV----ELPSLKEDGLPTN 669 C L LP +H LT L++L + RG LPSL LP N Sbjct: 263 CSNLLTLPLDIHRLTQLEKLDL-RGCVNLSRLPSLIAQ-LPAN 303

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 8e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score = 98.8 bits (246), Expect = 1e-21
 Identities = 26/203 (12%), Positives = 65/203 (32%), Gaps = 36/203 (17%)

Query: 1   AYCSLFPKDYEFEEEEIILLWCAVGLLDHGESGNPSEDLGRKFFRELRARSFIQQSSNS- 59
              S+  KD +   + + +LW                +      +E   +S +    N  
Sbjct: 384 TDLSILQKDVKVPTKVLCILWDM------------ETEEVEDILQEFVNKSLLFCDRNGK 431

Query: 60  ISRFLMHDLINDLAQWAAGEIYFRMEYTSEVNKQQSFSENLRHLSYIPEYCDGVKRFEDL 119
             R+ +HDL  D       +   +++       ++  ++  R+      +     + + +
Sbjct: 432 SFRYYLHDLQVDFLT---EKNCSQLQD----LHKKIITQFQRYHQP---HTLSPDQEDCM 481

Query: 120 YDIQHLRTFLPVTLSNSSRGHLAYSILP---------KLFKLQRLRAFSLRGYHIFELPD 170
           Y       FL   ++++       +++          +L     L    +   HI +  D
Sbjct: 482 Y----WYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKD 537

Query: 171 SIGDLRYLRYLNLSGTEIRTLPE 193
                 +  +L+L+G  +   P 
Sbjct: 538 CAVSENFQEFLSLNGHLLGRQPF 560


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query815
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.98
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.98
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.7
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.69
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.69
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.68
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.67
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.67
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.64
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.59
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.58
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.52
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.5
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.49
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.48
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.47
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.46
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.46
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.44
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.44
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.44
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.43
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.43
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.42
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.41
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.39
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.36
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.36
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.34
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.34
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.33
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.27
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.25
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.22
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.2
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.19
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.18
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.17
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.15
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.12
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.1
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.1
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.02
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.02
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.01
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.98
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 98.97
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.84
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.71
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.7
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.67
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.66
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.36
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.96
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.92
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 97.87
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.78
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.71
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.61
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 96.91
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.49
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.69
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4e-50  Score=467.66  Aligned_cols=641  Identities=14%  Similarity=0.113  Sum_probs=366.6

Q ss_pred             CCceeEEEeeccccccc-c-cccccccCCCceEEccccCCcCcCCCccccccccccCCCcccEEEcCCCCcc-ccCc--c
Q 044882           97 SENLRHLSYIPEYCDGV-K-RFEDLYDIQHLRTFLPVTLSNSSRGHLAYSILPKLFKLQRLRAFSLRGYHIF-ELPD--S  171 (815)
Q Consensus        97 ~~~~r~l~~~~~~~~~~-~-~~~~~~~~~~Lr~L~~~~~~~~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~i~-~lp~--~  171 (815)
                      ...++.+.+........ . -.+.+.++++|+.+......      + ...+..+..+++|++|+|++|.+. .+|.  .
T Consensus        49 ~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~------~-~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~  121 (768)
T 3rgz_A           49 DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSH------I-NGSVSGFKCSASLTSLDLSRNSLSGPVTTLTS  121 (768)
T ss_dssp             TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSC------E-EECCCCCCCCTTCCEEECCSSEEEEEGGGGGG
T ss_pred             CCcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCC------c-CCCchhhccCCCCCEEECCCCcCCCcCCChHH
Confidence            34566666554322211 0 11334455555555443321      1 234466777888888888888776 4565  7


Q ss_pred             ccCCccCCEEecCCCCCC-ccchhh-hccCCCcEEeccCCccccccchh---hcCcCCcceeeccCCCcccccccccccc
Q 044882          172 IGDLRYLRYLNLSGTEIR-TLPESV-NKLYNLHSLLLEDCDRLKKLCAD---MGNLAKLHHLKNSNTKSLEEMPVGIGRL  246 (815)
Q Consensus       172 ~~~l~~L~~L~L~~~~i~-~lp~~i-~~L~~L~~L~L~~~~~l~~lp~~---i~~L~~L~~L~l~~~~~l~~~p~~i~~L  246 (815)
                      ++++++|++|+|++|.+. ..|..+ +++++|++|++++|......|..   ++++++|++|++++|...+..|  ++.+
T Consensus       122 l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~~l  199 (768)
T 3rgz_A          122 LGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRC  199 (768)
T ss_dssp             GGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--CTTC
T ss_pred             HhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC--cccC
Confidence            778888888888887765 445444 67788888888887433444444   6777888888888777333222  3667


Q ss_pred             cccccccceeeccCC-CCCccccccccccccceeeecccccCChhhhhhcccCCCcCCceeeeEEccCCCCCCCchhhHH
Q 044882          247 TSLQTLCNFVVGKGS-GSGLRELKLLTHLHGTLNISKLENVKDVGDAKEAQLDGKKNLRELLLRWTLSTDGSSSREAEIE  325 (815)
Q Consensus       247 ~~L~~L~~~~~~~~~-~~~~~~l~~L~~L~~~l~~~~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~  325 (815)
                      ++|++|+........ ...+..+++|+.|    .+..-    .........+..+++|+.|++++|...+.         
T Consensus       200 ~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L----~Ls~n----~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~---------  262 (768)
T 3rgz_A          200 VNLEFLDVSSNNFSTGIPFLGDCSALQHL----DISGN----KLSGDFSRAISTCTELKLLNISSNQFVGP---------  262 (768)
T ss_dssp             TTCCEEECCSSCCCSCCCBCTTCCSCCEE----ECCSS----CCCSCHHHHTTTCSSCCEEECCSSCCEES---------
T ss_pred             CcCCEEECcCCcCCCCCcccccCCCCCEE----ECcCC----cCCCcccHHHhcCCCCCEEECCCCcccCc---------
Confidence            777777543322211 1113333333333    22111    11112333456666666666666654110         


Q ss_pred             HHHhhcCCCCCCcccEEEeecCCC-CCCccCCCCCCCCccEEEEecCCCCCCCC-CCCCCCCcCeeeeccCCCceecCcc
Q 044882          326 KDVLNMLKPHENLEQFCISGYGGT-KFPTWFGDSSFSNLVTLEFENCDMCTALP-SVGQLPSLKHLAVCGMSRVKRLGSE  403 (815)
Q Consensus       326 ~~~~~~l~~~~~L~~L~l~~~~~~-~~p~~~~~~~l~~L~~L~L~~~~~~~~l~-~l~~l~~L~~L~l~~~~~~~~~~~~  403 (815)
                         ... ..+++|++|+++++.+. .+|.++.. .+++|++|++++|.+.+.+| .++.+++|++|++++|.....++..
T Consensus       263 ---~~~-~~l~~L~~L~L~~n~l~~~ip~~~~~-~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~  337 (768)
T 3rgz_A          263 ---IPP-LPLKSLQYLSLAENKFTGEIPDFLSG-ACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD  337 (768)
T ss_dssp             ---CCC-CCCTTCCEEECCSSEEEESCCCCSCT-TCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHH
T ss_pred             ---cCc-cccCCCCEEECcCCccCCccCHHHHh-hcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHH
Confidence               011 14556666666666554 55665542 24666777776666655555 5666666777777666443344443


Q ss_pred             ccCCCCCCCCCCcceeeeccccccccccccCCCCCcccCC-CcceeeeccCcccccCCCCC-----CCCccEEEEecccC
Q 044882          404 FYGNDSPIPFLCLETLRFEDMQEWEDWIPLRSGQGVEGFP-KLRELHILRCSKLKGTFPEH-----LPALEMLVIEGCEE  477 (815)
Q Consensus       404 ~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~-~L~~L~l~~c~~l~~~lp~~-----l~~L~~L~l~~~~~  477 (815)
                      .+..     +++|+.|++.++.......     ..+..++ +|+.|++++ +++.+.+|..     +++|+.|++.+|..
T Consensus       338 ~l~~-----l~~L~~L~Ls~n~l~~~~p-----~~l~~l~~~L~~L~Ls~-N~l~~~~~~~~~~~~~~~L~~L~L~~n~l  406 (768)
T 3rgz_A          338 TLLK-----MRGLKVLDLSFNEFSGELP-----ESLTNLSASLLTLDLSS-NNFSGPILPNLCQNPKNTLQELYLQNNGF  406 (768)
T ss_dssp             HHTT-----CTTCCEEECCSSEEEECCC-----TTHHHHTTTCSEEECCS-SEEEEECCTTTTCSTTCCCCEEECCSSEE
T ss_pred             HHhc-----CCCCCEEeCcCCccCcccc-----HHHHhhhcCCcEEEccC-CCcCCCcChhhhhcccCCccEEECCCCcc
Confidence            3332     5666666666543211111     1222343 666666666 3455444422     44566666666643


Q ss_pred             c---cccCCCCCCcceEEeCCCCccccccccCCCC--CCccccceEEEeccCCcccCchhhhcCCCCCcceEEEeccCCc
Q 044882          478 L---LVSVTSLPALCKFISGGCKKVVWKSAAGHPG--SQNSVLKKIEIRECDALKSLPEAWMCGTNSSLEDMSIRQCHSL  552 (815)
Q Consensus       478 l---~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~--~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~~~~l  552 (815)
                      .   ...+..+++|+.|++++|...     ...+.  ...++|++|++++|...+.+|..+  ..+++|+.|++++|...
T Consensus       407 ~~~~p~~l~~l~~L~~L~Ls~N~l~-----~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~--~~l~~L~~L~L~~N~l~  479 (768)
T 3rgz_A          407 TGKIPPTLSNCSELVSLHLSFNYLS-----GTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL--MYVKTLETLILDFNDLT  479 (768)
T ss_dssp             EEECCGGGGGCTTCCEEECCSSEEE-----SCCCGGGGGCTTCCEEECCSSCCCSCCCGGG--GGCTTCCEEECCSSCCC
T ss_pred             ccccCHHHhcCCCCCEEECcCCccc-----CcccHHHhcCCCCCEEECCCCcccCcCCHHH--cCCCCceEEEecCCccc
Confidence            2   233445566666666665432     11111  112456666666666555555554  45666666666666433


Q ss_pred             hhhhccccccccceEecccccccccccccccccccCcccccCCCCCCceEEeccCCCcccccCCCCCCCCcceEEecccc
Q 044882          553 TYIAAVQLPLSLKNLLIHKCDNIRTLTVEEGIQSSSSRSGLHNLRQLQEISIRRCGNLVSFPEGGLPCAKLTRLEISSCK  632 (815)
Q Consensus       553 ~~~~~~~l~~~L~~l~l~~~~~L~~l~ls~n~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~  632 (815)
                      ..++.          .+.+|++|+.|++++|.+.+..|..+..+++|++|++++|.....+|..+..+++|+.|++++|+
T Consensus       480 ~~~p~----------~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~  549 (768)
T 3rgz_A          480 GEIPS----------GLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL  549 (768)
T ss_dssp             SCCCG----------GGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSE
T ss_pred             CcCCH----------HHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCc
Confidence            22221          13455666666666666666666666666666666666666555666666666666666666666


Q ss_pred             cccccccccCCCCCcCcEEecCC----------------------------------------------CCCCCCC-CCC
Q 044882          633 RLEALPKGLHNLTSLQELTIGRG----------------------------------------------VELPSLK-EDG  665 (815)
Q Consensus       633 ~~~~~~~~~~~l~~L~~L~l~~~----------------------------------------------~~~~~~~-~~~  665 (815)
                      +.+.+|..+.....+..+.+..+                                              ..-..+| ..+
T Consensus       550 l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~  629 (768)
T 3rgz_A          550 FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFD  629 (768)
T ss_dssp             EESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCS
T ss_pred             cCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhh
Confidence            66666655544433333222110                                              0000011 123


Q ss_pred             CCCCCceEEEcCCcchhhhhhhcCcCcccCCCccEEEEeccCCCcc-cCCCCccccccccCCCCCCccceEEecCCCCCc
Q 044882          666 LPTNLQSLTIEGNMEIWKSMIERGRGFHRFSSLRQLTIINCDDDMV-SFPPKADDKRLGTALPLPASLTSLWISGFPNLE  744 (815)
Q Consensus       666 ~~~~L~~L~l~~~~~l~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~-~~~~~~~~~~l~~~~~~~~~L~~L~l~~c~~l~  744 (815)
                      .+++|+.|++++|......    +..+..+++|+.|++++  +.+. .+|.         .+..+++|+.|+|++|+...
T Consensus       630 ~l~~L~~LdLs~N~l~g~i----p~~l~~l~~L~~L~Ls~--N~l~g~ip~---------~l~~L~~L~~LdLs~N~l~g  694 (768)
T 3rgz_A          630 NNGSMMFLDMSYNMLSGYI----PKEIGSMPYLFILNLGH--NDISGSIPD---------EVGDLRGLNILDLSSNKLDG  694 (768)
T ss_dssp             SSBCCCEEECCSSCCBSCC----CGGGGGCTTCCEEECCS--SCCCSCCCG---------GGGGCTTCCEEECCSSCCEE
T ss_pred             ccccccEEECcCCcccccC----CHHHhccccCCEEeCcC--CccCCCCCh---------HHhCCCCCCEEECCCCcccC
Confidence            4678999999999765432    25688999999999999  4444 5654         44678999999999966666


Q ss_pred             cccccCCCCCCCCeeeeCCCCCCcccCCCCCCCccceeeecCCcchH----HHHhccCCCcccccccccce
Q 044882          745 RLSSSIVDLQNLASLYLGDCPKLKYFPEKGLPSSLLQLDIWGCPLIE----EKCRKDGGQYWDLLTHIPDV  811 (815)
Q Consensus       745 ~l~~~~~~l~~L~~L~i~~c~~l~~l~~~~~~~~L~~L~i~~c~~l~----~~~~~~~~~~w~~~~~i~~~  811 (815)
                      .+|..+..+++|++|++++|+--..+|..+.+.++....+.|||.+.    ..|....+++|++|+|+|..
T Consensus       695 ~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~  765 (768)
T 3rgz_A          695 RIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHH  765 (768)
T ss_dssp             CCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC-------------
T ss_pred             cCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCcccc
Confidence            89999999999999999997666678887777788888888877553    27999999999999999865



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 815
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.0 bits (97), Expect = 2e-04
 Identities = 34/232 (14%), Positives = 72/232 (31%), Gaps = 14/232 (6%)

Query: 168 LPDSIGDL--RYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCD-RLKKLCADMGNLAK 224
            PD  G L  + +       + +          + +  + L +    +  L   +   +K
Sbjct: 13  HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSK 72

Query: 225 LHHLKNSNTKSLEEMPVGIGRLTSLQTLCNFVVGKGSGSGLRELKLLTHLHGTLNISKLE 284
           L +L     +  + +   + + ++L  L        S   L+ L         LN+S   
Sbjct: 73  LQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCF 132

Query: 285 NVKDVGDAKEAQLDGKKNLRELLLRWTLSTDGSSSREAEIEKDVLNMLKPHENLEQFCIS 344
           +  +           +   +  L  +  +   S             +++   NL    +S
Sbjct: 133 DFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLS---------TLVRRCPNLVHLDLS 183

Query: 345 GYGGTKFPTWFGDSSFSNLVTLEFENCDMCT--ALPSVGQLPSLKHLAVCGM 394
                K   +      + L  L    C       L  +G++P+LK L V G+
Sbjct: 184 DSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI 235


>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query815
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.76
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.61
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.53
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.5
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.43
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.38
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.38
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.33
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.29
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.15
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.1
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.02
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.77
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.8
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.5
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.26
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.38
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.77
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.87  E-value=5.7e-21  Score=201.89  Aligned_cols=86  Identities=17%  Similarity=0.349  Sum_probs=72.6

Q ss_pred             cCCCcccEEEcCCCCccccCccccCCccCCEEecCCCCCCccchhhhccCCCcEEeccCCccccccchhhcCcCCcceee
Q 044882          150 FKLQRLRAFSLRGYHIFELPDSIGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCDRLKKLCADMGNLAKLHHLK  229 (815)
Q Consensus       150 ~~l~~Lr~L~L~~~~i~~lp~~~~~l~~L~~L~L~~~~i~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~L~~L~~L~  229 (815)
                      ..+.+|++|+++++.|+.+ +.++.+++|++|++++|+|+.+|. ++++++|++|++++| .+..++. ++++++|+.|+
T Consensus        41 ~~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n-~i~~i~~-l~~l~~L~~L~  116 (384)
T d2omza2          41 TDLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNN-QIADITP-LANLTNLTGLT  116 (384)
T ss_dssp             HHHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSS-CCCCCGG-GTTCTTCCEEE
T ss_pred             HHhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccc-ccccccc-ccccccccccc
Confidence            3567799999999999888 468889999999999999999874 899999999999999 6777765 88999999999


Q ss_pred             ccCCCcccccc
Q 044882          230 NSNTKSLEEMP  240 (815)
Q Consensus       230 l~~~~~l~~~p  240 (815)
                      ++++. ...++
T Consensus       117 ~~~~~-~~~~~  126 (384)
T d2omza2         117 LFNNQ-ITDID  126 (384)
T ss_dssp             CCSSC-CCCCG
T ss_pred             ccccc-ccccc
Confidence            98887 44443



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure