Citrus Sinensis ID: 044898


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MANLSCIFFTAFLLQCTFLNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTVQNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNCMVPPVQMQCPLRSGKQKTRPTAQCHEWRG
cccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEccccEEEEEcccccccccccEEEccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccEEEccccccEEccccccccccccEEEccccccccccccccccccccccccccccccEEEccccccccccccEEccccEEEEEccccccccccEEEccccccccccccccccccEEcccccccEEcccHHHHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEccccEEEEEEEEEEcEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccccEEEccHHHHHHccEEEccccccccccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccEEEEcccccccccccccccccccEEEcccccccccccHHHccccEEEcccccccccccHHHccHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccHccHHHHHHHHcccccccccc
MANLSCIFFTAFLLQCTFLNVFAILDPVDFLALQAIRKSlddlpgsnffaswdftsdpcnfagvycdadkvialnlgdpragspgltgrldpaigkltslaelsivpgrvigklpqsLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYnqltgaipqsigtlpelSNVILChnklsgsvppflsHALTRldlkhndlsgslapdslppsvqylslswnrlsgpvdrllsrldqlnYLDLSlnqfngnipgriftfpitnlqlqrnafagpvqppdqvtiptvdlshnmlsgqispsfsTVQNLYlnnnrftgqvpgsfVDHLLDASIQILYLQHNfltgieinptaeipsssslclqyncmvppvqmqcplrsgkqktrptaqchewrg
MANLSCIFFTAFLLQCTFLNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTVQNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNCMVPPVQMqcplrsgkqktrptaqchewrg
MANLSCIFFTAFLLQCTFLNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTVQNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNCMVPPVQMQCPLRSGKQKTRPTAQCHEWRG
***LSCIFFTAFLLQCTFLNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLSHALTRLDLKH**************SVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTVQNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNCMVPPVQMQ*********************
***LSCIFFTAFLLQCTFLNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTVQNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNCMVPPV************************
MANLSCIFFTAFLLQCTFLNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTVQNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNCMVPPVQMQCP*******************
*ANLSCIFFTAFLLQCTFLNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTVQNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNCMVPPVQMQCPLRSGKQKTRPT********
iHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANLSCIFFTAFLLQCTFLNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTVQNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNCMVPPVQMQCPLRSGKQKTRPTAQCHEWRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query396 2.2.26 [Sep-21-2011]
Q00874372 DNA-damage-repair/tolerat no no 0.755 0.803 0.332 6e-35
Q42371 976 LRR receptor-like serine/ no no 0.835 0.339 0.319 1e-33
Q9SCT4 836 Probably inactive leucine no no 0.777 0.368 0.350 5e-33
Q6XAT2 967 LRR receptor-like serine/ no no 0.760 0.311 0.310 4e-32
C0LGW6 966 LRR receptor-like serine/ no no 0.830 0.340 0.304 9e-32
C0LGU1 959 Probable LRR receptor-lik no no 0.876 0.361 0.286 2e-28
Q9C9H7 847 Receptor-like protein 12 no no 0.719 0.336 0.323 3e-28
O49545 1003 Leucine-rich repeat recep no no 0.654 0.258 0.350 6e-28
O82318 960 Probably inactive leucine no no 0.755 0.311 0.343 6e-27
Q9FZ59 1088 Leucine-rich repeat recep no no 0.787 0.286 0.338 7e-27
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function desciption
 Score =  148 bits (374), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 109/328 (33%), Positives = 182/328 (55%), Gaps = 29/328 (8%)

Query: 27  PVDFLALQAIRKSLDDLPGSNFFASWDFTSDPC-NFAGVYCDAD--KVIALNL-GDP--- 79
           P D  AL A + SL + P    F +W   +D C  + G+ CD D  +V  ++L G+    
Sbjct: 29  PKDQTALNAFKSSLSE-PNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESEDA 87

Query: 80  ---RAGSPG-LTGRLDPAIGKLTSLAELSIVPGR-VIGKLPQSLSQLKNLRFFAISRNFV 134
              +AG  G ++G +DPA+  LT+L  L +   + + G++P  ++ L +LR   ++ N +
Sbjct: 88  IFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNKI 147

Query: 135 SGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLS--H 192
           +GEIPA +G+L  L  L+L+ NQ++G IP S+ +L EL ++ L  N ++G +P       
Sbjct: 148 TGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSLK 207

Query: 193 ALTRLDLKHNDLSGSLAPDSLP--PSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQ 250
            L+R+ L  N+L+GS+ P+S+     +  L LS N + GP+   +  +  L+ L+L  N 
Sbjct: 208 MLSRVLLGRNELTGSI-PESISGMERLADLDLSKNHIEGPIPEWMGNMKVLSLLNLDCNS 266

Query: 251 FNGNIPGRIFTFPITNL-QLQRNAFAGPVQPPD----QVTIPTVDLSHNMLSGQISPSFS 305
             G IPG + +    ++  L RNA  G +  PD    +  + ++DLSHN LSG+I  S S
Sbjct: 267 LTGPIPGSLLSNSGLDVANLSRNALEGTI--PDVFGSKTYLVSLDLSHNSLSGRIPDSLS 324

Query: 306 T---VQNLYLNNNRFTGQVPGSF-VDHL 329
           +   V +L +++N+  G++P  F  DHL
Sbjct: 325 SAKFVGHLDISHNKLCGRIPTGFPFDHL 352




This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGU1|Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
255567588400 serine-threonine protein kinase, plant-t 1.0 0.99 0.812 0.0
224131280399 predicted protein [Populus trichocarpa] 0.984 0.977 0.789 1e-178
296086666 509 unnamed protein product [Vitis vinifera] 0.954 0.742 0.806 1e-172
359479846402 PREDICTED: probably inactive leucine-ric 0.969 0.955 0.799 1e-172
356536745401 PREDICTED: LRR receptor-like serine/thre 0.977 0.965 0.746 1e-171
297843156396 leucine-rich repeat family protein [Arab 0.944 0.944 0.772 1e-171
449462294395 PREDICTED: receptor-like protein 12-like 0.967 0.969 0.768 1e-170
356502838403 PREDICTED: probably inactive leucine-ric 0.941 0.925 0.758 1e-170
449491530395 PREDICTED: LOW QUALITY PROTEIN: protein 0.967 0.969 0.768 1e-169
449444659404 PREDICTED: serine/threonine-protein kina 0.984 0.965 0.746 1e-168
>gi|255567588|ref|XP_002524773.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223535957|gb|EEF37616.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/400 (81%), Positives = 358/400 (89%), Gaps = 4/400 (1%)

Query: 1   MANLSCI--FFTAFLL--QCTFLNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTS 56
           M N+  I   F+ ++L   C    V AILDP+DFLALQ+IRKSL+D+PGSNFF SWDFTS
Sbjct: 1   MGNIKLIKTTFSGYILLGTCLLQLVHAILDPMDFLALQSIRKSLEDMPGSNFFTSWDFTS 60

Query: 57  DPCNFAGVYCDADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQ 116
           DPCNFAGVYCDADKVIALNLGDPRAGS GLTGRLDPAIGKL++LAELSIVPGR+IG LPQ
Sbjct: 61  DPCNFAGVYCDADKVIALNLGDPRAGSSGLTGRLDPAIGKLSALAELSIVPGRIIGSLPQ 120

Query: 117 SLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVI 176
           SLSQLK LRF A+SRNF+SGEIPA+LGQLR L+TLDLSYNQLTG IP SIGT+P+LSNVI
Sbjct: 121 SLSQLKGLRFLAVSRNFLSGEIPASLGQLRNLKTLDLSYNQLTGPIPHSIGTIPQLSNVI 180

Query: 177 LCHNKLSGSVPPFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLS 236
           LCHN+LSGSVP FLS  LTRLDLKHNDLSGSL+P +LPPSVQYLSL+WNRLSGPVDRLL+
Sbjct: 181 LCHNRLSGSVPAFLSQTLTRLDLKHNDLSGSLSPYALPPSVQYLSLAWNRLSGPVDRLLN 240

Query: 237 RLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNML 296
           RL+QLNYLDLS+NQF G IPGR+FT+PI+NLQLQRN F GPVQP DQV I TVDLS+N L
Sbjct: 241 RLNQLNYLDLSMNQFTGGIPGRVFTYPISNLQLQRNLFCGPVQPSDQVIIGTVDLSYNRL 300

Query: 297 SGQISPSFSTVQNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIP 356
           SGQISP FS+VQNLYLNNNRFTGQVPGSFVD LL ASIQILYLQHN+LTGIEINPTAEIP
Sbjct: 301 SGQISPLFSSVQNLYLNNNRFTGQVPGSFVDRLLAASIQILYLQHNYLTGIEINPTAEIP 360

Query: 357 SSSSLCLQYNCMVPPVQMQCPLRSGKQKTRPTAQCHEWRG 396
            SSSLCLQYNCMVPPVQ  CPL++GKQKTRPTAQC EW+G
Sbjct: 361 LSSSLCLQYNCMVPPVQTPCPLKAGKQKTRPTAQCSEWKG 400




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224131280|ref|XP_002321045.1| predicted protein [Populus trichocarpa] gi|222861818|gb|EEE99360.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296086666|emb|CBI32301.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359479846|ref|XP_002272042.2| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356536745|ref|XP_003536896.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA-like [Glycine max] Back     alignment and taxonomy information
>gi|297843156|ref|XP_002889459.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297335301|gb|EFH65718.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449462294|ref|XP_004148876.1| PREDICTED: receptor-like protein 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356502838|ref|XP_003520222.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At2g25790-like [Glycine max] Back     alignment and taxonomy information
>gi|449491530|ref|XP_004158927.1| PREDICTED: LOW QUALITY PROTEIN: protein BRASSINOSTEROID INSENSITIVE 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449444659|ref|XP_004140091.1| PREDICTED: serine/threonine-protein kinase BRI1-like 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query396
TAIR|locus:2139320395 AT4G03010 [Arabidopsis thalian 0.979 0.982 0.750 7.7e-158
TAIR|locus:2020733397 AT1G03440 [Arabidopsis thalian 0.969 0.967 0.745 3.8e-156
TAIR|locus:2090472396 AT3G17640 "AT3G17640" [Arabido 0.944 0.944 0.419 1.4e-73
TAIR|locus:2097458419 AT3G59510 [Arabidopsis thalian 0.952 0.899 0.332 3.1e-44
TAIR|locus:2005507 976 ER "ERECTA" [Arabidopsis thali 0.835 0.339 0.319 3.9e-36
TAIR|locus:2098267 836 IMK2 "inflorescence meristem r 0.845 0.400 0.341 4.1e-35
TAIR|locus:2167948 966 ERL1 "ERECTA-like 1" [Arabidop 0.830 0.340 0.307 5.8e-35
TAIR|locus:2182855 967 ERL2 "ERECTA-like 2" [Arabidop 0.823 0.337 0.304 2e-34
TAIR|locus:2049098382 AT2G15320 [Arabidopsis thalian 0.830 0.861 0.309 5.8e-34
TAIR|locus:4515102753 598 AT1G73066 [Arabidopsis thalian 0.838 0.555 0.323 1.7e-32
TAIR|locus:2139320 AT4G03010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1538 (546.5 bits), Expect = 7.7e-158, P = 7.7e-158
 Identities = 292/389 (75%), Positives = 339/389 (87%)

Query:     9 FTAFLLQCTF-LNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCD 67
             F+  LL   F L V +I+ PVDFLALQAIRKSLDDLPGSNFF SWDFTSDPCNFAGVYCD
Sbjct:     7 FSVLLLLLRFGLIVESIIVPVDFLALQAIRKSLDDLPGSNFFDSWDFTSDPCNFAGVYCD 66

Query:    68 ADKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFF 127
              DKV ALNLGDPRAGSPGL+GR+DPAIGKL++L ELSIVPGR++G LP ++SQ KNLRF 
Sbjct:    67 DDKVTALNLGDPRAGSPGLSGRIDPAIGKLSALTELSIVPGRIMGSLPHTISQSKNLRFL 126

Query:   128 AISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVP 187
             AISRNF+SGEIPA+L +LRGL+TLDLSYNQLTG+IP SIG+LPELSN+ILCHN L+GS+P
Sbjct:   127 AISRNFISGEIPASLSELRGLKTLDLSYNQLTGSIPPSIGSLPELSNLILCHNHLNGSIP 186

Query:   188 PFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLS 247
              FLS +LTR+DLK N+L+G ++  SLPPS+QYLSL+WN+L+GPV R+L RL+QLNYLDLS
Sbjct:   187 QFLSQSLTRIDLKRNNLTGIISLTSLPPSLQYLSLAWNQLTGPVYRVLLRLNQLNYLDLS 246

Query:   248 LNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTV 307
             LN+F G IPG+IFTFPITNLQLQRN F G +QPP+QVTIPTVDLS+N  SG++SP  S V
Sbjct:   247 LNRFTGAIPGQIFTFPITNLQLQRNFFYGVIQPPNQVTIPTVDLSYNRFSGELSPLLSNV 306

Query:   308 QNLYLNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNC 367
             QNLYLNNNRFTGQVP SFVD LL ++IQ LYLQHNFLTGI+I+P A+IP SSSLCLQYNC
Sbjct:   307 QNLYLNNNRFTGQVPVSFVDRLLASNIQTLYLQHNFLTGIQISPAADIPVSSSLCLQYNC 366

Query:   368 MVPPVQMQCPLRSGKQKTRPTAQCHEWRG 396
             MV PVQ  CP+++G QKTRPT QC EWRG
Sbjct:   367 MVLPVQTPCPVKAGLQKTRPTTQCSEWRG 395




GO:0005576 "extracellular region" evidence=ISM
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2020733 AT1G03440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090472 AT3G17640 "AT3G17640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097458 AT3G59510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005507 ER "ERECTA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098267 IMK2 "inflorescence meristem receptor-like kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167948 ERL1 "ERECTA-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182855 ERL2 "ERECTA-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049098 AT2G15320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-30
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-23
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-11
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 7e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  139 bits (352), Expect = 6e-36
 Identities = 94/286 (32%), Positives = 144/286 (50%), Gaps = 18/286 (6%)

Query: 70  KVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAI 129
           K+I+L+L D       L+G +   + +L +L  L +      GK+P +L+ L  L+   +
Sbjct: 285 KLISLDLSDN-----SLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQL 339

Query: 130 SRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPF 189
             N  SGEIP  LG+   L  LDLS N LTG IP+ + +   L  +IL  N L G +P  
Sbjct: 340 WSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKS 399

Query: 190 LS--HALTRLDLKHNDLSGSLAPDSLP-PSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDL 246
           L    +L R+ L+ N  SG L  +    P V +L +S N L G ++     +  L  L L
Sbjct: 400 LGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSL 459

Query: 247 SLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTV---DLSHNMLSGQISPS 303
           + N+F G +P    +  + NL L RN F+G V P    ++  +    LS N LSG+I   
Sbjct: 460 ARNKFFGGLPDSFGSKRLENLDLSRNQFSGAV-PRKLGSLSELMQLKLSENKLSGEIPDE 518

Query: 304 FSTVQNLY---LNNNRFTGQVPGSFVDHLLDASIQILYLQHNFLTG 346
            S+ + L    L++N+ +GQ+P SF +  +   +  L L  N L+G
Sbjct: 519 LSSCKKLVSLDLSHNQLSGQIPASFSEMPV---LSQLDLSQNQLSG 561


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 396
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.98
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.88
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
KOG4237498 consensus Extracellular matrix protein slit, conta 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
PLN03150623 hypothetical protein; Provisional 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.29
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.26
PLN03150623 hypothetical protein; Provisional 99.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.23
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.21
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.18
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.09
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 99.01
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.64
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.57
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.57
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.55
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.5
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.27
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.24
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.15
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.12
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
PRK15386 426 type III secretion protein GogB; Provisional 97.96
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.9
PRK15386 426 type III secretion protein GogB; Provisional 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.74
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.41
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.36
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.93
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.93
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.65
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.16
KOG4341483 consensus F-box protein containing LRR [General fu 95.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.67
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.57
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.81
KOG4308478 consensus LRR-containing protein [Function unknown 94.78
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.65
KOG4308 478 consensus LRR-containing protein [Function unknown 94.3
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.41
smart0037026 LRR Leucine-rich repeats, outliers. 92.78
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.78
KOG4341483 consensus F-box protein containing LRR [General fu 92.13
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.34
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.16
smart0037026 LRR Leucine-rich repeats, outliers. 91.16
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 88.29
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.61
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.84
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 83.22
KOG3864221 consensus Uncharacterized conserved protein [Funct 82.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 82.19
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 81.78
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.2e-41  Score=358.92  Aligned_cols=335  Identities=29%  Similarity=0.524  Sum_probs=274.1

Q ss_pred             CChHHHHHHHHHHHhCCCCCCCCCCCCCCCCCCCCCcceeEeCC-CCEEEEEcCCCCCCCCCCceecCccccCCCCCCEE
Q 044898           25 LDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDA-DKVIALNLGDPRAGSPGLTGRLDPAIGKLTSLAEL  103 (396)
Q Consensus        25 ~~~~~~~~l~~~~~~~~~~~~~~~~~~W~~~~~~C~w~gv~c~~-~~v~~L~L~~~~~~~~~l~~~l~~~~~~l~~L~~L  103 (396)
                      .++.|..||++|++++.+ + ...+.+|+...++|.|.||.|+. ++|+.|+|+     ++++.|.++..+..+++|++|
T Consensus        26 ~~~~~~~~l~~~~~~~~~-~-~~~~~~w~~~~~~c~w~gv~c~~~~~v~~L~L~-----~~~i~~~~~~~~~~l~~L~~L   98 (968)
T PLN00113         26 LHAEELELLLSFKSSIND-P-LKYLSNWNSSADVCLWQGITCNNSSRVVSIDLS-----GKNISGKISSAIFRLPYIQTI   98 (968)
T ss_pred             CCHHHHHHHHHHHHhCCC-C-cccCCCCCCCCCCCcCcceecCCCCcEEEEEec-----CCCccccCChHHhCCCCCCEE
Confidence            356899999999999965 3 23568998778999999999985 799999999     467888889999999999999


Q ss_pred             EccCCcCccccchhhc-CCCCCcEEeccCCcCccccccccCCCCCCCEEEeecCcCCCCCCcccCCCcCCcEEEccCCcc
Q 044898          104 SIVPGRVIGKLPQSLS-QLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKL  182 (396)
Q Consensus       104 ~l~~n~l~~~~p~~l~-~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~l~~n~l  182 (396)
                      ++++|.+.+.+|..+. ++++|++|++++|.+++.+|.  +.+++|++|++++|.+++..|..+..+++|++|++++|.+
T Consensus        99 ~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l  176 (968)
T PLN00113         99 NLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVL  176 (968)
T ss_pred             ECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcc
Confidence            9999999988887765 899999999999999887775  4578899999999988888888888888999999999888


Q ss_pred             cccCCchhh--ccCCEEEccCCcCcccCCCC-CCCCCCcEEEcccCCCCccchhhhcCCCCCCEEeccCCcCcccCCccc
Q 044898          183 SGSVPPFLS--HALTRLDLKHNDLSGSLAPD-SLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRI  259 (396)
Q Consensus       183 ~~~~p~~~~--~~L~~L~l~~n~l~~~~~~~-~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~p~~~  259 (396)
                      .+.+|..+.  ++|++|++++|.+.+..|.. ...++|+.|++++|++++.+|..++.+++|++|++++|.+++.+|..+
T Consensus       177 ~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l  256 (968)
T PLN00113        177 VGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL  256 (968)
T ss_pred             cccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhH
Confidence            888888776  78888899888888776652 223788888888888888888888888888888888888888888887


Q ss_pred             cCc-ccCEEEccCCcccCcCCCC--CCCCcCEEEccCCCCcccCCcC---CcccceEEeecccccccCchhHHhcccCCc
Q 044898          260 FTF-PITNLQLQRNAFAGPVQPP--DQVTIPTVDLSHNMLSGQISPS---FSTVQNLYLNNNRFTGQVPGSFVDHLLDAS  333 (396)
Q Consensus       260 ~~~-~L~~L~l~~n~l~~~~~~~--~~~~L~~L~ls~N~l~~~~~~~---~~~L~~L~L~~N~l~~~~~~~~~~~~~~~~  333 (396)
                      ... +|++|++++|.+.+..|..  .+++|++|++++|.+.+.+|..   +++|+.|++++|.+++.+|..+..+   ++
T Consensus       257 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l---~~  333 (968)
T PLN00113        257 GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSL---PR  333 (968)
T ss_pred             hCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcC---CC
Confidence            776 7888888888888766544  6678888888888888777754   3467788888888887888777777   78


Q ss_pred             ccEEEccCCcCCCCCCCCCCCCCccchhcccCccCCCC
Q 044898          334 IQILYLQHNFLTGIEINPTAEIPSSSSLCLQYNCMVPP  371 (396)
Q Consensus       334 L~~L~L~~N~l~~~~~~~~~~l~~L~~L~l~~N~l~~~  371 (396)
                      |+.|++++|.+++..+..+..+++|+.|++++|.+.+.
T Consensus       334 L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~  371 (968)
T PLN00113        334 LQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGE  371 (968)
T ss_pred             CCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEee
Confidence            88888888888766566677777788888888777643



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 6e-18
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-18
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 7e-06
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 8e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-04
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 5e-04
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Iteration: 1

Score = 90.5 bits (223), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 83/294 (28%), Positives = 136/294 (46%), Gaps = 28/294 (9%) Query: 24 ILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCN--FAGVYCDAD----KVIALNLG 77 + +P D AL I+K DL +SW T+D CN + GV CD D +V L+L Sbjct: 2 LCNPQDKQALLQIKK---DLGNPTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLS 58 Query: 78 DPRAGSPGLTGRLDPAIGKLTSLAELSIVP----GRVIGKLPQSLSQLKNLRFFAISRNF 133 P P L +L L+ + ++G +P ++++L L + I+ Sbjct: 59 GLNLPKP------YPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTN 112 Query: 134 VSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPP---FL 190 VSG IP L Q++ L TLD SYN L+G +P SI +LP L + N++SG++P Sbjct: 113 VSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSF 172 Query: 191 SHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQ 250 S T + + N L+G + P ++ ++ LS N L G L + L+ N Sbjct: 173 SKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNS 232 Query: 251 FNGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVT----IPTVDLSHNMLSGQI 300 ++ + + L L+ N G + P +T + ++++S N L G+I Sbjct: 233 LAFDLGKVGLSKNLNGLDLRNNRIYGTL--PQGLTQLKFLHSLNVSFNNLCGEI 284
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query396
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-60
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-57
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-50
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-48
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-47
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-35
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-32
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-35
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-34
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-34
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-30
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-29
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-27
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-21
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-20
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  196 bits (502), Expect = 2e-60
 Identities = 85/340 (25%), Positives = 138/340 (40%), Gaps = 65/340 (19%)

Query: 26  DPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCN--FAGVYCDAD----KVIALNLGDP 79
           +P D  AL  I+K L +       +SW  T+D CN  + GV CD D    +V  L+L   
Sbjct: 4   NPQDKQALLQIKKDLGNPTT---LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLS-- 58

Query: 80  RAGSPGLTGRLD--PAIGKLTSLAELSIVPG-RVIGKLPQSLSQLKNLRFFAISRNFVSG 136
                 L        ++  L  L  L I     ++G +P ++++L  L +  I+   VSG
Sbjct: 59  ---GLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSG 115

Query: 137 EIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPF---LSHA 193
            IP  L Q++ L TLD SYN L+G +P SI +LP L  +    N++SG++P      S  
Sbjct: 116 AIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKL 175

Query: 194 LTRLDLKHNDLSGSLAPDSLPPSV-----QYLSLSWNRLSGPVDRLLSRLDQLNYLDLSL 248
            T + +  N L+G      +PP+       ++ LS N L G    L         + L+ 
Sbjct: 176 FTSMTISRNRLTG-----KIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAK 230

Query: 249 NQFNGNIPGRIFTFPITNL-QLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSFSTV 307
           N    ++        +     L                   +DL +N + G +    + +
Sbjct: 231 NSLAFDLG------KVGLSKNLN-----------------GLDLRNNRIYGTLPQGLTQL 267

Query: 308 QNL-YLN--NNRFTGQVP--GSFVDHLLDASIQILYLQHN 342
           + L  LN   N   G++P  G+           +    +N
Sbjct: 268 KFLHSLNVSFNNLCGEIPQGGNL------QRFDVSAYANN 301


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.98
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.96
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.24
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.24
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.93
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.93
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.79
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.7
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.5
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.49
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.33
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.82
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.42
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.15
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2e-45  Score=379.37  Aligned_cols=340  Identities=27%  Similarity=0.363  Sum_probs=251.6

Q ss_pred             hhhccCCChHHHHHHHHHHHhCCCCCCCCCCCCCCCCCCCCCcceeEeCCCCEEEEEcCCCCCCCCCCcee---cC----
Q 044898           19 LNVFAILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFAGVYCDADKVIALNLGDPRAGSPGLTGR---LD----   91 (396)
Q Consensus        19 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~W~~~~~~C~w~gv~c~~~~v~~L~L~~~~~~~~~l~~~---l~----   91 (396)
                      +++++...++|++||++||+++.+ |.  .+++|..+.|||.|.||+|+.++|++|+|++     .++.|.   +|    
T Consensus         3 ~~~~~~~~~~~~~all~~k~~~~~-~~--~l~~W~~~~~~C~w~gv~C~~~~v~~L~L~~-----~~l~g~~~~l~~~l~   74 (768)
T 3rgz_A            3 QASPSQSLYREIHQLISFKDVLPD-KN--LLPDWSSNKNPCTFDGVTCRDDKVTSIDLSS-----KPLNVGFSAVSSSLL   74 (768)
T ss_dssp             -----CCHHHHHHHHHHHHTTCSC-TT--SSTTCCTTSCGGGSTTEEEETTEEEEEECTT-----SCCCEEHHHHHHHTT
T ss_pred             cCccccCCHHHHHHHHHHHhhCCC-cc--cccCCCCCCCCcCCcceEECCCcEEEEECCC-----CCcCCccCccChhHh
Confidence            344555567899999999999985 43  6899987789999999999989999999994     456665   44    


Q ss_pred             -------------------ccccCCCCCCEEEccCCcCccccch--hhcCCCCCcEEeccCCcCcccccccc-CCCCCCC
Q 044898           92 -------------------PAIGKLTSLAELSIVPGRVIGKLPQ--SLSQLKNLRFFAISRNFVSGEIPAAL-GQLRGLR  149 (396)
Q Consensus        92 -------------------~~~~~l~~L~~L~l~~n~l~~~~p~--~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~  149 (396)
                                         ..++++++|++|++++|.+++.+|.  .++++++|++|++++|.+.+.+|..+ .++++|+
T Consensus        75 ~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~  154 (768)
T 3rgz_A           75 SLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLE  154 (768)
T ss_dssp             TCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCS
T ss_pred             ccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCC
Confidence                               4566667777777777777776666  67777777777777777776666554 6677777


Q ss_pred             EEEeecCcCCCCCCcc---cCCCcCCcEEEccCCcccccCCchhhccCCEEEccCCcCcccCCCCCCCCCCcEEEcccCC
Q 044898          150 TLDLSYNQLTGAIPQS---IGTLPELSNVILCHNKLSGSVPPFLSHALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNR  226 (396)
Q Consensus       150 ~L~L~~n~l~~~~p~~---~~~l~~L~~L~l~~n~l~~~~p~~~~~~L~~L~l~~n~l~~~~~~~~~~~~L~~L~L~~n~  226 (396)
                      +|++++|++++..|..   +.++++|++|++++|.+.+..|....++|++|++++|.+.+.++.....++|++|++++|.
T Consensus       155 ~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~n~  234 (768)
T 3rgz_A          155 VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNK  234 (768)
T ss_dssp             EEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCSSC
T ss_pred             EEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcCCc
Confidence            7777777777666655   6777777777777777776666544477888888888877766654444788888888888


Q ss_pred             CCccchhhhcCCCCCCEEeccCCcCcccCCccccCcccCEEEccCCcccCcCCCC--C-CCCcCEEEccCCCCcccCCcC
Q 044898          227 LSGPVDRLLSRLDQLNYLDLSLNQFNGNIPGRIFTFPITNLQLQRNAFAGPVQPP--D-QVTIPTVDLSHNMLSGQISPS  303 (396)
Q Consensus       227 l~~~~~~~l~~l~~L~~L~l~~n~l~~~~p~~~~~~~L~~L~l~~n~l~~~~~~~--~-~~~L~~L~ls~N~l~~~~~~~  303 (396)
                      +++.+|..+..+++|++|++++|.+++.+|.. ...+|++|++++|.+++.+|..  . +++|++|++++|.+++.+|..
T Consensus       235 l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~  313 (768)
T 3rgz_A          235 LSGDFSRAISTCTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPF  313 (768)
T ss_dssp             CCSCHHHHTTTCSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGG
T ss_pred             CCCcccHHHhcCCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchH
Confidence            88777888888888888888888887766665 3337888888888887766654  2 377888888888888777765


Q ss_pred             C---cccceEEeecccccccCchh-HHhcccCCcccEEEccCCcCCCCCCCCCCCCC-ccchhcccCccCCC
Q 044898          304 F---STVQNLYLNNNRFTGQVPGS-FVDHLLDASIQILYLQHNFLTGIEINPTAEIP-SSSSLCLQYNCMVP  370 (396)
Q Consensus       304 ~---~~L~~L~L~~N~l~~~~~~~-~~~~~~~~~L~~L~L~~N~l~~~~~~~~~~l~-~L~~L~l~~N~l~~  370 (396)
                      +   ++|+.|++++|.+++.+|.. +..+   ++|++|++++|++++..+..+..++ +|+.|++++|.+.+
T Consensus       314 ~~~l~~L~~L~L~~n~l~~~ip~~~l~~l---~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~  382 (768)
T 3rgz_A          314 FGSCSLLESLALSSNNFSGELPMDTLLKM---RGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSG  382 (768)
T ss_dssp             GGGCTTCCEEECCSSEEEEECCHHHHTTC---TTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEE
T ss_pred             HhcCCCccEEECCCCcccCcCCHHHHhcC---CCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCC
Confidence            4   46778888888888777765 6666   7888888888888755566666665 78888888887764



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 396
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-13
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 75.9 bits (185), Expect = 5e-16
 Identities = 73/344 (21%), Positives = 126/344 (36%), Gaps = 54/344 (15%)

Query: 26  DPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPCNFA--GVYCDAD----KVIALNLGDP 79
           +P D  AL  I+K L +       +SW  T+D CN    GV CD D    +V  L+L   
Sbjct: 4   NPQDKQALLQIKKDLGN---PTTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDL--- 57

Query: 80  RAGSPGLTGRLDPAIGKLTSLAELSIVPGRVIGKLPQSLSQLKNLRFFAISRN-FVSGEI 138
                 L                           +P SL+ L  L F  I     + G I
Sbjct: 58  --SGLNLPKPYP----------------------IPSSLANLPYLNFLYIGGINNLVGPI 93

Query: 139 PAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSNVILCHNKLSGSVPPFLSH--ALTR 196
           P A+ +L  L  L +++  ++GAIP  +  +  L  +   +N LSG++PP +S    L  
Sbjct: 94  PPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVG 153

Query: 197 LDLKHNDLSGSLAPDSLP--PSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQFNGN 254
           +    N +SG++             +++S NRL+G +    + L+               
Sbjct: 154 ITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDA 213

Query: 255 IPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTV-DLSHNMLSGQISPSFSTVQNL--- 310
                       + L +N+ A  +            DL +N + G +    + ++ L   
Sbjct: 214 SVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSL 273

Query: 311 YLNNNRFTGQVP--GSFVDHLLDASIQILYLQHN-FLTGIEINP 351
            ++ N   G++P  G+           +    +N  L G  +  
Sbjct: 274 NVSFNNLCGEIPQGGNL------QRFDVSAYANNKCLCGSPLPA 311


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query396
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.58
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.84
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.41
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.09
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=8.4e-41  Score=307.02  Aligned_cols=290  Identities=27%  Similarity=0.463  Sum_probs=232.5

Q ss_pred             CCChHHHHHHHHHHHhCCCCCCCCCCCCCCCCCCCC--CcceeEeCC----CCEEEEEcCCCCCCCCCCce--ecCcccc
Q 044898           24 ILDPVDFLALQAIRKSLDDLPGSNFFASWDFTSDPC--NFAGVYCDA----DKVIALNLGDPRAGSPGLTG--RLDPAIG   95 (396)
Q Consensus        24 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~W~~~~~~C--~w~gv~c~~----~~v~~L~L~~~~~~~~~l~~--~l~~~~~   95 (396)
                      -|.++|++||++||+++.++   ..+++|..++|||  .|.||+|+.    .||++|+|++     +++.|  .+|+.++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~---~~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~-----~~l~g~~~lp~~l~   73 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNP---TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG-----LNLPKPYPIPSSLA   73 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCC---GGGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEEC-----CCCSSCEECCGGGG
T ss_pred             CCCHHHHHHHHHHHHHCCCC---CcCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCC-----CCCCCCCCCChHHh
Confidence            37899999999999999874   2578998888999  499999986    3899999995     56665  6899999


Q ss_pred             CCCCCCEEEccC-CcCccccchhhcCCCCCcEEeccCCcCccccccccCCCCCCCEEEeecCcCCCCCCcccCCCcCCcE
Q 044898           96 KLTSLAELSIVP-GRVIGKLPQSLSQLKNLRFFAISRNFVSGEIPAALGQLRGLRTLDLSYNQLTGAIPQSIGTLPELSN  174 (396)
Q Consensus        96 ~l~~L~~L~l~~-n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~  174 (396)
                      ++++|++|+|++ |.++|.+|..|+++++|++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|..+.+++.|++
T Consensus        74 ~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~  153 (313)
T d1ogqa_          74 NLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVG  153 (313)
T ss_dssp             GCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             cCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccce
Confidence            999999999987 8999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEccCCcccccCCchhh---ccCCEEEccCCcCcccCCCCCCCCCCcEEEcccCCCCccchhhhcCCCCCCEEeccCCcC
Q 044898          175 VILCHNKLSGSVPPFLS---HALTRLDLKHNDLSGSLAPDSLPPSVQYLSLSWNRLSGPVDRLLSRLDQLNYLDLSLNQF  251 (396)
Q Consensus       175 L~l~~n~l~~~~p~~~~---~~L~~L~l~~n~l~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~l~~n~l  251 (396)
                      +++++|.+.+.+|..+.   ..++.+++++|++++..+..........+++..+...+.+|..+..+++++.+++++|.+
T Consensus       154 l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l  233 (313)
T d1ogqa_         154 ITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSL  233 (313)
T ss_dssp             EECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEE
T ss_pred             eecccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            99999999999998776   335777777777776665522224455677777777767777777777777777777776


Q ss_pred             cccCCccccCcccCEEEccCCcccCcCCCCCCCCcCEEEccCCCCcccCCcCC---cccceEEeecccccccCchhHHhc
Q 044898          252 NGNIPGRIFTFPITNLQLQRNAFAGPVQPPDQVTIPTVDLSHNMLSGQISPSF---STVQNLYLNNNRFTGQVPGSFVDH  328 (396)
Q Consensus       252 ~~~~p~~~~~~~L~~L~l~~n~l~~~~~~~~~~~L~~L~ls~N~l~~~~~~~~---~~L~~L~L~~N~l~~~~~~~~~~~  328 (396)
                      .+.+|. +.                     .+++|+.|++++|+++|.+|..+   ++|++|+|++|+|+|.+|+ +..+
T Consensus       234 ~~~~~~-~~---------------------~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L  290 (313)
T d1ogqa_         234 AFDLGK-VG---------------------LSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNL  290 (313)
T ss_dssp             CCBGGG-CC---------------------CCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTG
T ss_pred             cccccc-cc---------------------cccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccC
Confidence            654442 22                     34667777777777777777654   4577788888888877774 3445


Q ss_pred             ccCCcccEEEccCCc-CCCC
Q 044898          329 LLDASIQILYLQHNF-LTGI  347 (396)
Q Consensus       329 ~~~~~L~~L~L~~N~-l~~~  347 (396)
                         ++|+.+++++|+ +.+.
T Consensus       291 ---~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         291 ---QRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             ---GGSCGGGTCSSSEEEST
T ss_pred             ---CCCCHHHhCCCccccCC
Confidence               678888888886 4544



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure