Citrus Sinensis ID: 044933

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570
MPNLRILKFYSSMNEENKCKMSYFQGPGFTEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKLKRLPEISPGNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLPGLFPSSDESYLRTLYLSDNFKLDRNEIRGIVKGALQKIQLLATARLREAREKISYPSLRGRGFLPWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNFSRKFNFFYTSKIEKQFYVYCEYIVRPKDYHPHCSTSRMTLLGVGDCVVSDHLFFGYYFFDGEEFNDFRKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLFHAPDSRESFSCD
cccccEEEEEcccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEccccccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccEEccccccccccccEEEcccccccEEccccccccccccEEccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEcccccccccccccccccccEEccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEEEcccccccccccccccEEEEEEEEEEcccccccccccccEEEccccccccccEEEEEEEccccccccccccccEEEEEEEEEEEEcccccccccEEEEEEEEEEEEcccccccccc
ccccEEEEEEcccccccccEccccccccccccEEEEEcccccccccccccHHHHEEEccccccHHHccccccccccccEEEcccccccccccccHHHccccccEEEEcccccccccccccccccHccEEEccccccHccccHHHHHHHHEEEccccccccccHHHHHcccccEEEccccccHccccHHHHccccccEEEcccccHHHcccHHHHcHHHccEEEcccccccccccHHHHHHcccEEEcccccccccccccHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHHHHcccEEEccccccccccccccccccEEEccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHccccHHcccHHccccccccEEEcccccccHHHcccccccEEEEEcccccccccccEEEEEEEEEEccccccccccccccccEEEEEEEEEEcccccccccccEEccccccccccccEEEEEEcccccccccccccccccEEEEEEEEEEccccccccEEEEEcEEEEEEEcccccccccc
MPNLRILKFYSSMneenkckmsyfqgpgftevrylhwhgyplkllpsnihpeklvllemphsnieQLFDSVQDYGKLNQIITAAFNffskiptpsltqhLNNLVILNLsgcknlqslpARIHLKLLKeldlsgcsklkrlpeispgnittmhldgtaleelpSSIECLSklshlgladckslkslpsglcklksldVLIIDGCSNLQRLPEELGNLEALDILHAIGtsitevppsiVRLKRVRGiyfgrnkglslpitfsvdglqnlrdlnlndcgimelpeslgllssvttlhlegnnferipesIIQLSNLERLFIRYCERlqslpklpcnllsldahhctaleslpglfpssdesylrtlylsdnfkldrnEIRGIVKGALQKIQLLATARLREAREkisypslrgrgflpwnkipkwfsfqsagscvtlemppdffnnksvLGLAFSVIVNFSRKFNFFYTSKIEKQFYVYCEyivrpkdyhphcstsrmtllgvgdcvvsdhlffgyyffdgeefndfrkyncvpvAVRFnfreangfefldypvkkcgirlfhapdsresfscd
MPNLRILKFYSSMNEENKCKMSYFQGPGFTEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKlkrlpeispgniTTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIgtsitevppsivrLKRVRGIYFgrnkglslpitFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLPGLFPSSDESYLRTLYLSDNFKLDRNEIRGIVKGALQKIQLLATARLREArekisypslrgrgflpWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNFSRKFNFFYTSKIEKQFYVYCEYIVRPKDYHPHCSTSRMTLLGVGDCVVSDHLFFGYYFFDGEEFNDFRKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLfhapdsresfscd
MPNLRILKFYSSMNEENKCKMSYFQGPGFTEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKLKRLPEISPGNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLPGLFPSSDESYLRTLYLSDNFKLDRNEIRGIVKGALQKIQLLATARLREAREKISYPSLRGRGFLPWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNFSRKFNFFYTSKIEKQFYVYCEYIVRPKDYHPHCSTSRMTLLGVGDCVVSDHLffgyyffdgeefNDFRKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLFHAPDSRESFSCD
*****ILKFYSSMNEENKCKMSYFQGPGFTEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKLKRLPEISPGNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLPGLFPSSDESYLRTLYLSDNFKLDRNEIRGIVKGALQKIQLLATARLREAREKISYPSLRGRGFLPWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNFSRKFNFFYTSKIEKQFYVYCEYIVRPKDYHPHCSTSRMTLLGVGDCVVSDHLFFGYYFFDGEEFNDFRKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLFH***********
MPNLRILKFYSSMNEENKCKMSYFQGPGFTEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKLKRLPEISPGNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLPGLFPSSDESYLRTLYLSDNFKLDRNEIRGIVKGALQKIQLLATARLREAREKISYPSLRGRGFLPWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNFSRKFNFFYTSKIEKQFYVYCEYIVRPKDYHPHCSTSRMTLLGVGDCVVSDHLFFGYYFFDGEEFNDFRKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLFHAP*********
MPNLRILKFYSSMNEENKCKMSYFQGPGFTEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKLKRLPEISPGNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLPGLFPSSDESYLRTLYLSDNFKLDRNEIRGIVKGALQKIQLLATARLREAREKISYPSLRGRGFLPWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNFSRKFNFFYTSKIEKQFYVYCEYIVRPKDYHPHCSTSRMTLLGVGDCVVSDHLFFGYYFFDGEEFNDFRKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLFHAPDSRESFSCD
*PNLRILKFYSSMNEENKCKMSYFQGPGFTEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKLKRLPEISPGNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLPGLFPSSDESYLRTLYLSDNFKLDRNEIRGIVKGALQKIQLLATARLREAREKISYPSLRGRGFLPWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNFSRKFNFFYTSKIEKQFYVYCEYIVRPKDYHPHCSTSRMTLLGVGDCVVSDHLFFGYYFFDGEEFNDFRKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLFHAPD********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNLRILKFYSSMNEENKCKMSYFQGPGFTEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKLKRLPEISPGNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLPGLFPSSDESYLRTLYLSDNFKLDRNEIRGIVKGALQKIQLLATARLREAREKISYPSLRGRGFLPWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNFSRKFNFFYTSKIEKQFYVYCEYIVRPKDYHPHCSTSRMTLLGVGDCVVSDHLFFGYYFFDGEEFNDFRKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLFHAPDSRESFSCD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query570 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.692 0.345 0.309 1e-38
Q9SZ67 1895 Probable WRKY transcripti no no 0.429 0.129 0.352 2e-32
O825001095 Putative disease resistan no no 0.582 0.303 0.289 8e-27
O235301301 Protein SUPPRESSOR OF npr no no 0.524 0.229 0.286 3e-25
Q9FL92 1372 Probable WRKY transcripti no no 0.391 0.162 0.336 3e-23
Q9FH83 1288 Probable WRKY transcripti no no 0.768 0.340 0.259 2e-22
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.471 0.166 0.280 3e-19
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.433 0.241 0.315 1e-15
P0CB161201 Putative disease resistan no no 0.470 0.223 0.286 4e-15
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.454 0.139 0.307 4e-14
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 137/443 (30%), Positives = 224/443 (50%), Gaps = 48/443 (10%)

Query: 40   YPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIP----TPS 95
            YP +  PS    + LV L++ H+++  L+   +    L +I  +     ++ P     P+
Sbjct: 584  YPWESFPSTFELKMLVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPN 643

Query: 96   LTQHLN------------------NLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKL 137
            L +++N                   ++ L L+ CK+L+  P  ++++ L+ L L  C  L
Sbjct: 644  L-EYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPC-VNVESLEYLGLRSCDSL 701

Query: 138  KRLPEISPGNIT---TMHLDGTALEELPSSI-ECLSKLSHLGLADCKSLKSLPSGLCKLK 193
            ++LPEI  G +     +H+ G+ + ELPSSI +  + ++ L L + K+L +LPS +C+LK
Sbjct: 702  EKLPEIY-GRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLK 760

Query: 194  SLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYF-GRNKG 252
            SL  L + GCS L+ LPEE+G+L+ L +  A  T I   P SI+RL ++  + F G   G
Sbjct: 761  SLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDG 820

Query: 253  LSLPITFSVDGLQNLRDLNLNDCGIME--LPESLGLLSSVTTLHLEGNNFERIPESIIQL 310
            +        +GL +L  LNL+ C +++  LPE +G LSS+  L L  NNFE +P SI QL
Sbjct: 821  VHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQL 880

Query: 311  SNLERLFIRYCERLQSLPKLP--CNLLSLDAHHCTALESLPGLFPSSDESYLRTLYLSDN 368
              L+ L ++ C+RL  LP+LP   N L +D H   AL+ +  L     + +         
Sbjct: 881  GALQSLDLKDCQRLTQLPELPPELNELHVDCH--MALKFIHYLVTKRKKLH--------R 930

Query: 369  FKLDRNEIRGIVK-GALQKIQLLATARLR-EAREKISYPSLRGRGFLPWNKIPKWFSFQS 426
             KLD      +    A    Q +++ R    A + +S     G+ + P  KIP WF  Q 
Sbjct: 931  VKLDDAHNDTMYNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPY-P-EKIPSWFHHQG 988

Query: 427  AGSCVTLEMPPDFFNNKSVLGLA 449
              S V++ +P +++     LG A
Sbjct: 989  WDSSVSVNLPENWYIPDKFLGFA 1011
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query570
359493483 1274 PREDICTED: TMV resistance protein N-like 0.873 0.390 0.352 2e-72
359493487 1162 PREDICTED: TMV resistance protein N-like 0.740 0.363 0.391 1e-71
227438275 1226 disease resistance protein [Brassica rap 0.966 0.449 0.348 8e-69
297794743 1184 predicted protein [Arabidopsis lyrata su 0.908 0.437 0.341 1e-64
227438287 1207 disease resistance protein [Brassica rap 0.970 0.458 0.341 3e-64
297813715 1212 hypothetical protein ARALYDRAFT_327329 [ 0.954 0.448 0.330 5e-64
15234388 1219 TIR-NBS-LRR class disease resistance pro 0.884 0.413 0.346 5e-64
225460354 1174 PREDICTED: TMV resistance protein N-like 0.943 0.458 0.348 1e-63
359493485 824 PREDICTED: TMV resistance protein N-like 0.878 0.608 0.348 8e-63
359496026 1250 PREDICTED: TMV resistance protein N-like 0.905 0.412 0.327 4e-62
>gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
 Score =  280 bits (716), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 213/605 (35%), Positives = 301/605 (49%), Gaps = 107/605 (17%)

Query: 32   VRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKI 91
            +R L+WHGYPLK  PSN HPEKLV L M  S ++Q ++  + + KL  I  +     +KI
Sbjct: 611  LRDLYWHGYPLKSFPSNFHPEKLVELNMCFSRLKQPWEGKKGFEKLKSIKLSHSQHLTKI 670

Query: 92   P----TPSLTQ-----------------HLNNLVILNLSGCKNLQSLPARIHLKLLKELD 130
            P     P+L +                  L  L+ LNL GCK L+S  + IH++ L+ L 
Sbjct: 671  PDFSGVPNLRRLILKGCTSLVEVHPSIGALKKLIFLNLEGCKKLKSFSSSIHMESLQILT 730

Query: 131  LSGCSKLKRLPEISPGNIT---TMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPS 187
            LSGCSKLK+ PE+  GN+     + L+GTA++ LP SIE L+ L+ L L +CKSL+SLP 
Sbjct: 731  LSGCSKLKKFPEVQ-GNMEHLPNLSLEGTAIKGLPLSIENLTGLALLNLKECKSLESLPR 789

Query: 188  GLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVR---- 243
             + KLKSL  LI+ GCS L+ LP+ LG+L+ L  L+A G+ + EVPPSI  L  ++    
Sbjct: 790  SIFKLKSLKTLILSGCSELKDLPDNLGSLQCLTELNADGSGVQEVPPSITLLTNLQILSL 849

Query: 244  -GIYFGRNKGLSLPITF-----------SVDGLQNLRDLNLNDCGIME--LPESLGLLSS 289
             G   G +K  ++  +F           S  GL +LR L L  C + E  LP  LG + S
Sbjct: 850  AGCKGGESKSRNMIFSFHSSPTEELRLPSFSGLYSLRVLILQRCNLSEGALPSDLGSIPS 909

Query: 290  VTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLP 349
            +  L L  N+F  IP S+  LS L  L + YC+ LQSLP+LP ++ SL+AH CT+LE+  
Sbjct: 910  LERLDLSRNSFITIPASLSGLSRLRSLTLEYCKSLQSLPELPSSVESLNAHSCTSLET-- 967

Query: 350  GLFPSSDESYLRTLY------LSDNFKLDRNEIRGIVKGALQKIQLLATA-RLREAREKI 402
              F  S  +Y    +       ++ F+L  N+   IV   L+ IQL+++  +       I
Sbjct: 968  --FTCSSSAYTSKKFGDLRFNFTNCFRLGENQGSDIVGAILEGIQLMSSIPKFLVPDRGI 1025

Query: 403  SYPSLRGRGFLPWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNFSRKFNF 462
              P       +P N+IP+WF  QS G  V +E+P  ++N K ++GLAF   +NF      
Sbjct: 1026 PTPHNEYNALVPGNRIPEWFRHQSVGCSVNIELPQHWYNTK-LMGLAFCAALNFKGAM-- 1082

Query: 463  FYTSKIEKQFYVYCEYIVRPKDYHPHCSTSRMTLLG-VGDCVV----------------- 504
                                 D +P    S   L+  + DC V                 
Sbjct: 1083 ---------------------DGNPGTEPSSFGLVCYLNDCFVETGLHSLYTPPEGSKFI 1121

Query: 505  -SDHLFFGYYFFDGEEF---NDFRKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLFHA 560
             SDH  F Y      E    N FRK +   VA  F    ++G       VKKCGIRL + 
Sbjct: 1122 ESDHTLFEYISLARLEICLGNWFRKLSDNVVA-SFALTGSDG------EVKKCGIRLVYE 1174

Query: 561  PDSRE 565
             D ++
Sbjct: 1175 EDEKD 1179

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|227438275|gb|ACP30627.1| disease resistance protein [Brassica rapa subsp. pekinensis] Back     alignment and taxonomy information
>gi|297794743|ref|XP_002865256.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311091|gb|EFH41515.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|227438287|gb|ACP30633.1| disease resistance protein [Brassica rapa subsp. pekinensis] Back     alignment and taxonomy information
>gi|297813715|ref|XP_002874741.1| hypothetical protein ARALYDRAFT_327329 [Arabidopsis lyrata subsp. lyrata] gi|297320578|gb|EFH51000.1| hypothetical protein ARALYDRAFT_327329 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15234388|ref|NP_192938.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] gi|4586106|emb|CAB40942.1| putative disease resistance protein (TMV N-like) [Arabidopsis thaliana] gi|7267902|emb|CAB78244.1| putative disease resistance protein (TMV N-like) [Arabidopsis thaliana] gi|332657683|gb|AEE83083.1| TIR-NBS-LRR class disease resistance protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493485|ref|XP_003634611.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query570
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.687 0.321 0.373 1.4e-56
TAIR|locus:21229651210 AT4G19510 [Arabidopsis thalian 0.617 0.290 0.396 2.2e-50
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.966 0.436 0.290 1e-46
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.589 0.293 0.339 8.5e-41
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.615 0.295 0.334 8.3e-40
TAIR|locus:21222091179 AT4G36150 [Arabidopsis thalian 0.764 0.369 0.299 1.4e-37
TAIR|locus:20818101226 AT3G51570 [Arabidopsis thalian 0.585 0.272 0.341 9.2e-37
TAIR|locus:2827629 1355 AT2G17050 [Arabidopsis thalian 0.607 0.255 0.336 1.9e-35
TAIR|locus:28276391195 AT2G17060 [Arabidopsis thalian 0.771 0.368 0.289 1.2e-34
TAIR|locus:21532071165 AT5G45060 [Arabidopsis thalian 0.601 0.294 0.338 1.4e-33
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 583 (210.3 bits), Expect = 1.4e-56, Sum P(2) = 1.4e-56
 Identities = 152/407 (37%), Positives = 229/407 (56%)

Query:    57 LEMPHS-NIEQLFDSVQDYGKLNQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQ 115
             +++ HS N+ Q       +  L ++         K+P  S    L  L+ LNL  C +L+
Sbjct:   648 VDLSHSINLRQCLGLANAHN-LERLNLEGCTSLKKLP--STINCLEKLIYLNLRDCTSLR 704

Query:   116 SLPARIHLKLLKELDLSGCSKLKRLPEISPGNITTMHLDGTALEELPSSIECLSKLSHLG 175
             SLP  I  + L+ L LSGCS LK+ P IS  N+  + LDGT ++ LP SI+   +L+ L 
Sbjct:   705 SLPKGIKTQSLQTLILSGCSSLKKFPLISE-NVEVLLLDGTVIKSLPESIQTFRRLALLN 763

Query:   176 LADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPS 235
             L +CK LK L S L KLK L  LI+ GCS L+  PE   ++E+L+IL    TSITE+P  
Sbjct:   764 LKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLMDDTSITEMP-K 822

Query:   236 IVRLKRVRGIYF-GRNKGLSLPITFSVD--GLQNLRDLNLNDCGIMELPESLGLLSSVTT 292
             ++ L  ++     G +  +S+ + F     G   L DL L+ C + +LP+++G LSS+ +
Sbjct:   823 MMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPDNIGGLSSLQS 882

Query:   293 LHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSLDAHHCTALESLPG-L 351
             L L GNN E +PES  QL+NL+   +++C+ L+SLP LP NL  LDAH C +LE+L   L
Sbjct:   883 LCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETLANPL 942

Query:   352 FPSSDESYLRTLYLSDN-FKLDRNEIRGIVKGALQKIQLLATARL-REAREKISYPSLRG 409
              P +    + ++++  N +KL+++    +V  A  K QL+A A   R  R  +  P L G
Sbjct:   943 TPLTVGERIHSMFIFSNCYKLNQDAQASLVGHARIKSQLMANASAKRYYRGFVPEP-LVG 1001

Query:   410 RGFLPWNKIPKWFSFQSAGSCVTLEMPPDFFNNKSVLGLAFSVIVNF 456
               + P  +IP WF  Q  G  + + +PP + +   V GLA SV+V+F
Sbjct:  1002 ICY-PATEIPSWFCHQRLGRSLEIPLPPHWCDINFV-GLALSVVVSF 1046
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827639 AT2G17060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Al_scaffold_0008_340
annotation not avaliable (1184 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query570
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-37
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-17
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-08
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-06
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 9e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-05
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-04
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  147 bits (373), Expect = 3e-37
 Identities = 125/380 (32%), Positives = 178/380 (46%), Gaps = 86/380 (22%)

Query: 1   MPNLRILKFYSSMNEENKCKMSYFQGPGF----TEVRYLHWHGYPLKLLPSNIHPEKLVL 56
           M NL  LKFY+   ++ K ++ +    GF     ++R L W  YPL+ +PSN  PE LV 
Sbjct: 557 MRNLLFLKFYTKKWDQKK-EVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVK 615

Query: 57  LEMPHSNIEQLFDSVQDYGKLNQIITAAFNFFSKIPT---------------------PS 95
           L+M  S +E+L+D V     L  I         +IP                      PS
Sbjct: 616 LQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPS 675

Query: 96  LTQHLNNLVILNLSGCKNLQSLPARIHLKLLKELDLSGCSKLKRLPEISPGNITTMHLDG 155
             Q+LN L  L++S C+NL+ LP  I+LK L  L+LSGCS+LK  P+IS  NI+ + LD 
Sbjct: 676 SIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDIST-NISWLDLDE 734

Query: 156 TALEELPSSIE---------CLSK---------------------LSHLGLADCKSLKSL 185
           TA+EE PS++          C  K                     L+ L L+D  SL  L
Sbjct: 735 TAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVEL 794

Query: 186 PSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGI 245
           PS +  L  L+ L I+ C NL+ LP  + NLE+L+ L   G S         RL+     
Sbjct: 795 PSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCS---------RLR----- 839

Query: 246 YFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEG-NNFERIP 304
                       TF  D   N+ DLNL+  GI E+P  +   S+++ L + G NN +R+ 
Sbjct: 840 ------------TFP-DISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVS 886

Query: 305 ESIIQLSNLERLFIRYCERL 324
            +I +L +LE +    C  L
Sbjct: 887 LNISKLKHLETVDFSDCGAL 906

syringae 6; Provisional. Length = 1153
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 570
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
PLN032101153 Resistant to P. syringae 6; Provisional 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
KOG4237498 consensus Extracellular matrix protein slit, conta 99.77
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
KOG4237498 consensus Extracellular matrix protein slit, conta 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.51
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.94
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.94
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
PLN03150623 hypothetical protein; Provisional 98.62
KOG4341483 consensus F-box protein containing LRR [General fu 98.59
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.54
PLN03150623 hypothetical protein; Provisional 98.52
PRK15386426 type III secretion protein GogB; Provisional 98.5
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.48
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.46
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.44
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.43
KOG4341483 consensus F-box protein containing LRR [General fu 98.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.42
PRK15386426 type III secretion protein GogB; Provisional 98.33
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.23
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.07
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.01
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.8
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.76
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.76
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.63
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.54
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.44
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.33
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.28
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.23
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.95
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.51
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.35
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.92
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.57
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.03
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 94.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.26
KOG4308478 consensus LRR-containing protein [Function unknown 92.17
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.07
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.28
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.66
smart0037026 LRR Leucine-rich repeats, outliers. 89.66
KOG4308478 consensus LRR-containing protein [Function unknown 87.95
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.77
smart0037026 LRR Leucine-rich repeats, outliers. 84.77
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.17
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=3.1e-45  Score=426.19  Aligned_cols=507  Identities=25%  Similarity=0.370  Sum_probs=375.3

Q ss_pred             CCCceEEEEecCCc-ccccccccccCCCCC--CCccEEEecCCCCCCCCCCcCCCCcEEEECCCCChhhccccccCccCC
Q 044933            1 MPNLRILKFYSSMN-EENKCKMSYFQGPGF--TEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIEQLFDSVQDYGKL   77 (570)
Q Consensus         1 m~~Lr~L~l~~~~~-~~~~~~~~lp~~~~~--~~L~~L~l~~~~l~~lp~~~~~~~L~~L~L~~n~l~~l~~~~~~l~~L   77 (570)
                      |++|++|+++.+.+ ..++...++|+++.+  ++||+|+|++|+++.+|..|.+.+|++|+|++|+++.+|++++.+++|
T Consensus       557 m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~L  636 (1153)
T PLN03210        557 MRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGL  636 (1153)
T ss_pred             CccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCC
Confidence            78999999987543 223456789999988  789999999999999999999999999999999999999999999999


Q ss_pred             cEEccCcccCCCCCCCCcccccCCCCcEEEecCCCCCCcCCCcc-CCCCCCEEeeeCCCCCCCCCCCC-CCCccEEEecC
Q 044933           78 NQIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARI-HLKLLKELDLSGCSKLKRLPEIS-PGNITTMHLDG  155 (570)
Q Consensus        78 ~~L~Ls~~~~l~~~~~~~~~~~l~~L~~L~L~~~~~~~~~p~~~-~l~~L~~L~Ls~~~~~~~~p~~~-~~~L~~L~L~~  155 (570)
                      +.|+|++++.+..+|.  + ..+++|+.|+|++|..+..+|..+ .+++|+.|++++|..++.+|... ..+|+.|++++
T Consensus       637 k~L~Ls~~~~l~~ip~--l-s~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsg  713 (1153)
T PLN03210        637 RNIDLRGSKNLKEIPD--L-SMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSG  713 (1153)
T ss_pred             CEEECCCCCCcCcCCc--c-ccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCC
Confidence            9999999888888874  4 679999999999999999999988 89999999999999999998754 37999999998


Q ss_pred             cC-CCcCChhccCCCCCCEEeccCCCCCCcCCcccCCCCCCCEEEEcCCCCCC-------CcchhhcCCCcCceeccccc
Q 044933          156 TA-LEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQ-------RLPEELGNLEALDILHAIGT  227 (570)
Q Consensus       156 ~~-i~~lp~~~~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~L~L~~~~~~~-------~~p~~l~~l~~L~~L~l~~n  227 (570)
                      |. +..+|..   ..+|+.|++++|.+ ..+|..+ .+++|+.|.+.++....       ..+......++|+.|++++|
T Consensus       714 c~~L~~~p~~---~~nL~~L~L~~n~i-~~lP~~~-~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n  788 (1153)
T PLN03210        714 CSRLKSFPDI---STNISWLDLDETAI-EEFPSNL-RLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDI  788 (1153)
T ss_pred             CCCccccccc---cCCcCeeecCCCcc-ccccccc-cccccccccccccchhhccccccccchhhhhccccchheeCCCC
Confidence            74 3455542   46889999999874 5677655 57888888887754211       11122234578999999988


Q ss_pred             cC-ccCCchhccCCCCcEEEeccCCCCCCccccccccCCCCCeeecccCCCCC-cCcccCCCCCccEEEccCCcccccCc
Q 044933          228 SI-TEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIME-LPESLGLLSSVTTLHLEGNNFERIPE  305 (570)
Q Consensus       228 ~i-~~l~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~-ip~~l~~l~~L~~L~L~~n~l~~lp~  305 (570)
                      .. .++|.+++++++|+.|++++|..+. .+|..+ .+++|+.|++++|.... +|..   .++|+.|+|++|.++.+|.
T Consensus       789 ~~l~~lP~si~~L~~L~~L~Ls~C~~L~-~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~---~~nL~~L~Ls~n~i~~iP~  863 (1153)
T PLN03210        789 PSLVELPSSIQNLHKLEHLEIENCINLE-TLPTGI-NLESLESLDLSGCSRLRTFPDI---STNISDLNLSRTGIEEVPW  863 (1153)
T ss_pred             CCccccChhhhCCCCCCEEECCCCCCcC-eeCCCC-CccccCEEECCCCCcccccccc---ccccCEeECCCCCCccChH
Confidence            54 4899999999999999999987443 344433 68899999999986543 5543   4689999999999999999


Q ss_pred             cccCCCCcCEEcccCccccCcCCCCC---cccceecccccccCCcCCCCCCC-----------CCccccceeeccCCccc
Q 044933          306 SIIQLSNLERLFIRYCERLQSLPKLP---CNLLSLDAHHCTALESLPGLFPS-----------SDESYLRTLYLSDNFKL  371 (570)
Q Consensus       306 ~l~~l~~L~~L~Ls~~~~l~~lp~~~---~~L~~L~l~~c~~l~~~~~~~~~-----------~~~~~L~~L~l~~~~~L  371 (570)
                      ++..+++|+.|+|++|+.++.+|..+   .+|+.+++++|.++..++..-..           ..++....+...+|++|
T Consensus       864 si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L  943 (1153)
T PLN03210        864 WIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNL  943 (1153)
T ss_pred             HHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCC
Confidence            99999999999999999999888643   56777899999988765432100           01122233455577666


Q ss_pred             chhhhhhhhhHHHHHHHHHHHHHHHHhhhcCCCCCCCeeEeecCCCCCcceeecCCCcEEE-EEcCCCCCCCCceeeEEE
Q 044933          372 DRNEIRGIVKGALQKIQLLATARLREAREKISYPSLRGRGFLPWNKIPKWFSFQSAGSCVT-LEMPPDFFNNKSVLGLAF  450 (570)
Q Consensus       372 ~~~~i~~~~~~~l~~l~~L~~l~l~~n~~~~~~~~~~~~~~~pg~~ip~~f~~~~~~~~i~-~~lp~~~~~~~~~~g~~~  450 (570)
                      +.....          +         +      ......+++||.++|+||.||+.|++++ +++|+.|+ ...|.||++
T Consensus       944 ~~~a~l----------~---------~------~~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~-~~~~~~f~~  997 (1153)
T PLN03210        944 DQEALL----------Q---------Q------QSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISP-CQPFFRFRA  997 (1153)
T ss_pred             Cchhhh----------c---------c------cccceEEECCCccCchhccCCcccceeeeeccCCccc-CCCccceEE
Confidence            543320          0         0      0113357899999999999999999998 99999998 678999999


Q ss_pred             EEEEeccCccCccccceeeeEEEEEecccccCCCCCCCcceee---eeecCCCccCCCCeEEEEEeeccccccccc----
Q 044933          451 SVIVNFSRKFNFFYTSKIEKQFYVYCEYIVRPKDYHPHCSTSR---MTLLGVGDCVVSDHLFFGYYFFDGEEFNDF----  523 (570)
Q Consensus       451 ~~v~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~dh~~~~~~~~~~~~~~~~----  523 (570)
                      |+|+++....+......+.+.|+|++..+        ..+...   ..+.+ ..  ..+|++++.....   ...+    
T Consensus       998 c~v~~~~~~~~~~~~~~~~~~c~~~~~~~--------~~~~~~~~~~~~~~-~~--~~~~l~~~~~~~~---~~~~~~~~ 1063 (1153)
T PLN03210        998 CAVVDSESFFIISVSFDIQVCCRFIDRLG--------NHFDSPYQPHVFSV-TK--KGSHLVIFDCCFP---LNEDNAPL 1063 (1153)
T ss_pred             EEEEecCccccCCCceeEEEEEEEECCCC--------CccccCCCceeEee-ec--cccceEEeccccc---ccccccch
Confidence            99999887644322346678888888766        211100   00000 01  3455555432211   1110    


Q ss_pred             ccCCCCceEEEEEEEecCccccccccEEeeeeEEEecCCCC
Q 044933          524 RKYNCVPVAVRFNFREANGFEFLDYPVKKCGIRLFHAPDSR  564 (570)
Q Consensus       524 ~~~~~~~~~~~~~~~~~~~~~~~~~~v~~cg~~~~~~~~~~  564 (570)
                      .....+++.++|++.+.    ...++||+||||++|+.+..
T Consensus      1064 ~~~~~~~~~~~f~~~~~----~~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1064 AELNYDHVDIQFRLTNK----NSQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred             hccCCceeeEEEEEecC----CCCeEEEeeeEEEeccCCCc
Confidence            01123455688888742    23479999999999966544

syringae 6; Provisional
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query570
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-09
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 3e-04
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 4e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 94/207 (45%), Gaps = 18/207 (8%)
Query: 153 LDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEE 212
           +D   L ELP + +  + L  L LA    L++LP+ +  L  L  L I  C  L  LPE 
Sbjct: 111 IDAAGLXELPDTXQQFAGLETLTLAR-NPLRALPASIASLNRLRELSIRACPELTELPEP 169
Query: 213 LGNLEA---------LDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDG 263
           L + +A         L  L    T I  +P SI  L+ ++ +   RN  LS  +  ++  
Sbjct: 170 LASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKI-RNSPLSA-LGPAIHH 227
Query: 264 LQNLRDLNLNDC-GIMELPESLGLLSSVTTLHLEG-NNFERIPESIIQLSNLERLFIRYC 321
           L  L +L+L  C  +   P   G  + +  L L+  +N   +P  I +L+ LE+L +R C
Sbjct: 228 LPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGC 287
Query: 322 ERLQSLP----KLPCNLLSLDAHHCTA 344
             L  LP    +LP N + L   H  A
Sbjct: 288 VNLSRLPSLIAQLPANCIILVPPHLQA 314
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query570
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-53
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-37
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-29
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-28
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-19
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  182 bits (463), Expect = 8e-53
 Identities = 64/292 (21%), Positives = 100/292 (34%), Gaps = 28/292 (9%)

Query: 98  QHLNNLVILNLSGCKNLQSLPARIH-LKLLKELDLSGCSKLKRLPEISPGNITTMHLDGT 156
            H +    L   G   L+     +   +     D +      R    +  N       G 
Sbjct: 9   HHSSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSN--NPQIETRTGR 66

Query: 157 ALEELPSSIECLS--KLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELG 214
           AL+     +E  +      L L     L   P    +L  L  + ID    L  LP+ + 
Sbjct: 67  ALKATADLLEDATQPGRVALELRSVP-LPQFPDQAFRLSHLQHMTIDAAG-LMELPDTMQ 124

Query: 215 NLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGL-SLP-------ITFSVDGLQN 266
               L+ L      +  +P SI  L R+R +       L  LP        +    GL N
Sbjct: 125 QFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVN 184

Query: 267 LRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQS 326
           L+ L L   GI  LP S+  L ++ +L +  +    +  +I  L  LE L +R C  L++
Sbjct: 185 LQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRN 244

Query: 327 LPKLPCNLLSL---DAHHCTALESLPGLFPSSDE----SYLRTLYLSDNFKL 371
            P +      L       C+ L +LP       +    + L  L L     L
Sbjct: 245 YPPIFGGRAPLKRLILKDCSNLLTLP------LDIHRLTQLEKLDLRGCVNL 290
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query570
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.98
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.78
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.77
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.65
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.54
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.39
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.34
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.34
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.19
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.19
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.14
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.96
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.95
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.93
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.92
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.89
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.63
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.6
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.55
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.25
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.91
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.7
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.03
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.92
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.64
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.5e-41  Score=378.85  Aligned_cols=391  Identities=19%  Similarity=0.214  Sum_probs=264.9

Q ss_pred             CCccEEEecCCCCCCCCCCcCCCCcEEEECCCCChh-hccccccCc-cCCcEEccCcccCCCCCCCCcccccCCCCcEEE
Q 044933           30 TEVRYLHWHGYPLKLLPSNIHPEKLVLLEMPHSNIE-QLFDSVQDY-GKLNQIITAAFNFFSKIPTPSLTQHLNNLVILN  107 (570)
Q Consensus        30 ~~L~~L~l~~~~l~~lp~~~~~~~L~~L~L~~n~l~-~l~~~~~~l-~~L~~L~Ls~~~~l~~~~~~~~~~~l~~L~~L~  107 (570)
                      ++|++|++++|.+....+...+++|++|++++|+++ .+|..+... ++|++|++++|. +++..+..+ +.+++|++|+
T Consensus       247 ~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~-l~~~~p~~~-~~l~~L~~L~  324 (768)
T 3rgz_A          247 TELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNH-FYGAVPPFF-GSCSLLESLA  324 (768)
T ss_dssp             SSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSE-EEECCCGGG-GGCTTCCEEE
T ss_pred             CCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCc-CCCccchHH-hcCCCccEEE
Confidence            444444444444432222224455555555555555 455554443 666666666654 554444455 6666677777


Q ss_pred             ecCCCCCCcCCCc-c-CCCCCCEEeeeCCCCCCCCCCCCC---CCccEEEecCcCCC-cCChhccC--CCCCCEEeccCC
Q 044933          108 LSGCKNLQSLPAR-I-HLKLLKELDLSGCSKLKRLPEISP---GNITTMHLDGTALE-ELPSSIEC--LSKLSHLGLADC  179 (570)
Q Consensus       108 L~~~~~~~~~p~~-~-~l~~L~~L~Ls~~~~~~~~p~~~~---~~L~~L~L~~~~i~-~lp~~~~~--l~~L~~L~L~~~  179 (570)
                      |++|.+.+.+|.. + .+++|++|++++|.....+|....   .+|++|++++|.++ .+|..+..  +++|++|++++|
T Consensus       325 L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n  404 (768)
T 3rgz_A          325 LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNN  404 (768)
T ss_dssp             CCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSS
T ss_pred             CCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCC
Confidence            7666666566654 3 666677777776654445554332   26777777777766 35555554  677888888888


Q ss_pred             CCCCcCCcccCCCCCCCEEEEcCCCCCCCcchhhcCCCcCceeccccccCc-cCCchhccCCCCcEEEeccCCCCCCccc
Q 044933          180 KSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSIT-EVPPSIVRLKRVRGIYFGRNKGLSLPIT  258 (570)
Q Consensus       180 ~~~~~lp~~l~~l~~L~~L~L~~~~~~~~~p~~l~~l~~L~~L~l~~n~i~-~l~~~l~~l~~L~~L~l~~n~~~~~~~~  258 (570)
                      .+.+.+|..+.++++|++|++++|.+.+.+|..++.+++|+.|++++|.+. .+|..+..+++|+.|++++|. +.+..|
T Consensus       405 ~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~-l~~~~p  483 (768)
T 3rgz_A          405 GFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND-LTGEIP  483 (768)
T ss_dssp             EEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC-CCSCCC
T ss_pred             ccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCc-ccCcCC
Confidence            877788888888888888888888887788888888888888888888887 677788888888888888888 555667


Q ss_pred             cccccCCCCCeeecccCCCCC-cCcccCCCCCccEEEccCCccc-ccCccccCCCCcCEEcccCccccCcCCCCC-----
Q 044933          259 FSVDGLQNLRDLNLNDCGIME-LPESLGLLSSVTTLHLEGNNFE-RIPESIIQLSNLERLFIRYCERLQSLPKLP-----  331 (570)
Q Consensus       259 ~~~~~l~~L~~L~Ls~n~l~~-ip~~l~~l~~L~~L~L~~n~l~-~lp~~l~~l~~L~~L~Ls~~~~l~~lp~~~-----  331 (570)
                      ..+..+++|+.|++++|++++ +|.+++.+++|++|+|++|.++ .+|..+..+++|+.|++++|+..+.+|...     
T Consensus       484 ~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~  563 (768)
T 3rgz_A          484 SGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSG  563 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTT
T ss_pred             HHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccc
Confidence            778888888888888888885 7888888888888888888887 778888888888888888887766665321     


Q ss_pred             --------------------------------------------------------------------cccceecccccc
Q 044933          332 --------------------------------------------------------------------CNLLSLDAHHCT  343 (570)
Q Consensus       332 --------------------------------------------------------------------~~L~~L~l~~c~  343 (570)
                                                                                          ++|+.|++++|.
T Consensus       564 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~  643 (768)
T 3rgz_A          564 KIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNM  643 (768)
T ss_dssp             CBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSC
T ss_pred             hhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCc
Confidence                                                                                234555555554


Q ss_pred             cCCcCCCCCCCCCccccceeeccCCcccchhhhhhhhhHHHHHHHHHHHHHHHHhhhcCCCCCCCeeEeecCCCCCccee
Q 044933          344 ALESLPGLFPSSDESYLRTLYLSDNFKLDRNEIRGIVKGALQKIQLLATARLREAREKISYPSLRGRGFLPWNKIPKWFS  423 (570)
Q Consensus       344 ~l~~~~~~~~~~~~~~L~~L~l~~~~~L~~~~i~~~~~~~l~~l~~L~~l~l~~n~~~~~~~~~~~~~~~pg~~ip~~f~  423 (570)
                      ....+|..+  +.++.|+.|++++|      .+++.+|..+.+++.|+.||+++|+++|.+|....       .++..-.
T Consensus       644 l~g~ip~~l--~~l~~L~~L~Ls~N------~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~-------~l~~L~~  708 (768)
T 3rgz_A          644 LSGYIPKEI--GSMPYLFILNLGHN------DISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMS-------ALTMLTE  708 (768)
T ss_dssp             CBSCCCGGG--GGCTTCCEEECCSS------CCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGG-------GCCCCSE
T ss_pred             ccccCCHHH--hccccCCEEeCcCC------ccCCCCChHHhCCCCCCEEECCCCcccCcCChHHh-------CCCCCCE
Confidence            433444332  23455555555544      67777777777777777788777777765554322       4555556


Q ss_pred             ecCCCcEEEEEcCCC
Q 044933          424 FQSAGSCVTLEMPPD  438 (570)
Q Consensus       424 ~~~~~~~i~~~lp~~  438 (570)
                      ..-.+|.++..+|..
T Consensus       709 L~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          709 IDLSNNNLSGPIPEM  723 (768)
T ss_dssp             EECCSSEEEEECCSS
T ss_pred             EECcCCcccccCCCc
Confidence            666788888888864
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 570
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 57.0 bits (136), Expect = 2e-09
 Identities = 46/250 (18%), Positives = 91/250 (36%), Gaps = 10/250 (4%)

Query: 79  QIITAAFNFFSKIPTPSLTQHLNNLVILNLSGCKNLQSLPARI-HLKLLKELDLSGCSKL 137
            ++    N  ++I      ++L NL  L L   K  +  P     L  L+ L LS   +L
Sbjct: 34  ALLDLQNNKITEIKDGDF-KNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKN-QL 91

Query: 138 KRLPEISPGNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDV 197
           K LPE  P  +  + +    + ++  S+        +       LKS        + +  
Sbjct: 92  KELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKK 151

Query: 198 LIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPI 257
           L     ++        G   +L  LH  G  IT+V  + ++              +S   
Sbjct: 152 LSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVD 211

Query: 258 TFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPES-------IIQL 310
             S+    +LR+L+LN+  ++++P  L     +  ++L  NN   I  +         + 
Sbjct: 212 NGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKK 271

Query: 311 SNLERLFIRY 320
           ++   + +  
Sbjct: 272 ASYSGVSLFS 281
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query570
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.49
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.47
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.37
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.36
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.33
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.03
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.16
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.75
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.43
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.24
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.62
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.94  E-value=4.5e-25  Score=225.63  Aligned_cols=184  Identities=17%  Similarity=0.242  Sum_probs=100.8

Q ss_pred             CCccEEEecCcCCCcCChhccCCCCCCEEeccCCCCCCcCCcccCCCCCCCEEEEcCCCCCCCcchhhcCCCcCceeccc
Q 044933          146 GNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAI  225 (570)
Q Consensus       146 ~~L~~L~L~~~~i~~lp~~~~~l~~L~~L~L~~~~~~~~lp~~l~~l~~L~~L~L~~~~~~~~~p~~l~~l~~L~~L~l~  225 (570)
                      ++++.++++++.++.++. ....++|+.|++++|.+.. + ..+..+++|+.|++++|.+.+..  .++.+++|+.|+++
T Consensus       197 ~~~~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~l~~-~-~~l~~l~~L~~L~l~~n~l~~~~--~~~~~~~L~~L~l~  271 (384)
T d2omza2         197 TNLESLIATNNQISDITP-LGILTNLDELSLNGNQLKD-I-GTLASLTNLTDLDLANNQISNLA--PLSGLTKLTELKLG  271 (384)
T ss_dssp             TTCSEEECCSSCCCCCGG-GGGCTTCCEEECCSSCCCC-C-GGGGGCTTCSEEECCSSCCCCCG--GGTTCTTCSEEECC
T ss_pred             cccceeeccCCccCCCCc-ccccCCCCEEECCCCCCCC-c-chhhcccccchhccccCccCCCC--cccccccCCEeecc
Confidence            456666666666665543 3445566666666665432 2 23455666666666665543322  24555666666666


Q ss_pred             cccCccCCchhccCCCCcEEEeccCCCCCCccccccccCCCCCeeecccCCCCCcCcccCCCCCccEEEccCCcccccCc
Q 044933          226 GTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPE  305 (570)
Q Consensus       226 ~n~i~~l~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~ip~~l~~l~~L~~L~L~~n~l~~lp~  305 (570)
                      ++.+..+++ +..++.++.+.++.|.+..   ...+..+++++.|++++|++++++. +..+++|++|++++|+++.++ 
T Consensus       272 ~~~l~~~~~-~~~~~~l~~l~~~~n~l~~---~~~~~~~~~l~~L~ls~n~l~~l~~-l~~l~~L~~L~L~~n~l~~l~-  345 (384)
T d2omza2         272 ANQISNISP-LAGLTALTNLELNENQLED---ISPISNLKNLTYLTLYFNNISDISP-VSSLTKLQRLFFANNKVSDVS-  345 (384)
T ss_dssp             SSCCCCCGG-GTTCTTCSEEECCSSCCSC---CGGGGGCTTCSEEECCSSCCSCCGG-GGGCTTCCEEECCSSCCCCCG-
T ss_pred             CcccCCCCc-ccccccccccccccccccc---ccccchhcccCeEECCCCCCCCCcc-cccCCCCCEEECCCCCCCCCh-
Confidence            666655543 4555666666666655322   1224555666666666666665532 555666666666666666555 


Q ss_pred             cccCCCCcCEEcccCccccCcCCC--CCcccceecccc
Q 044933          306 SIIQLSNLERLFIRYCERLQSLPK--LPCNLLSLDAHH  341 (570)
Q Consensus       306 ~l~~l~~L~~L~Ls~~~~l~~lp~--~~~~L~~L~l~~  341 (570)
                      .+..+++|++|++++|+. +.++.  ..++|+.|++++
T Consensus       346 ~l~~l~~L~~L~l~~N~l-~~l~~l~~l~~L~~L~L~~  382 (384)
T d2omza2         346 SLANLTNINWLSAGHNQI-SDLTPLANLTRITQLGLND  382 (384)
T ss_dssp             GGGGCTTCCEEECCSSCC-CBCGGGTTCTTCSEEECCC
T ss_pred             hHcCCCCCCEEECCCCcC-CCChhhccCCCCCEeeCCC
Confidence            355666666666665542 33331  234555555554
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure