Citrus Sinensis ID: 044934


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MGVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVSTSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCLMK
cccEEEEEEEEEcccHHHHHHHHHcccccccccccccccccEEEEEcccccccEEEEEEEEEEEEEEEcccccEEEEEEEEcccccccEEEEEEEEEEEEEcccccccccEEEEc
ccEEEEEccccccccHHHHHHHHHHcHHccHHHHcHHHEEEEEEEEcccccccHHHEEEEHHHHHHHHcHHccEEEEEEEEccccHHHHEEEEEEEEEEccccccccccccEEEc
mgvlrfdkdgsvaaapsRMFKAFVIDshnlfpklLPQAFKSIVYEQGYGEVGSIEVVSTSMQSrvdaldrdnlyckytvfeEDCISDILELIVFQIKFgpyklkkissnasclmk
mgvlrfdkdgsvaaaPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVSTSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKfgpyklkkissnasclmk
MGVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVSTSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCLMK
*****************RMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVSTSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLKKI*********
*GVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVSTSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCLMK
********DGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVSTSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLKKIS********
*GVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVSTSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLK***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVSTSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCLMK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
O50001160 Major allergen Pru ar 1 O N/A no 0.852 0.612 0.371 4e-15
P43211159 Major allergen Mal d 1 OS N/A no 0.852 0.616 0.342 1e-12
O24248160 Major allergen Pru av 1 O N/A no 0.852 0.612 0.333 1e-12
O49065157 Root allergen protein OS= N/A no 0.852 0.624 0.383 1e-12
P17642155 Pathogenesis-related prot N/A no 0.930 0.690 0.352 2e-12
P43178160 Major pollen allergen Bet N/A no 0.843 0.606 0.355 2e-12
P15494160 Major pollen allergen Bet N/A no 0.843 0.606 0.365 2e-12
P43183160 Major pollen allergen Bet N/A no 0.843 0.606 0.355 2e-12
P17641155 Pathogenesis-related prot N/A no 0.930 0.690 0.352 3e-12
P43179160 Major pollen allergen Bet N/A no 0.843 0.606 0.355 5e-12
>sp|O50001|PRU1_PRUAR Major allergen Pru ar 1 OS=Prunus armeniaca PE=1 SV=1 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 7/105 (6%)

Query: 1   MGVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVS-- 58
           MGV  ++ + +    P ++FKAF++D+ NL PK+ P A K     +G G VG+I+ V+  
Sbjct: 1   MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAPTAVKGTEILEGDGGVGTIKKVTFG 60

Query: 59  -----TSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKF 98
                  ++ RVD +D+DNL   YT+ E D +SD++E I + IK 
Sbjct: 61  EGSQYAYVKHRVDGIDKDNLSYSYTLIEGDALSDVIENIAYDIKL 105





Prunus armeniaca (taxid: 36596)
>sp|P43211|MAL11_MALDO Major allergen Mal d 1 OS=Malus domestica GN=MALD1 PE=1 SV=2 Back     alignment and function description
>sp|O24248|PRU1_PRUAV Major allergen Pru av 1 OS=Prunus avium GN=PRUA1 PE=1 SV=1 Back     alignment and function description
>sp|O49065|RAP_TAROF Root allergen protein OS=Taraxacum officinale PE=1 SV=1 Back     alignment and function description
>sp|P17642|PRS2_SOLTU Pathogenesis-related protein STH-2 OS=Solanum tuberosum GN=STH-2 PE=2 SV=1 Back     alignment and function description
>sp|P43178|BEV1E_BETPN Major pollen allergen Bet v 1-E OS=Betula pendula GN=BETV1E PE=1 SV=2 Back     alignment and function description
>sp|P15494|BEV1A_BETPN Major pollen allergen Bet v 1-A OS=Betula pendula GN=BETVIA PE=1 SV=2 Back     alignment and function description
>sp|P43183|BEV1J_BETPN Major pollen allergen Bet v 1-J OS=Betula pendula GN=BETV1J PE=1 SV=2 Back     alignment and function description
>sp|P17641|PRS1_SOLTU Pathogenesis-related protein STH-21 OS=Solanum tuberosum GN=STH-21 PE=2 SV=1 Back     alignment and function description
>sp|P43179|BEV1F_BETPN Major pollen allergen Bet v 1-F/I OS=Betula pendula GN=BETV1F PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
351726706160 uncharacterized protein LOC100500506 [Gl 0.947 0.681 0.450 7e-21
351727078160 uncharacterized protein LOC100527307 [Gl 0.947 0.681 0.442 9e-20
388501186160 unknown [Lotus japonicus] 0.947 0.681 0.442 1e-19
225431834161 PREDICTED: major allergen Pru ar 1 [Viti 1.0 0.714 0.422 2e-19
351722332160 uncharacterized protein LOC100306656 [Gl 0.947 0.681 0.434 5e-19
357478849160 Pathogenesis-related protein [Medicago t 0.947 0.681 0.418 6e-18
388514607160 unknown [Lotus japonicus] 0.852 0.612 0.447 7e-18
388509642160 unknown [Medicago truncatula] 0.947 0.681 0.418 7e-18
288557890154 pathogenesis-related protein 10.9 [Vitis 0.913 0.681 0.424 3e-17
224130342160 predicted protein [Populus trichocarpa] 0.921 0.662 0.394 8e-17
>gi|351726706|ref|NP_001235344.1| uncharacterized protein LOC100500506 [Glycine max] gi|255630496|gb|ACU15606.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 76/122 (62%), Gaps = 13/122 (10%)

Query: 1   MGVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVSTS 60
           MGV  F ++ S + APSRMFKA ++DS NL PKLLPQ  K +   QG GE GSIE V+ +
Sbjct: 1   MGVTTFTQEYSSSVAPSRMFKALIVDSRNLLPKLLPQFVKDVNVTQGDGEAGSIEQVNFN 60

Query: 61  -------MQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCL 113
                  ++ R+D LD+DNL CKYT+ E D + D L+ I +++KF      + +S+  CL
Sbjct: 61  EASPFKYLKHRIDVLDKDNLVCKYTMIEGDPLGDKLDSIGYEVKF------EATSDGGCL 114

Query: 114 MK 115
            K
Sbjct: 115 CK 116




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|351727078|ref|NP_001237916.1| uncharacterized protein LOC100527307 [Glycine max] gi|255632051|gb|ACU16378.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388501186|gb|AFK38659.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225431834|ref|XP_002271360.1| PREDICTED: major allergen Pru ar 1 [Vitis vinifera] gi|147853969|emb|CAN79555.1| hypothetical protein VITISV_025729 [Vitis vinifera] gi|296083306|emb|CBI22942.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351722332|ref|NP_001238264.1| uncharacterized protein LOC100306656 [Glycine max] gi|255629199|gb|ACU14944.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357478849|ref|XP_003609710.1| Pathogenesis-related protein [Medicago truncatula] gi|355510765|gb|AES91907.1| Pathogenesis-related protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388514607|gb|AFK45365.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388509642|gb|AFK42887.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|288557890|emb|CBJ49381.1| pathogenesis-related protein 10.9 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130342|ref|XP_002328585.1| predicted protein [Populus trichocarpa] gi|222838567|gb|EEE76932.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
PR10.9
SubName- Full=Putative uncharacterized protein (Chromosome chr5 scaffold_64, whole genome shotgun sequence); (161 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00033091001
SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (357 aa)
       0.483
GSVIVG00033064001
SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (288 aa)
       0.483

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
cd07816148 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domai 4e-21
pfam00407150 pfam00407, Bet_v_1, Pathogenesis-related protein B 1e-07
>gnl|CDD|176858 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins Back     alignment and domain information
 Score = 81.5 bits (202), Expect = 4e-21
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 8/94 (8%)

Query: 12  VAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVS-------TSMQSR 64
           +     +++KAFV+DSH L PKL P   KS+   +G G  GSI++++         ++ R
Sbjct: 9   LKVPAEKLWKAFVLDSHLLPPKLPPV-IKSVELLEGDGGPGSIKLITFGPGGKVKYVKER 67

Query: 65  VDALDRDNLYCKYTVFEEDCISDILELIVFQIKF 98
           +DA+D +N   KYTV E D + D  +    +IKF
Sbjct: 68  IDAVDEENKTYKYTVIEGDVLKDGYKSYKVEIKF 101


This family includes the ligand binding domain of Bet v 1 (the major pollen allergen of white birch, Betula verrucosa) and related proteins. In addition to birch Bet v 1, this family includes other plant intracellular pathogenesis-related class 10 (PR-10) proteins, norcoclaurine synthases (NCSs), cytokinin binding proteins (CSBPs), major latex proteins (MLPs), and ripening-related proteins. It belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Members of this family binds a diverse range of ligands. Bet v 1 can bind brassinosteroids, cytokinins, flavonoids and fatty acids. Hyp-1, a PR-10 from Hypericum perforatum/St. John's wort, catalyzes the condensation of two molecules of emodin to the bioactive naphthodianthrone hypericin. NCSs catalyze the condensation of dopamine and 4-hydroxyphenylacetaldehyde to (S)-norcoclaurine, the first committed step in the biosynthesis of benzylisoquinoline alkaloids such as morphine. The role of MLPs is unclear; however, they are associated with fruit and flower development and in pathogen defense responses. A number of PR-10 proteins in this subgroup, including Bet v 1, have in vitro RNase activity, the biological significance of which is unclear. Bet v 1 family proteins have a conserved glycine-rich P (phosphate-binding)-loop proximal to the entrance of the ligand-binding pocket. However, its conformation differs from that of the canonical P-loop structure found in nucleotide-binding proteins. Several PR-10 members including Bet v1 are allergenic. Cross-reactivity of Bet v 1 with homologs from plant foods results in birch-fruit syndrome. Length = 148

>gnl|CDD|215904 pfam00407, Bet_v_1, Pathogenesis-related protein Bet v I family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
PF00407151 Bet_v_1: Pathogenesis-related protein Bet v I fami 100.0
cd07816148 Bet_v1-like Ligand-binding bet_v_1 domain of major 99.95
cd07821140 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), 99.48
PF10604139 Polyketide_cyc2: Polyketide cyclase / dehydrase an 99.26
cd08866144 SRPBCC_11 Ligand-binding SRPBCC domain of an uncha 99.19
cd07819140 SRPBCC_2 Ligand-binding SRPBCC domain of an unchar 99.0
cd08861142 OtcD1_ARO-CYC_like N-terminal and C-terminal aroma 98.96
cd08865140 SRPBCC_10 Ligand-binding SRPBCC domain of an uncha 98.94
cd07813138 COQ10p_like Coenzyme Q-binding protein COQ10p and 98.9
cd08862138 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of 98.89
cd07822141 SRPBCC_4 Ligand-binding SRPBCC domain of an unchar 98.74
cd07812141 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR 98.68
cd07820137 SRPBCC_3 Ligand-binding SRPBCC domain of an unchar 98.65
cd07818150 SRPBCC_1 Ligand-binding SRPBCC domain of an unchar 98.65
cd07824146 SRPBCC_6 Ligand-binding SRPBCC domain of an unchar 98.6
cd07814139 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand- 98.53
cd07825144 SRPBCC_7 Ligand-binding SRPBCC domain of an unchar 98.49
cd07817139 SRPBCC_8 Ligand-binding SRPBCC domain of an unchar 98.46
cd05018144 CoxG Carbon monoxide dehydrogenase subunit G (CoxG 98.42
cd08860146 TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom 98.41
PF03364130 Polyketide_cyc: Polyketide cyclase / dehydrase and 98.35
cd07823146 SRPBCC_5 Ligand-binding SRPBCC domain of an unchar 98.28
PRK10724158 hypothetical protein; Provisional 98.2
cd08898145 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligan 97.82
cd08899157 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligan 97.8
cd08893136 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobi 97.73
COG3427146 Carbon monoxide dehydrogenase subunit G, CoxG [Ene 97.67
cd07826142 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligan 97.5
cd08900143 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligan 97.46
cd08896146 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligan 97.44
cd08897133 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligan 97.35
COG5637217 Predicted integral membrane protein [Function unkn 97.21
PF06240140 COXG: Carbon monoxide dehydrogenase subunit G (Cox 97.16
cd08891149 SRPBCC_CalC Ligand-binding SRPBCC domain of Microm 97.16
cd08892126 SRPBCC_Aha1 Putative hydrophobic ligand-binding SR 97.13
cd08894139 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligan 97.1
cd08895146 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligan 97.07
cd08901136 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligan 96.89
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 96.88
PTZ00220132 Activator of HSP-90 ATPase; Provisional 96.52
PF08327124 AHSA1: Activator of Hsp90 ATPase homolog 1-like pr 96.17
COG2867146 Oligoketide cyclase/lipid transport protein [Lipid 95.8
COG3832149 Uncharacterized conserved protein [Function unknow 95.22
PF08982149 DUF1857: Domain of unknown function (DUF1857); Int 94.32
cd08863141 SRPBCC_DUF1857 DUF1857, an uncharacterized ligand- 93.16
cd08873235 START_STARD14_15-like Lipid-binding START domain o 91.49
cd08874205 START_STARD9-like C-terminal START domain of mamma 90.69
cd08914236 START_STARD15-like Lipid-binding START domain of m 82.64
cd08906209 START_STARD3-like Cholesterol-binding START domain 81.85
>PF00407 Bet_v_1: Pathogenesis-related protein Bet v I family; InterPro: IPR000916 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms Back     alignment and domain information
Probab=100.00  E-value=9.1e-36  Score=213.92  Aligned_cols=107  Identities=31%  Similarity=0.512  Sum_probs=99.7

Q ss_pred             CccEEEEEEEEeccCHHHHHHHHhcccccccccccccceeeEEEEecCCccc-cEEEEc-------eeeeEEEeeecCCc
Q 044934            1 MGVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVG-SIEVVS-------TSMQSRVDALDRDN   72 (115)
Q Consensus         1 m~~~~~~~ei~i~a~a~k~w~~~~~d~~~l~pk~~P~~v~sve~~eGdg~~G-sir~~t-------~~~kEri~~vDe~~   72 (115)
                      |++++++.|+++++||+|+|++| ++.++++||++|+.|+|+|++||||++| |||.|+       .++|||++.+|++|
T Consensus         1 m~~~~~~~E~~~~~~a~k~~ka~-~~~~~llpki~P~~i~sve~~eGdgg~gGSIk~~~f~~~~~~~~~Kekve~~D~~~   79 (151)
T PF00407_consen    1 MGVGKLEVEVEVKVSADKLWKAF-KSSPHLLPKILPHVIKSVEVVEGDGGPGGSIKKWTFGPGGPFKYVKEKVEAIDEEN   79 (151)
T ss_dssp             SCEEEEEEEEEESS-HHHHHHHH-TTHHHHHHHHSTTTEEEEEEEESSSSTTT-EEEEEEETTSSEEEEEEEEEEEETTT
T ss_pred             CCcEEEEEEEEecCCHHHHHHHH-hcCccchhhhChhhceeEEEEccCCCCCCeEEEEEecCCCCcceeEEEEEeecCCC
Confidence            99999999999999999999997 5588999999999999999999999887 999999       68999999999999


Q ss_pred             cEEEEEEEecCccCcceEEEEEEEEEEecccccccCCCceeeC
Q 044934           73 LYCKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCLMK  115 (115)
Q Consensus        73 ~~~~y~vieG~~l~~~~~s~~~~i~v~p~~~~~~~~~gg~~vk  115 (115)
                      ++++|++||||++ ..|++|+.++++.|+      ++|||++|
T Consensus        80 ~~~~y~viEGd~l-~~~~~~~~~~~~~~~------~~g~~v~k  115 (151)
T PF00407_consen   80 KTITYTVIEGDVL-GDYKSFKSTIQKIPK------GDGGCVVK  115 (151)
T ss_dssp             TEEEEEEEEETTG-TTTEEEEEEEEEEEE------TTSCEEEE
T ss_pred             cEEEEEEEecccc-ccEEEEEEEEEecCC------CCCceEEE
Confidence            9999999999988 689999999999999      89999986



A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation. The allergens in this family include allergens with the following designations: Aln g 1, Api g 1, Bet v 1, Car b 1, Cor a 1, Dau c 1, Mal d 1 and Pru a 1. Trees within the order Fagales possess particularly potent allergens, e.g. Bet v1, the major White Birch (Betula verrucosa) pollen antigen. Bet v1 is the main cause of type I allergies observed in early spring. Type I, or immunoglobulin E-mediated (IgE-mediated) allergies affect 1 in 5 people in Europe and North America. Commonly-observed symptoms are hay fever, dermatitis, asthma and, in severe cases, anaphylactic shock. First contact with these allergens results in sensitisation; subsequent contact produces a cross-linking reaction of IgE on mast cells and concomitant release of histamine. The inevitable symptoms of an allergic reaction ensue. Recent NMR analysis [] has confirmed earlier predictions of the protein structure and site of the major T-cell epitope []. The Bet v1 protein comprises 6 anti-parallel beta-strands and 3 alpha-helices. Four of the strands dominate the global fold, and 2 of the helices form a C-terminal amphipathic helical motif. This motif is believed to be the T-cell epitope. Other proteins belonging to this family include the major pollen allergens: Aln g I from Alnus glutinosa (Alder); Api G I from Apium graveolens (Celery); Car b I from Carpinus betulus (European hornbeam); Cor a I from Corylus avellana (European hazel); Mal d I from Malus domestica (Apple). The motif is also found in: the wound-induced protein AoPR1 from Asparagus officinalis (Garden asparagus); pathogenesis-related proteins from Phaseolus vulgaris (Kidney bean) and Petroselinum crispum (Parsley) (PR1-1 and PR1-3); the disease resistance response proteins, STH-2 and STH-21, from Solanum tuberosum (Potato) and pI49, pI176 and DRRG49-C from Pisum sativum (Garden pea); the P. sativum abscisic acid-responsive proteins ABR17 and ABR18; and the stress-induced protein SAM22 from Glycine max (Soybean). ; GO: 0006952 defense response, 0009607 response to biotic stimulus; PDB: 1IFV_A 4A8V_A 4A8U_A 2K7H_A 2QIM_A 3E85_A 1H2O_A 1E09_A 1QMR_A 1FSK_D ....

>cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins Back     alignment and domain information
>cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information
>PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis Back     alignment and domain information
>cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains Back     alignment and domain information
>cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins Back     alignment and domain information
>cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu Back     alignment and domain information
>cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily Back     alignment and domain information
>cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins Back     alignment and domain information
>cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) Back     alignment and domain information
>cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains Back     alignment and domain information
>PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp Back     alignment and domain information
>cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>PRK10724 hypothetical protein; Provisional Back     alignment and domain information
>cd08898 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08899 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08893 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins; some contain an N-terminal GntR family winged HTH DNA-binding domain Back     alignment and domain information
>COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] Back     alignment and domain information
>cd07826 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08900 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08896 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08897 SRPBCC_CalC_Aha1-like_4 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>COG5637 Predicted integral membrane protein [Function unknown] Back     alignment and domain information
>PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster Back     alignment and domain information
>cd08891 SRPBCC_CalC Ligand-binding SRPBCC domain of Micromonospora echinospora CalC and related proteins Back     alignment and domain information
>cd08892 SRPBCC_Aha1 Putative hydrophobic ligand-binding SRPBCC domain of the Hsp90 co-chaperone Aha1 and related proteins Back     alignment and domain information
>cd08894 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08895 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08901 SRPBCC_CalC_Aha1-like_8 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>PTZ00220 Activator of HSP-90 ATPase; Provisional Back     alignment and domain information
>PF08327 AHSA1: Activator of Hsp90 ATPase homolog 1-like protein; InterPro: IPR013538 This family includes eukaryotic, prokaryotic and archaeal proteins that bear similarity to a C-terminal region of human activator of 90 kDa heat shock protein ATPase homologue 1 (AHSA1/p38, O95433 from SWISSPROT) Back     alignment and domain information
>COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] Back     alignment and domain information
>COG3832 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08982 DUF1857: Domain of unknown function (DUF1857); InterPro: IPR015075 This protein has no known function Back     alignment and domain information
>cd08863 SRPBCC_DUF1857 DUF1857, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily Back     alignment and domain information
>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
3ie5_A165 Crystal Structure Of Hyp-1 Protein From Hypericum P 5e-13
1e09_A159 Solution Structure Of The Major Cherry Allergen Pru 5e-13
1fsk_A159 Complex Formation Between A Fab Fragment Of A Monoc 8e-13
4a80_A159 Crystal Structure Of Major Birch Pollen Allergen Be 8e-13
1b6f_A159 Birch Pollen Allergen Bet V 1 Length = 159 8e-13
4a8u_A159 Crystal Structure Of Native Birch Pollen Allergen B 9e-13
1h2o_A159 Solution Structure Of The Major Cherry Allergen Pru 1e-12
1llt_A159 Birch Pollen Allergen Bet V 1 Mutant E45s Length = 2e-12
4a84_A159 Crystal Structure Of Major Birch Pollen Allergen Be 6e-12
1qmr_A159 Birch Pollen Allergen Bet V 1 Mutant N28t, K32q, E4 2e-11
1fm4_A159 Crystal Structure Of The Birch Pollen Allergen Bet 3e-11
2lpx_A170 Solution Structure Of Strawberry Allergen Fra A 1e 4e-09
2k7h_A157 Nmr Solution Structure Of Soybean Allergen Gly M 4 6e-07
1xdf_A157 Crystal Structure Of Pathogenesis-Related Protein L 9e-07
3rws_A168 Crystal Structure Of Medicago Truncatula Nodulin 13 1e-06
1icx_A155 Crystal Structure Of Pathogenesis-Related Protein L 1e-06
2bk0_A154 Crystal Structure Of The Major Celery Allergen Api 2e-06
1ifv_A155 Crystal Structure Of Pathogenesis-Related Protein L 4e-06
2qim_A158 Crystal Structure Of Pathogenesis-Related Protein L 6e-06
1tw0_A157 Native Crystal Structure Of Spe16 Length = 157 3e-05
2wql_A154 Crystal Structure Of The Major Carrot Allergen Dau 6e-04
>pdb|3IE5|A Chain A, Crystal Structure Of Hyp-1 Protein From Hypericum Perforatum (St John's Wort) Involved In Hypericin Biosynthesis Length = 165 Back     alignment and structure

Iteration: 1

Score = 69.3 bits (168), Expect = 5e-13, Method: Compositional matrix adjust. Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 7/91 (7%) Query: 15 APSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVS-------TSMQSRVDA 67 AP R+FKA V++ H + K P FKS +G G VG++ ++ T M + D Sbjct: 21 APHRLFKALVLERHQVLVKAQPHVFKSGEIIEGDGGVGTVTKITFVDGHPLTYMLHKFDE 80 Query: 68 LDRDNLYCKYTVFEEDCISDILELIVFQIKF 98 +D N YCKYT+FE D + D +E +V+++K Sbjct: 81 IDAANFYCKYTLFEGDVLRDNIEKVVYEVKL 111
>pdb|1E09|A Chain A, Solution Structure Of The Major Cherry Allergen Pru Av 1 Length = 159 Back     alignment and structure
>pdb|1FSK|A Chain A, Complex Formation Between A Fab Fragment Of A Monoclonal Igg Antibody And The Major Allergen From Birch Pollen Bet V 1 Length = 159 Back     alignment and structure
>pdb|4A80|A Chain A, Crystal Structure Of Major Birch Pollen Allergen Bet V 1 A In Complex With 8-Anilinonaphthalene-1-Sulfonate (Ans) Length = 159 Back     alignment and structure
>pdb|1B6F|A Chain A, Birch Pollen Allergen Bet V 1 Length = 159 Back     alignment and structure
>pdb|4A8U|A Chain A, Crystal Structure Of Native Birch Pollen Allergen Bet V 1 Isoform J Length = 159 Back     alignment and structure
>pdb|1H2O|A Chain A, Solution Structure Of The Major Cherry Allergen Pru Av 1 Mutant E45w Length = 159 Back     alignment and structure
>pdb|1LLT|A Chain A, Birch Pollen Allergen Bet V 1 Mutant E45s Length = 159 Back     alignment and structure
>pdb|4A84|A Chain A, Crystal Structure Of Major Birch Pollen Allergen Bet V 1 A F30v Mutant In Complex With Deoxycholate Length = 159 Back     alignment and structure
>pdb|1QMR|A Chain A, Birch Pollen Allergen Bet V 1 Mutant N28t, K32q, E45s, P108g Length = 159 Back     alignment and structure
>pdb|1FM4|A Chain A, Crystal Structure Of The Birch Pollen Allergen Bet V 1l Length = 159 Back     alignment and structure
>pdb|2LPX|A Chain A, Solution Structure Of Strawberry Allergen Fra A 1e Length = 170 Back     alignment and structure
>pdb|2K7H|A Chain A, Nmr Solution Structure Of Soybean Allergen Gly M 4 Length = 157 Back     alignment and structure
>pdb|1XDF|A Chain A, Crystal Structure Of Pathogenesis-Related Protein Llpr-10.2a From Yellow Lupine Length = 157 Back     alignment and structure
>pdb|1ICX|A Chain A, Crystal Structure Of Pathogenesis-Related Protein Llpr10.1a From Yellow Lupine Length = 155 Back     alignment and structure
>pdb|2BK0|A Chain A, Crystal Structure Of The Major Celery Allergen Api G 1 Length = 154 Back     alignment and structure
>pdb|1IFV|A Chain A, Crystal Structure Of Pathogenesis-Related Protein Llpr10.1b From Yellow Lupine Length = 155 Back     alignment and structure
>pdb|2QIM|A Chain A, Crystal Structure Of Pathogenesis-Related Protein Llpr-10.2b From Yellow Lupine In Complex With Cytokinin Length = 158 Back     alignment and structure
>pdb|1TW0|A Chain A, Native Crystal Structure Of Spe16 Length = 157 Back     alignment and structure
>pdb|2WQL|A Chain A, Crystal Structure Of The Major Carrot Allergen Dau C 1 Length = 154 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
4a8u_A159 Major pollen allergen BET V 1-J; PR-10 protein; 1. 1e-24
2vjg_A154 Major allergen DAU C 1; major carrot allergen, pat 3e-24
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seve 6e-23
3ie5_A165 Phenolic oxidative coupling protein HYP-1; hyperic 8e-23
2flh_A155 Cytokinin-specific binding protein; zeatin, pathog 3e-22
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathoge 6e-22
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 5e-21
3rws_A168 MTN13 protein; zeatin, cytokinin, hormone, lucerne 6e-21
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 4e-20
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine 3e-17
2i9y_A166 Major latex protein-like protein 28 or MLP-like pr 4e-14
3qrz_A223 Abscisic acid receptor PYL5; crystal, hormone rece 1e-04
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; 2e-04
>4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Length = 159 Back     alignment and structure
 Score = 90.4 bits (224), Expect = 1e-24
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 13/121 (10%)

Query: 2   GVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVS--- 58
           GV  ++ + +     +R+FKAF++D  NLFPK+ PQA  S+   +G G  G+I+ +S   
Sbjct: 1   GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE 60

Query: 59  ----TSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCLM 114
                 ++ RVD +D  N    Y+V E   + D LE I  +IK         + N   ++
Sbjct: 61  GFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVA------TPNGGSIL 114

Query: 115 K 115
           K
Sbjct: 115 K 115


>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Length = 157 Back     alignment and structure
>3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} Length = 165 Back     alignment and structure
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Length = 155 Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Length = 159 Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Length = 158 Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Length = 155 Back     alignment and structure
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Length = 201 Back     alignment and structure
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
2wql_A154 Major allergen DAU C 1; pathogenesis-related prote 100.0
2vjg_A154 Major allergen DAU C 1; major carrot allergen, pat 100.0
3ie5_A165 Phenolic oxidative coupling protein HYP-1; hyperic 100.0
3rws_A168 MTN13 protein; zeatin, cytokinin, hormone, lucerne 100.0
4a8u_A159 Major pollen allergen BET V 1-J; PR-10 protein; 1. 100.0
2flh_A155 Cytokinin-specific binding protein; zeatin, pathog 100.0
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 100.0
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathoge 100.0
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seve 100.0
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine 100.0
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 100.0
2i9y_A166 Major latex protein-like protein 28 or MLP-like pr 99.97
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; 99.93
3oqu_A205 Abscisic acid receptor PYL9; RCAR1, hormone recept 99.92
3p51_A160 Uncharacterized protein; structural genomics, PSI- 99.92
3rt2_A183 Abscisic acid receptor PYL10; ABA-independent PP2C 99.91
3jrs_A208 PYL1, putative uncharacterized protein AT5G46790; 99.9
3f08_A146 Uncharacterized protein Q6HG14; NESG Q6HG14_bachk 99.9
3oji_A189 Abscisic acid receptor PYL3; crystal, PP2C, pyraba 99.88
3k3k_A211 Abscisic acid receptor PYR1; ABA receptor, plant h 99.88
3qrz_A223 Abscisic acid receptor PYL5; crystal, hormone rece 99.86
2le1_A151 Uncharacterized protein; structural genomics, nort 99.85
1vjh_A122 BET V I allergen family; structural genomics, cent 99.82
3tfz_A172 Cyclase; helix-GRIP, BET V1-like superfamily, bios 99.26
3tl1_A159 WHIE ORF VI, polyketide cyclase; helix-GRIP fold, 99.2
2d4r_A147 Hypothetical protein TTHA0849; start domain, struc 99.18
3ijt_A155 SMU.440, putative uncharacterized protein; hypothe 99.17
3tvq_A169 Multifunctional cyclase-dehydratase-3-O-methyl TR 99.13
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BE 98.78
3ggn_A155 Uncharacterized protein DR_A0006; structural genom 98.71
2ns9_A157 Hypothetical protein APE2225; uncharacterized cons 98.67
2pcs_A162 Conserved protein; structural genomics, unknown fu 98.65
1xn6_A143 Hypothetical protein BC4709; structural genomics, 98.37
3p9v_A161 Uncharacterized protein; structural genomics, PSI- 98.33
1z94_A147 Conserved hypothetical protein; NESG, CV1439, stru 98.19
3q6a_A135 Uncharacterized protein; structural genomics, PSI- 98.14
2leq_A146 Uncharacterized protein; start domains, structural 98.1
2lcg_A142 Uncharacterized protein; start domain, structural 98.09
2il5_A171 Hypothetical protein; structural genomics, APC2365 98.08
1xuv_A178 Hypothetical protein MM0500; alpha-beta protein, n 98.07
1xn5_A146 BH1534 unknown conserved protein; structural genom 97.94
2ldk_A172 Uncharacterized protein; structural genomics, nort 97.93
3pu2_A164 Uncharacterized protein; SRPBCC superfamily, PSI-b 97.9
2lak_A160 AHSA1-like protein RHE_CH02687; NESG, structural g 97.85
3rd6_A161 MLL3558 protein; structural genomics, PSI-biology, 97.84
2kew_A152 Uncharacterized protein YNDB; start domain, resona 97.84
2lgh_A144 Uncharacterized protein; AHSA1, start domain, COG3 97.83
3put_A166 Hypothetical conserved protein; structural genomic 97.79
2lf2_A175 Uncharacterized protein; NESG, structural genomics 97.79
2l8o_A144 Uncharacterized protein; mixed alpha-beta protein, 97.78
3eli_A152 AHSA1, AHA1 domain protein; alpha-beta protein, st 97.76
3q63_A151 MLL2253 protein; structural genomics, PSI-biology, 97.73
2l9p_A164 Uncharacterized protein; structural genomics, nort 97.69
3uid_A168 Putative uncharacterized protein; SRPBCC superfami 97.67
3q64_A162 MLL3774 protein; structural genomics, PSI-biology, 97.62
1xfs_A178 NC_840354, conserved hypothetical protein; structu 97.61
2nn5_A184 Hypothetical protein EF_2215; structural genomics, 97.58
4fpw_A181 CALU16; structural genomics, PSI-biology, northeas 97.35
1x53_A145 Activator of 90 kDa heat shock protein ATPase homo 97.3
2k5g_A191 Uncharacterized protein; structural genomiccs, pro 97.29
3ni8_A158 PFC0360W protein; heat shock, malaria, ATPase, str 97.22
2luz_A192 CALU16; structural genomics, northeast structural 97.02
2qpv_A156 Uncharacterized protein ATU1531; structural genomi 96.97
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 96.81
1zxf_A155 CALC; SELF-sacrificing resistance protein, structu 95.61
2lio_A136 Uncharacterized protein; structural genomics, nort 95.23
3qsz_A189 STAR-related lipid transfer protein; structural ge 94.47
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 94.3
2ffs_A157 Hypothetical protein PA1206; 7-stranded beta sheet 94.29
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 85.97
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 82.6
>2wql_A Major allergen DAU C 1; pathogenesis-related protein, plant defense; HET: P4C; 2.70A {Daucus carota} PDB: 2bk0_A Back     alignment and structure
Probab=100.00  E-value=3.6e-39  Score=231.15  Aligned_cols=108  Identities=24%  Similarity=0.457  Sum_probs=102.4

Q ss_pred             CccEEEEEEEEeccCHHHHHHHHhcccccccccccccceeeEEEEecCCccccEEEEc-------eeeeEEEeeecCCcc
Q 044934            1 MGVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVS-------TSMQSRVDALDRDNL   73 (115)
Q Consensus         1 m~~~~~~~ei~i~a~a~k~w~~~~~d~~~l~pk~~P~~v~sve~~eGdg~~Gsir~~t-------~~~kEri~~vDe~~~   73 (115)
                      ||+.+++.|+++++||+|+|++|++|+|+|+|||+|++++|++ +||||++||||+||       .++||||+++|++||
T Consensus         1 mgv~~~~~E~~~~v~a~kl~ka~v~d~~~l~Pk~~P~~iks~~-veGdg~~Gsir~~t~~~g~~~~~~kErle~iD~~~~   79 (154)
T 2wql_A            1 MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVE-VKGDGGAGTVRIITLPEGSPITTMTVRTDAVNKEAL   79 (154)
T ss_dssp             --CCEEEEEEEESSCHHHHHHHHTTTHHHHHHHHSTTTCSEEE-EESSSSTTCEEEEECCTTCSCCEEEEEEEEEETTTT
T ss_pred             CCCeEEEEEEEecCCHHHHHHHHhhcccccchhhcccceeEEE-EECCCCCCeEEEEEEcCCCCceEEEEEEEEEehhhC
Confidence            9999999999999999999999899999999999999999999 68999999999999       589999999999999


Q ss_pred             EEEEEEEecCccCcceEEEEEEEEEEecccccccCCCceeeC
Q 044934           74 YCKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCLMK  115 (115)
Q Consensus        74 ~~~y~vieG~~l~~~~~s~~~~i~v~p~~~~~~~~~gg~~vk  115 (115)
                      +++|+++|||++..+|++|+++++++|+      ++|||++|
T Consensus        80 ~~~y~iieGd~l~~~~~~~~~~ikv~p~------~~ggsvvk  115 (154)
T 2wql_A           80 SYDSTVIDGDILLGFIESIETHMVVVPT------ADGGSITK  115 (154)
T ss_dssp             EEEEEEEESGGGTTTEEEEEEEEEEEEC------TTSCEEEE
T ss_pred             EEEEEEEeccccccceEEEEEEEEEeeC------CCCcEEEE
Confidence            9999999999988999999999999999      89999985



>3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} SCOP: d.129.3.0 Back     alignment and structure
>4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Back     alignment and structure
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Back     alignment and structure
>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Back     alignment and structure
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Back     alignment and structure
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Back     alignment and structure
>3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} Back     alignment and structure
>3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Back     alignment and structure
>3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C Back     alignment and structure
>3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A Back     alignment and structure
>3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 4ds8_A* 3klx_A* 4dsb_A* 4dsc_A* Back     alignment and structure
>3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3zvu_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* Back     alignment and structure
>2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Back     alignment and structure
>1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A Back     alignment and structure
>3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} Back     alignment and structure
>3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Back     alignment and structure
>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Back     alignment and structure
>3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A Back     alignment and structure
>3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A Back     alignment and structure
>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 Back     alignment and structure
>3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A Back     alignment and structure
>2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 Back     alignment and structure
>2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 Back     alignment and structure
>1xn6_A Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} SCOP: d.129.3.5 Back     alignment and structure
>3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} Back     alignment and structure
>1z94_A Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI structure initiative; 2.10A {Chromobacterium violaceum} SCOP: d.129.3.5 Back     alignment and structure
>3q6a_A Uncharacterized protein; structural genomics, PSI-biology; 1.80A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>2leq_A Uncharacterized protein; start domains, structural genomics, PSI-biology, protein STR initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>2lcg_A Uncharacterized protein; start domain, structural genomics, northeast structural GENO consortium, NESG, unknown function, AHSA1; NMR {Ralstonia metallidurans} Back     alignment and structure
>2il5_A Hypothetical protein; structural genomics, APC23650, PSI-2, structure initiative; 2.30A {Staphylococcus aureus subsp} SCOP: d.129.3.5 Back     alignment and structure
>1xuv_A Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} SCOP: d.129.3.5 Back     alignment and structure
>1xn5_A BH1534 unknown conserved protein; structural genomics, protein structure initiative, PSI, BACI halodurans protein BH1534, alpha + beta; NMR {Bacillus halodurans} SCOP: d.129.3.5 Back     alignment and structure
>2ldk_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Arthrobacter aurescens} Back     alignment and structure
>3pu2_A Uncharacterized protein; SRPBCC superfamily, PSI-biology, NESG, RHR263, structural GE protein structure initiative; HET: MSE; 2.61A {Rhodobacter sphaeroides} Back     alignment and structure
>2lak_A AHSA1-like protein RHE_CH02687; NESG, structural genomics, northeast structural genomics CON PSI-biology, structure genomics, unknown function; NMR {Rhizobium etli} Back     alignment and structure
>3rd6_A MLL3558 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.80A {Mesorhizobium loti} Back     alignment and structure
>2kew_A Uncharacterized protein YNDB; start domain, resonance assignments, lipid binding, structural genomics, unknown FU PSI-2; NMR {Bacillus subtilis subsp} PDB: 2kte_A Back     alignment and structure
>2lgh_A Uncharacterized protein; AHSA1, start domain, COG3832, PF08327, HSP90, heat shock, ST genomics, PSI-biology; NMR {Aeromonas hydrophila subsp} Back     alignment and structure
>3put_A Hypothetical conserved protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.83A {Rhizobium etli cfn 42} PDB: 3otl_A* Back     alignment and structure
>2lf2_A Uncharacterized protein; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>2l8o_A Uncharacterized protein; mixed alpha-beta protein, PSI-biology, structural genomics, structure initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>3eli_A AHSA1, AHA1 domain protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} SCOP: d.129.3.5 Back     alignment and structure
>3q63_A MLL2253 protein; structural genomics, PSI-biology, protein structure initiati alpha-beta protein, unknown, structure genomics; 2.00A {Mesorhizobium loti} Back     alignment and structure
>2l9p_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Staphylococcus epidermidis} Back     alignment and structure
>3uid_A Putative uncharacterized protein; SRPBCC superfamily, beta sandwich, function, structural genomics, TB structural genomics conso TBSGC; 1.57A {Mycobacterium smegmatis} SCOP: d.129.3.0 Back     alignment and structure
>3q64_A MLL3774 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.50A {Mesorhizobium loti} Back     alignment and structure
>1xfs_A NC_840354, conserved hypothetical protein; structural genomics, protein structure initiative, NESG, ALP protein, PSI; 1.70A {Nitrosomonas europaea} SCOP: d.129.3.5 Back     alignment and structure
>2nn5_A Hypothetical protein EF_2215; structural genomics, APC29336, PSI-2, structure initiative; HET: MSE; 1.45A {Enterococcus faecalis} SCOP: d.129.3.5 Back     alignment and structure
>4fpw_A CALU16; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.50A {Micromonospora echinospora} PDB: 2luz_A Back     alignment and structure
>1x53_A Activator of 90 kDa heat shock protein ATPase homolog 1; AHA1, HSP90,DUF704, C-terminal domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.129.3.5 Back     alignment and structure
>2k5g_A Uncharacterized protein; structural genomiccs, protein structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} SCOP: d.129.3.5 Back     alignment and structure
>3ni8_A PFC0360W protein; heat shock, malaria, ATPase, structural genomics consortium, unknown function; 2.50A {Plasmodium falciparum} Back     alignment and structure
>2luz_A CALU16; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Micromonospora echinospora} Back     alignment and structure
>2qpv_A Uncharacterized protein ATU1531; structural genomics, PSI protein structure initiative, midwest center for structural genomics; 2.35A {Agrobacterium tumefaciens str} SCOP: d.129.3.8 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1zxf_A CALC; SELF-sacrificing resistance protein, structural genomics, PSI, protein structure initiative; NMR {Micromonospora echinospora} SCOP: d.129.3.5 PDB: 2gkc_A* 2gkd_A 2l65_A* Back     alignment and structure
>2lio_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>2ffs_A Hypothetical protein PA1206; 7-stranded beta sheet, C-terminal helix, structural genomics protein structure initiative; HET: MSE; 2.50A {Pseudomonas aeruginosa} SCOP: d.129.3.7 Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 115
d1fm4a_159 d.129.3.1 (A:) Major tree pollen allergen {Europea 7e-23
d2bk0a1153 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery 2e-22
d1e09a_159 d.129.3.1 (A:) Major tree pollen allergen {Sweet c 3e-21
d1xdfa1157 d.129.3.1 (A:1-157) Plant pathogenesis-related pro 5e-21
d1icxa_155 d.129.3.1 (A:) Plant pathogenesis-related protein 1e-19
d1txca1147 d.129.3.1 (A:1-147) Plant pathogenesis-related pro 3e-17
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Length = 159 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: Pathogenesis-related protein 10 (PR10)-like
domain: Major tree pollen allergen
species: European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]
 Score = 84.9 bits (210), Expect = 7e-23
 Identities = 36/121 (29%), Positives = 60/121 (49%), Gaps = 13/121 (10%)

Query: 2   GVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVS--- 58
           GV  ++ + +     +RMFKAF++D   L PK+ PQA  S+   +G G  G+I+ ++   
Sbjct: 1   GVFNYETEATSVIPAARMFKAFILDGDKLVPKVAPQAISSVENIEGNGGPGTIKKINFPE 60

Query: 59  ----TSMQSRVDALDRDNLYCKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCLM 114
                 ++ RVD +D  N    Y+V E   + D LE I  +IK         + +  C++
Sbjct: 61  GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPVGDTLEKISNEIKIVA------TPDGGCVL 114

Query: 115 K 115
           K
Sbjct: 115 K 115


>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Length = 153 Back     information, alignment and structure
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Length = 159 Back     information, alignment and structure
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 157 Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 155 Back     information, alignment and structure
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d2bk0a1153 Major allergen api g 1 {Celery (Apium graveolens) 100.0
d1fm4a_159 Major tree pollen allergen {European white birch ( 100.0
d1xdfa1157 Plant pathogenesis-related protein PR10 {Yellow lu 100.0
d1e09a_159 Major tree pollen allergen {Sweet cherry (Prunus a 100.0
d1icxa_155 Plant pathogenesis-related protein PR10 {Yellow lu 100.0
d1txca1147 Plant pathogenesis-related protein PR10 {Jicama (P 100.0
d1vjha_120 Hypothetical protein At1G24000 {Thale cress (Arabi 99.85
d3cnwa1138 Uncharacterized protein XoxI {Bacillus cereus [Tax 99.78
d2d4ra1146 Hypothetical protein TTHA0849 {Thermus thermophilu 99.14
d2rera1155 Multifunctional enzyme TcmN, cyclase/aromatase dom 99.09
d2b79a1137 Hypothetical protein SMU440 {Streptococcus mutans 99.06
d2ns9a1147 Hypothetical protein APE2225 {Aeropyrum pernix [Ta 98.94
d2qpva1133 Uncharacterized protein Atu1531 {Agrobacterium tum 98.46
d2pcsa1147 Hypothetical protein GKP20 {Geobacillus kaustophil 98.37
d1xuva_163 Hypothetical protein MM0500 {Methanosarcina mazei 98.37
d1z94a1143 Hypothetical protein CV1439 {Chromobacterium viola 97.92
d2il5a1164 Hypothetical protein SA2116 {Staphylococcus aureus 97.75
d1t17a_148 Hypothetical protein CC1736 {Caulobacter crescentu 97.75
d2nn5a1160 Hypothetical protein EF2215 {Enterococcus faecalis 97.65
d1xn5a_138 Hypothetical protein BH1534 {Bacillus halodurans [ 97.64
d1xn6a_143 Hypothetical protein BC4709 {Bacillus cereus [TaxI 97.42
d1zxfa1155 Calicheamicin gene cluster protein CalC {Micromono 97.38
d1xfsa_165 Hypothetical protein NE0264 {Nitrosomonas europaea 97.29
d3elia1143 Uncharacterized protein SPO3351 {Silicibacter pome 97.21
d1x53a1132 Activator of 90 kda heat shock protein ATPase homo 96.72
d2k5ga1183 Uncharacterized protein BPP1335 {Bordetella parape 96.12
d2ffsa1151 Hypothetical protein PA1206 {Pseudomonas aeruginos 93.96
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 86.19
>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: Pathogenesis-related protein 10 (PR10)-like
domain: Major allergen api g 1
species: Celery (Apium graveolens) [TaxId: 4045]
Probab=100.00  E-value=1.4e-37  Score=221.39  Aligned_cols=107  Identities=26%  Similarity=0.530  Sum_probs=102.8

Q ss_pred             ccEEEEEEEEeccCHHHHHHHHhcccccccccccccceeeEEEEecCCccccEEEEc-------eeeeEEEeeecCCccE
Q 044934            2 GVLRFDKDGSVAAAPSRMFKAFVIDSHNLFPKLLPQAFKSIVYEQGYGEVGSIEVVS-------TSMQSRVDALDRDNLY   74 (115)
Q Consensus         2 ~~~~~~~ei~i~a~a~k~w~~~~~d~~~l~pk~~P~~v~sve~~eGdg~~Gsir~~t-------~~~kEri~~vDe~~~~   74 (115)
                      |+.+++.|+++++||+|+|++|+.|+++|+||++|+.|+++++ ||||++||||.||       .++|||++++|++|++
T Consensus         1 gv~t~e~E~~~~v~a~k~~ka~~~d~~~l~Pk~~P~~i~svev-eGdG~~GsIr~~~~~~~~~~~~~Kerve~iD~~~~~   79 (153)
T d2bk0a1           1 GVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEI-KGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALT   79 (153)
T ss_dssp             CEEEEEEEEEESSCHHHHHHHHTTSHHHHHHHHCGGGCSEEEE-ESSSSTTCEEEEECCTTSSCCEEEEEEEEEETTTTE
T ss_pred             CceEEEEEEeccCCHHHHHHHHhhcccccccccccceeeEEEE-ECCCCCCeEEEEEEecCccceeeEEEEEEEecCccE
Confidence            7899999999999999999999899999999999999999995 8999999999999       7899999999999999


Q ss_pred             EEEEEEecCccCcceEEEEEEEEEEecccccccCCCceeeC
Q 044934           75 CKYTVFEEDCISDILELIVFQIKFGPYKLKKISSNASCLMK  115 (115)
Q Consensus        75 ~~y~vieG~~l~~~~~s~~~~i~v~p~~~~~~~~~gg~~vk  115 (115)
                      ++|+++|||++.++|++|+.+++++|+      ++|||+||
T Consensus        80 ~~y~viEGd~l~~~y~s~~~~~~~~~~------~~ggsv~k  114 (153)
T d2bk0a1          80 FDYSVIDGDILLGFIESIENHVVLVPT------ADGGSICK  114 (153)
T ss_dssp             EEEEEEESGGGTTTEEEEEEEEEEEEC------TTSCEEEE
T ss_pred             EEEEEEecccccccEEEEEEEEEEecC------CCCCeEEE
Confidence            999999999888999999999999999      89999986



>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Back     information, alignment and structure
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Back     information, alignment and structure
>d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Back     information, alignment and structure
>d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Back     information, alignment and structure
>d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1z94a1 d.129.3.5 (A:2-144) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2nn5a1 d.129.3.5 (A:1-160) Hypothetical protein EF2215 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xn6a_ d.129.3.5 (A:) Hypothetical protein BC4709 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zxfa1 d.129.3.5 (A:1-155) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]} Back     information, alignment and structure
>d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1x53a1 d.129.3.5 (A:8-139) Activator of 90 kda heat shock protein ATPase homolog 1, AHSA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k5ga1 d.129.3.5 (A:1-183) Uncharacterized protein BPP1335 {Bordetella parapertussis [TaxId: 519]} Back     information, alignment and structure
>d2ffsa1 d.129.3.7 (A:1-151) Hypothetical protein PA1206 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure