Citrus Sinensis ID: 044886
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| 224131488 | 343 | predicted protein [Populus trichocarpa] | 0.961 | 0.513 | 0.655 | 7e-67 | |
| 118487572 | 345 | unknown [Populus trichocarpa] | 0.961 | 0.510 | 0.65 | 1e-66 | |
| 62526573 | 344 | aldo/keto reductase AKR [Manihot esculen | 0.967 | 0.514 | 0.663 | 3e-66 | |
| 357502825 | 339 | Aldo/keto reductase [Medicago truncatula | 0.961 | 0.519 | 0.646 | 3e-66 | |
| 217073738 | 339 | unknown [Medicago truncatula] gi|3885195 | 0.961 | 0.519 | 0.646 | 3e-66 | |
| 449468806 | 342 | PREDICTED: probable aldo-keto reductase | 0.945 | 0.505 | 0.671 | 2e-65 | |
| 225433674 | 341 | PREDICTED: auxin-induced protein PCNT115 | 0.945 | 0.507 | 0.682 | 3e-65 | |
| 147767361 | 341 | hypothetical protein VITISV_040294 [Viti | 0.945 | 0.507 | 0.676 | 3e-65 | |
| 296089614 | 316 | unnamed protein product [Vitis vinifera] | 0.945 | 0.547 | 0.682 | 4e-65 | |
| 449484655 | 342 | PREDICTED: probable aldo-keto reductase | 0.945 | 0.505 | 0.671 | 5e-65 |
| >gi|224131488|ref|XP_002321097.1| predicted protein [Populus trichocarpa] gi|222861870|gb|EEE99412.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 258 bits (659), Expect = 7e-67, Method: Compositional matrix adjust.
Identities = 131/200 (65%), Positives = 154/200 (77%), Gaps = 24/200 (12%)
Query: 1 MSAFYGPSKPESGMIALTNHAIDSGINVLDTSDVYGPHTNEILLGKVI------------ 48
MSAFYGP KPES M++L +HAI+SG+ +LDTSD+YGPHTNEILLGK +
Sbjct: 26 MSAFYGPPKPESDMVSLIHHAINSGVTLLDTSDMYGPHTNEILLGKALKAGSGLREKVEL 85
Query: 49 -------YEDGKYSYCGDPAYLRAACEASLKRLDVDCIDLYDQHRIDTKVPIEVTIGELK 101
++DGK GDPAY+RAACEASLKRL +DC+DLY QHRIDTKVPIEVT+GELK
Sbjct: 86 ATKFGINFQDGKREIRGDPAYVRAACEASLKRLQLDCVDLYYQHRIDTKVPIEVTMGELK 145
Query: 102 RLVEEGKIKHIDLSEAFASTIRRAHTIHPITVVRLEWSLRSRDVKEEM-----ELGIGIV 156
+LVEEGKIK+I LSEA ASTIRRAH +HP+T V+LEWSL SRDV+EE+ ELGIGIV
Sbjct: 146 KLVEEGKIKYIGLSEASASTIRRAHAVHPVTAVQLEWSLWSRDVEEEIVPTCRELGIGIV 205
Query: 157 AYNLLECEFLSSGPKLIHLF 176
AY+ L FLSSGPKL+ F
Sbjct: 206 AYSPLGRGFLSSGPKLVESF 225
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118487572|gb|ABK95612.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|62526573|gb|AAX84672.1| aldo/keto reductase AKR [Manihot esculenta] | Back alignment and taxonomy information |
|---|
| >gi|357502825|ref|XP_003621701.1| Aldo/keto reductase [Medicago truncatula] gi|124360844|gb|ABN08816.1| Aldo/keto reductase [Medicago truncatula] gi|355496716|gb|AES77919.1| Aldo/keto reductase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217073738|gb|ACJ85229.1| unknown [Medicago truncatula] gi|388519533|gb|AFK47828.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449468806|ref|XP_004152112.1| PREDICTED: probable aldo-keto reductase 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225433674|ref|XP_002266027.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147767361|emb|CAN68994.1| hypothetical protein VITISV_040294 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296089614|emb|CBI39433.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449484655|ref|XP_004156942.1| PREDICTED: probable aldo-keto reductase 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 183 | ||||||
| TAIR|locus:2036504 | 345 | ATB2 [Arabidopsis thaliana (ta | 0.693 | 0.368 | 0.674 | 3.3e-59 | |
| TAIR|locus:2036611 | 345 | AT1G60690 "AT1G60690" [Arabido | 0.693 | 0.368 | 0.689 | 1.4e-58 | |
| TAIR|locus:2196446 | 344 | AT1G10810 "AT1G10810" [Arabido | 0.693 | 0.369 | 0.689 | 8.8e-57 | |
| TAIR|locus:2036591 | 346 | AT1G60680 "AT1G60680" [Arabido | 0.628 | 0.332 | 0.708 | 8.8e-55 | |
| TAIR|locus:2036551 | 330 | AT1G60750 [Arabidopsis thalian | 0.639 | 0.354 | 0.704 | 1.1e-54 | |
| TIGR_CMR|SPO_A0345 | 327 | SPO_A0345 "oxidoreductase, ald | 0.661 | 0.370 | 0.476 | 2.4e-33 | |
| TIGR_CMR|GSU_3126 | 334 | GSU_3126 "oxidoreductase, aldo | 0.590 | 0.323 | 0.495 | 6.2e-33 | |
| POMBASE|SPAC1F7.12 | 340 | yak3 "aldose reductase ARK13 f | 0.562 | 0.302 | 0.461 | 2e-28 | |
| ASPGD|ASPL0000072041 | 351 | AN8733 [Emericella nidulans (t | 0.595 | 0.310 | 0.418 | 2.2e-27 | |
| ASPGD|ASPL0000051701 | 339 | AN10217 [Emericella nidulans ( | 0.595 | 0.321 | 0.403 | 7.1e-24 |
| TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 450 (163.5 bits), Expect = 3.3e-59, Sum P(2) = 3.3e-59
Identities = 89/132 (67%), Positives = 108/132 (81%)
Query: 47 VIYEDGKYSYCGDPAYLRAACEASLKRLDVDCIDLYDQHRIDTKVPIEVTIGELKRLVEE 106
+ Y +GK GDP Y+RAACEASLKRLD+ CIDLY QHR+DT+VPIE+T+GELK+LVEE
Sbjct: 92 ISYAEGKREVRGDPEYVRAACEASLKRLDIACIDLYYQHRVDTRVPIEITMGELKKLVEE 151
Query: 107 GKIKHIDLSEAFASTIRRAHTIHPITVVRLEWSLRSRDVKEEM-----ELGIGIVAYNLL 161
GKIK+I LSEA ASTIRRAH +HPIT V++EWSL +RDV+EE+ ELGIGIVAY+ L
Sbjct: 152 GKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLWTRDVEEEIIPTCRELGIGIVAYSPL 211
Query: 162 ECEFLSSGPKLI 173
F +SGPKL+
Sbjct: 212 GRGFFASGPKLV 223
|
|
| TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000072041 AN8733 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 7e-41 | |
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 5e-40 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 1e-37 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 1e-15 | |
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 1e-13 | |
| PRK09912 | 346 | PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r | 9e-11 | |
| TIGR01293 | 317 | TIGR01293, Kv_beta, voltage-dependent potassium ch | 8e-09 | |
| PLN02587 | 314 | PLN02587, PLN02587, L-galactose dehydrogenase | 1e-06 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 1e-06 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 1e-04 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 2e-04 |
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
Score = 139 bits (353), Expect = 7e-41
Identities = 64/179 (35%), Positives = 93/179 (51%), Gaps = 26/179 (14%)
Query: 6 GPSKPESGMIALTNHAIDSGINVLDTSDVYGPHTNEILLGKVIYEDG------------- 52
+ E+ I + + A+D+GIN DT+DVYG +E +LG+ + E G
Sbjct: 27 TDDEEEAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEALKERGRRDKVVIATKVGY 86
Query: 53 -------KYSYCGDPAYLRAACEASLKRLDVDCIDLYDQHRIDTKVPIEVTIGELKRLVE 105
+ ++R A EASLKRL D IDLY HR D + PIE T+ L LV
Sbjct: 87 RPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVR 146
Query: 106 EGKIKHIDLSEAFASTIRRAHTI-HPITVVRLEWSLRSRDVKEEM-----ELGIGIVAY 158
EGKI++I +S A I A + PI ++ E++L RD ++E+ E GIG++AY
Sbjct: 147 EGKIRYIGVSNYSAEQIAEALAVAAPIDSLQPEYNLLERDAEKELLPLCREEGIGLLAY 205
|
Length = 316 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 100.0 | |
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 100.0 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 100.0 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 100.0 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 99.98 | |
| KOG3023 | 285 | consensus Glutamate-cysteine ligase regulatory sub | 97.79 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 90.71 | |
| PRK13958 | 207 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 87.42 | |
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 86.16 | |
| PRK01222 | 210 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 83.44 | |
| PF07555 | 306 | NAGidase: beta-N-acetylglucosaminidase ; InterPro: | 82.05 | |
| COG0135 | 208 | TrpF Phosphoribosylanthranilate isomerase [Amino a | 80.36 |
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-42 Score=276.78 Aligned_cols=177 Identities=40% Similarity=0.556 Sum_probs=159.7
Q ss_pred CCCCCCCHHHHHHHHHHHHHcCCCeEeCcCCCCCCchHHHHHHHHhhCC----------CC--------CCCCCHHHHHH
Q 044886 4 FYGPSKPESGMIALTNHAIDSGINVLDTSDVYGPHTNEILLGKVIYEDG----------KY--------SYCGDPAYLRA 65 (183)
Q Consensus 4 ~~g~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~sE~~~g~~l~~~~----------k~--------~~~~~~~~i~~ 65 (183)
+||+..+++++++++.+|+++|+|+||||++||+|.||..+|++|++.. |. ....+...+.+
T Consensus 36 ~~~~~~~~e~a~~~m~~a~e~Gin~fDtAe~Yg~~~~E~llg~~i~~~~~~R~~vviaTK~~~~~~~~~~~G~~~~~i~~ 115 (336)
T KOG1575|consen 36 TFGGQIDKEEAFELLDHAYEAGINFFDTAEVYGNGQSEELLGEFIKSRGWRRDKVVIATKFGFDYGGETPRGLSRKHIIE 115 (336)
T ss_pred ccccCCCHHHHHHHHHHHHHcCCCEEehhhhcCCcccHHHHHHHHHhcCCcCCcEEEEEEEeccCCCcCCCCCcHHHHHH
Confidence 5677679999999999999999999999999999999999999998631 21 23557788999
Q ss_pred HHHHHHHHcCCCCcceEEeccCCCCCCHHHHHHHHHHHHHcCCccEEEecCcCHHHHHHHhhcCC--eeEEeeecCcccC
Q 044886 66 ACEASLKRLDVDCIDLYDQHRIDTKVPIEVTIGELKRLVEEGKIKHIDLSEAFASTIRRAHTIHP--ITVVRLEWSLRSR 143 (183)
Q Consensus 66 ~~~~sL~~lg~~~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iG~s~~~~~~l~~~~~~~~--~~~~q~~~~~~~~ 143 (183)
.++.|+++||++|||+|++||+|+..++++++++|.+++++|||++||+|++++++++++....+ +.++|++||++.+
T Consensus 116 ~~~~s~~rl~~~~IDl~q~Hr~D~~~piee~m~aL~~lve~Gki~yiGlSe~sa~~I~~a~~~~~~p~~s~Q~eysl~~R 195 (336)
T KOG1575|consen 116 GVRDSLRRLQTDYIDLLQVHRWDPMVPIEETMRALTDLVEQGKIRYWGLSEWSAEEIREAHAVAPIPIVAVQVEYSLLSR 195 (336)
T ss_pred HHHHHHHhcCCCeeEEEEEcccCCCCCHHHHHHHHHHHHhcCceEEEEeccCCHHHHHHHHHhcCCCceEeeeechhhhc
Confidence 99999999999999999999999999999999999999999999999999999999999999866 9999999999999
Q ss_pred CcHH-HH-----hcCCeEEEeccCCccccCCCCCCCCCCCCCC
Q 044886 144 DVKE-EM-----ELGIGIVAYNLLECEFLSSGPKLIHLFATKG 180 (183)
Q Consensus 144 ~~~~-~~-----~~~i~v~a~~~l~~G~l~~~~~~~~~~~~~~ 180 (183)
+.+. ++ +.||++++|+||++|+|++|+......+.++
T Consensus 196 d~ee~~i~~~c~~~Gi~li~ysPL~~G~Ltgk~~~~e~~~~~~ 238 (336)
T KOG1575|consen 196 DKEERGIIPLCRELGIGLIAWSPLGRGLLTGKYKLGEDSRNGD 238 (336)
T ss_pred chhhhhHHHHHHHcCcceEEecccccceeccCccccccccccc
Confidence 9766 45 9999999999999999999998765555443
|
|
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
| >PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF07555 NAGidase: beta-N-acetylglucosaminidase ; InterPro: IPR011496 This family consists of both eukaryotic and prokaryotic hyaluronidases | Back alignment and domain information |
|---|
| >COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 183 | ||||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-39 | ||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-39 | ||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 9e-39 | ||
| 3v0s_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 8e-38 | ||
| 1ynp_A | 317 | Aldo-keto Reductase Akr11c1 From Bacillus Haloduran | 2e-12 | ||
| 3erp_A | 353 | Structure Of Idp01002, A Putative Oxidoreductase Fr | 8e-11 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 1e-10 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 4e-10 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 1e-09 | ||
| 4aub_A | 366 | The Complex Structure Of The Bacterial Aldo-Keto Re | 1e-08 | ||
| 3n6q_A | 346 | Crystal Structure Of Yghz From E. Coli Length = 346 | 1e-08 | ||
| 1zsx_A | 347 | Crystal Structure Of Human Potassium Channel Kv Bet | 3e-08 | ||
| 3lut_A | 367 | A Structural Model For The Full-Length Shaker Potas | 3e-08 | ||
| 1qrq_A | 325 | Structure Of A Voltage-Dependent K+ Channel Beta Su | 4e-08 | ||
| 3eau_A | 327 | Voltage-Dependent K+ Channel Beta Subunit In Comple | 4e-08 | ||
| 1exb_A | 332 | Structure Of The Cytoplasmic Beta Subunit-T1 Assemb | 4e-08 | ||
| 2a79_A | 333 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 4e-08 | ||
| 3eb4_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (I211r) I | 5e-08 | ||
| 3eb3_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (W121a) I | 6e-08 | ||
| 2bp1_B | 360 | Structure Of The Aflatoxin Aldehyde Reductase In Co | 3e-05 | ||
| 2c91_A | 338 | Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt | 2e-04 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 2e-04 | ||
| 1gve_A | 327 | Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live | 3e-04 | ||
| 1mrq_A | 323 | Crystal Structure Of Human 20alpha-hsd In Ternary C | 5e-04 | ||
| 3gug_A | 323 | Crystal Structure Of Akr1c1 L308v Mutant In Complex | 5e-04 | ||
| 3c3u_A | 323 | Crystal Structure Of Akr1c1 In Complex With Nadp An | 5e-04 | ||
| 2clp_A | 347 | Crystal Structure Of Human Aflatoxin B1 Aldehyde Re | 5e-04 | ||
| 2ipf_A | 318 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 6e-04 | ||
| 2he5_A | 323 | Crystal Structure Of 17alpha-Hydroxysteroid Dehydro | 6e-04 | ||
| 3cv6_A | 323 | The Crystal Structure Of Mouse 17-Alpha Hydroxyster | 6e-04 | ||
| 3fjn_A | 323 | The Crystal Structure Of 17-Alpha Hydroxysteroid De | 7e-04 | ||
| 3up8_A | 298 | Crystal Structure Of A Putative 2,5-Diketo-D-Glucon | 8e-04 |
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
|
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 | Back alignment and structure |
| >pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 | Back alignment and structure |
| >pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 | Back alignment and structure |
| >pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 | Back alignment and structure |
| >pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 | Back alignment and structure |
| >pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 | Back alignment and structure |
| >pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 | Back alignment and structure |
| >pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 | Back alignment and structure |
| >pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
| >pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 | Back alignment and structure |
| >pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 | Back alignment and structure |
| >pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 | Back alignment and structure |
| >pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 | Back alignment and structure |
| >pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 | Back alignment and structure |
| >pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 | Back alignment and structure |
| >pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 | Back alignment and structure |
| >pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 183 | |||
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 8e-77 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 1e-76 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 5e-66 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 8e-62 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 1e-55 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 7e-48 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 6e-32 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 7e-31 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 2e-28 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 4e-28 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 6e-26 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 8e-25 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 2e-15 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 6e-08 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 1e-07 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 3e-07 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 3e-07 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 3e-07 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 5e-07 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 1e-06 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 1e-06 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 1e-06 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 2e-06 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 3e-06 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 7e-06 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 1e-05 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 2e-05 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 4e-05 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 7e-05 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 8e-05 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 9e-05 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 1e-04 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 1e-04 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 2e-04 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 3e-04 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 3e-04 |
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
Score = 232 bits (594), Expect = 8e-77
Identities = 42/184 (22%), Positives = 84/184 (45%), Gaps = 26/184 (14%)
Query: 1 MSAFYGPSKPESGMIALTNHAIDSGINVLDTSDVYGPHTNEILLGKVI------------ 48
+ + + + + A+D GIN++DT+ VYG +E ++G+ +
Sbjct: 41 IGGWMWGGPDDDNGVRTIHAALDEGINLIDTAPVYGFGHSEEIVGRALAEKPNKAHVATK 100
Query: 49 ---------YEDGKYSYCGDPAYLRAACEASLKRLDVDCIDLYDQHRIDTKVPIEVTIGE 99
++ K PA +R E SL+RL V+ IDL H D K PI+ + E
Sbjct: 101 LGLHWVGEDEKNMKVFRDSRPARIRKEVEDSLRRLRVETIDLEQIHWPDDKTPIDESARE 160
Query: 100 LKRLVEEGKIKHIDLSEAFASTIRRAHTIHPITVVRLEWSLRSRDVKEEM-----ELGIG 154
L++L ++GKI+ + +S + + P+ ++ +L R +++++ +
Sbjct: 161 LQKLHQDGKIRALGVSNFSPEQMDIFREVAPLATIQPPLNLFERTIEKDILPYAEKHNAV 220
Query: 155 IVAY 158
++AY
Sbjct: 221 VLAY 224
|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 97.77 |
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-44 Score=291.13 Aligned_cols=169 Identities=28% Similarity=0.417 Sum_probs=153.5
Q ss_pred CCHHHHHHHHHHHHHcCCCeEeCcCCCCCCchHHHHHHHHhhC--------CCC---C------CCCCHHHHHHHHHHHH
Q 044886 9 KPESGMIALTNHAIDSGINVLDTSDVYGPHTNEILLGKVIYED--------GKY---S------YCGDPAYLRAACEASL 71 (183)
Q Consensus 9 ~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~sE~~~g~~l~~~--------~k~---~------~~~~~~~i~~~~~~sL 71 (183)
.+++++.++|+.|+++|||+||||+.||.|.||+.+|++|+.. +|. . .+.+++.+++++++||
T Consensus 32 ~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~G~sE~~lG~al~~~~R~~~~i~TK~g~~~~~~~~~~~~~~~~i~~~~~~SL 111 (312)
T 1pyf_A 32 LNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESL 111 (312)
T ss_dssp CCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGCEEEEEECEEEETTEEEECCCHHHHHHHHHHHH
T ss_pred CCHHHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHhhhcCCCeEEEEEEeCCCCCCCCCCCCCCHHHHHHHHHHHH
Confidence 5889999999999999999999999999999999999999751 342 1 3678999999999999
Q ss_pred HHcCCCCcceEEeccCCCCCCHHHHHHHHHHHHHcCCccEEEecCcCHHHHHHHhhcCCeeEEeeecCcccCCcHH---H
Q 044886 72 KRLDVDCIDLYDQHRIDTKVPIEVTIGELKRLVEEGKIKHIDLSEAFASTIRRAHTIHPITVVRLEWSLRSRDVKE---E 148 (183)
Q Consensus 72 ~~lg~~~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iG~s~~~~~~l~~~~~~~~~~~~q~~~~~~~~~~~~---~ 148 (183)
++||+||||+|++|||++..+++++|++|++|+++||||+||+|||++++++++++..+|+++|++||+++++.+. .
T Consensus 112 ~rL~~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~~~l~~~~~~~~~~~~Q~~~~~~~~~~e~~l~~ 191 (312)
T 1pyf_A 112 KRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFP 191 (312)
T ss_dssp HHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCHHHHHHHTTTSCCCEEEEECBTTBCGGGTTHHH
T ss_pred HHhCCCcEEEEEeCCCCCCCCHHHHHHHHHHHHHCCCcCEEEecCCCHHHHHHHHhhCCceEEeccCCccccchHHHHHH
Confidence 9999999999999999988899999999999999999999999999999999999998999999999999988753 3
Q ss_pred H--hcCCeEEEeccCCccccCCCCCCCCCCC
Q 044886 149 M--ELGIGIVAYNLLECEFLSSGPKLIHLFA 177 (183)
Q Consensus 149 ~--~~~i~v~a~~~l~~G~l~~~~~~~~~~~ 177 (183)
+ ++||++++|+||++|+|++++.....++
T Consensus 192 ~~~~~gi~v~a~spL~~G~L~~~~~~~~~~~ 222 (312)
T 1pyf_A 192 YTKEHNISFIPYFPLVSGLLAGKYTEDTTFP 222 (312)
T ss_dssp HHHHHTCEEEEESTTTTTGGGTCCCTTCCCC
T ss_pred HHHHcCCeEEEecccccccccCCCCCCCCCC
Confidence 3 9999999999999999999886544443
|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 183 | ||||
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 5e-22 | |
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 3e-21 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 2e-15 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 3e-15 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 3e-13 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 6e-13 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 1e-12 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 4e-12 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 3e-11 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 9e-11 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 1e-10 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 1e-10 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 5e-10 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 2e-09 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 6e-09 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 1e-08 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Putative oxidoreductase IolS species: Bacillus subtilis [TaxId: 1423]
Score = 88.5 bits (218), Expect = 5e-22
Identities = 44/177 (24%), Positives = 81/177 (45%), Gaps = 22/177 (12%)
Query: 5 YGPSKPESGMIALTNHAIDSGINVLDTSDVYGPHTNEILLGKVIYE-------------- 50
P+ E L AI +G+ +LDT+ +YG +E L+G+V+ E
Sbjct: 27 LYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVIATKAAH 86
Query: 51 ---DGKYSYCGDPAYLRAACEASLKRLDVDCIDLYDQHRIDTKVPIEVTIGELKRLVEEG 107
+ + P +L+ + + SLKRL+ D IDL+ H D P + + L + + G
Sbjct: 87 RKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAG 146
Query: 108 KIKHIDLSEAFASTIRRAHTIHPITVVRLEWSLRSRDVKEEM-----ELGIGIVAYN 159
KI+ I +S ++ A+ + V++ E++L +R+ ++ E I + Y
Sbjct: 147 KIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYF 203
|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 183 | |||
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 100.0 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 100.0 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 100.0 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 100.0 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 100.0 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 100.0 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 100.0 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 100.0 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 100.0 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 99.98 | |
| d1x87a_ | 545 | Urocanate hydratase HutU {Bacillus stearothermophi | 86.81 | |
| d1uwka_ | 554 | Urocanate hydratase HutU {Pseudomonas putida [TaxI | 86.55 | |
| d1jpma1 | 234 | L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: | 83.8 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x87a_ e.51.1.1 (A:) Urocanate hydratase HutU {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uwka_ e.51.1.1 (A:) Urocanate hydratase HutU {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|