Citrus Sinensis ID: 044935

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680---
DKGEPFIEARAIIEALKPGSTKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLNEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNECLTVKIPGGEESIMSSFEQKKVLHLMLTIDEGTSVPISIWNNVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNIKNLLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRNLGSLKKLNLLRECWICGRGGVSDAGEARRAELEQKKNLLKLGLHFCHSRDGDEEQAGRRENEEDEAERLLEALGPPPNLKELRIHEYRGRRNVVPINWIMSLTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGVESDTDGSSVIAFPKLKRLAFHTMEELEEWDFRTAIKGEIIIMPRLSSLSIDDCPKLKALPDRLLQKTTLQRLEIYGCPILEERCRKETGEDWPKIRHIPDIEIE
ccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHcccccccEEEEEcccHHHHHHHcccccHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHccccccccccccccHHHHHccccccccccHHHHccccccccccEEcHHHHHHHHHHcccHHHHHHHHHHccccccccccccccEEEEEEcHHHHHHHHHHHHHcEEEEEccccccccccccccccEEEEEEEEcccccccccccccccccccEEEEcccccccccccccHHHHHccccEEcEEEcccccccccccccccccccccccccccccccccccccccHHHHccccccEEccccccccHHHHHHHHHcccccEEEcccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHcccccccccEEEEEEccccccccHHccccccHHHHHHHHHHccccccccccEEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccHHHHHHccccccccccccccccEEEc
ccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHcHHcccccccccccHHHHEcHccccHHHHHHHHEHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEHHHHHHHHHHHHccccEEEEEccccccEEcccccccEEEEEEEEEccccccccccHccHcccccccccHcccccccccHHHHHHHHHcccccEEEEEccccccccccHcccccccccccccEEEcccccccccccHHHcccccccEEEEcccccHHHccHHHcccccccEEEEcccccHHcccccccccccHHHHHHHcccccccccccccccccccHHHHHHccccccccccEEEEEccccccccccHHHHHHcccccHHHHHHHccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccEccHHHcccccccccccccccccccEEEEcccHcHHcccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccHHHHHHHcccccccccccccccEEEEc
DKGEPFIEARAIIEalkpgstkDLVEFQSLMQHIQECVEGEKFLLVLDDlwnkdyykwepfynclknglhgskILITTrnettahnmgsTNIIQLMFSFLGKSMEGRENLEKIGREIVgkckglplAVKTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLlsynelpskvkhYFSYCAVFPKDREIWKYELIKLWMAQGYLNEYFNILasssffqefnadgdgevyMCKMHDLVHDLAQFIWRnecltvkipggeesiMSSFEQKKVLHLMLTidegtsvpisIWNNVKRMRRLRSLSveggeyswsskvlpqLFDKLTCLRAITLetygwdynpikeipTNIKNLLHLKYLSLFGESEIKRLPEVLCELynlerldvRFCVNLRELLQGIGKLRKLmyldnegtnslrflpVGIGELIslrnlgslkklNLLRECwicgrggvsdaGEARRAELEQKKNLLKLGlhfchsrdgdeeqagrrenEEDEAERLLealgpppnlkelriheyrgrrnvvpinWIMSLTNLRDLYLSYcrncehlpplgklpsledlhilGMESVKRVGNKflgvesdtdgssviafpklKRLAFHTMEELEEWDFRTAIKGEiiimprlsslsiddcpklkalpdrllQKTTLQRleiygcpileercrketgedwpkirhipdieie
DKGEPFIEARAiiealkpgstKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLMFSFLGKSMEGRENLEKIGReivgkckglplAVKTIgsllrsknneeEWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLNEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNECLTVKIPGGEESIMSSFEQKKVLHLMLtidegtsvpisiwnnvkRMRRLRSLSVEGgeyswsskvlpqLFDKLTCLRAITLetygwdynpikEIPTNIKNLLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRNLGSLKKLNLLRECWICGRGGVSDAGEARRAELEQKKNLLklglhfchsrdgdeeqagrrENEEDEAERllealgpppnlkelriheyrgrrnvvpinwIMSLTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGvesdtdgssviafPKLKRLAFHTMEELEEWDFRTAIKGEIIIMPRLSSLSIDDCPKLKALPdrllqkttlqrleiygcpileercrketgedwpkirhipdieie
DKGEPFIEARAIIEALKPGSTKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLNEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNECLTVKIPGGEESIMSSFEQKKVLHLMLTIDEGTSVPISIWNNVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNIKNLLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRNLGSLKKLNLLRECWICGRGGVSDAGEARRAELEQKKNLLKLGLHFCHSRDGDEEQagrreneedeaerllealGPPPNLKELRIHEYRGRRNVVPINWIMSLTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGVESDTDGSSVIAFPKLKRLAFHTMEELEEWDFRTAIKGEIIIMPRLSSLSIDDCPKLKALPDRLLQKTTLQRLEIYGCPILEERCRKETGEDWPKIRHIPDIEIE
*******EARAIIEALKPGSTKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLNEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNECLTVKIPGGEESIMSSFEQKKVLHLMLTIDEGTSVPISIWNNVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNIKNLLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRNLGSLKKLNLLRECWICGRGGVS**************NLLKLGLHFC**********************************ELRIHEYRGRRNVVPINWIMSLTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGVESDTDGSSVIAFPKLKRLAFHTMEELEEWDFRTAIKGEIIIMPRLSSLSIDDCPKLKALPDRLLQKTTLQRLEIYGCPILEERCRKETGEDWPKI*********
DKGEPFIEARAIIEALK***********SLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLNEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNECLTVKIPG********FEQKKVLHLMLTIDEGTSVPISIWNNVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNIKNLLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRNLGSLKKLNLLRECWICGRGGVSDAGEARRAELEQKKNLLKLGLHFCHSRDGDE**********DEAERLLEALGPPPNLKELRIHEYRGRRNVVPINWIMSLTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGVESDTDGSSVIAFPKLKRLAFHTMEELEEWDFRTAIKGEIIIMPRLSSLSIDDCPKLKALPDRLLQKTTLQRLEIYGCPILEERCRKETGEDWPKIRHIPDIEIE
DKGEPFIEARAIIEALKPGSTKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLNEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNECLTVKIPGGEESIMSSFEQKKVLHLMLTIDEGTSVPISIWNNVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNIKNLLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRNLGSLKKLNLLRECWICGRGGVSDAGEARRAELEQKKNLLKLGLHFCHSRD*****************RLLEALGPPPNLKELRIHEYRGRRNVVPINWIMSLTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGVESDTDGSSVIAFPKLKRLAFHTMEELEEWDFRTAIKGEIIIMPRLSSLSIDDCPKLKALPDRLLQKTTLQRLEIYGCPILEERCRKETGEDWPKIRHIPDIEIE
*KGEPFIEARAIIEALKPGSTKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLNEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNECLTVKIPGGEESIMSSFEQKKVLHLMLTIDEGTSVPISIWNNVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNIKNLLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRNLGSLKKLNLLRECWICGRGGVSDAGEARRAELEQKKNLLKLGLHFCHSRDGDEEQAGRRENEEDEAERLLEALGPPPNLKELRIHEYRGRRNVVPINWIMSLTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGVESDTDGSSVIAFPKLKRLAFHTMEELEEWDFRTAIKGEIIIMPRLSSLSIDDCPKLKALPDRLLQKTTLQRLEIYGCPILEERCRKETGEDWPKIRHIPDIEIE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DKGEPFIEARAIIEALKPGSTKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLNEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNECLTVKIPGGEESIMSSFEQKKVLHLMLTIDEGTSVPISIWNNVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNIKNLLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRNLGSLKKLNLLRECWICGRGGVSDAGEARRAELEQKKNLLKLGLHFCHSRDGDEEQAGRRENEEDEAERLLEALGPPPNLKELRIHEYRGRRNVVPINWIMSLTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGVESDTDGSSVIAFPKLKRLAFHTMEELEEWDFRTAIKGEIIIMPRLSSLSIDDCPKLKALPDRLLQKTTLQRLEIYGCPILEERCRKETGEDWPKIRHIPDIEIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query683 2.2.26 [Sep-21-2011]
Q7XA39 988 Putative disease resistan N/A no 0.808 0.558 0.331 1e-68
Q7XA42 979 Putative disease resistan N/A no 0.799 0.557 0.324 3e-67
Q7XBQ9970 Disease resistance protei N/A no 0.828 0.583 0.321 9e-67
Q7XA40 992 Putative disease resistan N/A no 0.840 0.578 0.327 3e-66
Q9LRR4 1054 Putative disease resistan yes no 0.868 0.562 0.312 4e-64
Q9LRR5 1424 Putative disease resistan no no 0.897 0.430 0.299 1e-56
Q38834852 Disease resistance RPP13- no no 0.686 0.550 0.264 2e-41
Q39214926 Disease resistance protei no no 0.863 0.637 0.250 4e-35
Q8W4J9908 Disease resistance protei no no 0.850 0.639 0.263 3e-33
Q9FJB5901 Disease resistance RPP8-l no no 0.847 0.642 0.254 2e-32
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function desciption
 Score =  261 bits (667), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 227/684 (33%), Positives = 319/684 (46%), Gaps = 132/684 (19%)

Query: 21  TKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRN 80
            +DL  FQ   + +QE + G+++LLVLDD+WN D  KW      L  G  G+ IL TTR 
Sbjct: 239 VEDLASFQ---KKLQELLNGKRYLLVLDDVWNDDLEKWAKLRAVLTVGARGASILATTRL 295

Query: 81  ETTAHNMGS------------TNIIQLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAV 128
           E     MG+             +++  M    G+  E   NL  IG+EIV KC G+PLA 
Sbjct: 296 EKVGSIMGTLQPYHLSNLSPHDSLLLFMQRAFGQQKEANPNLVAIGKEIVKKCGGVPLAA 355

Query: 129 KTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFP 188
           KT+G LLR K  E EW+++ ++EIW     +  +L  L LSY+ LP  ++  F+YCAVFP
Sbjct: 356 KTLGGLLRFKREESEWEHVRDNEIWSLPQDESSILPALRLSYHHLPLDLRQCFAYCAVFP 415

Query: 189 KDREIWKYELIKLWMAQGYL------------NEYFNILASSSFFQEFNADGDGEVYMCK 236
           KD ++ K  LI LWMA G+L            NE +N L   SFFQE  A   G  Y  K
Sbjct: 416 KDTKMIKENLITLWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEAKS-GNTYF-K 473

Query: 237 MHDLVHDLAQFIWRNECLTVKIPGGEESIMSSFEQKKVLHLMLTIDEGTSVPISIWN--- 293
           +HDL+HDLA  ++                                    S   S  N   
Sbjct: 474 IHDLIHDLATSLF------------------------------------SASASCGNIRE 497

Query: 294 -NVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNIKN 352
            NVK  +   S+       S+S    P L  K   LR + L      Y+ ++++P++I +
Sbjct: 498 INVKDYKHTVSIGFAAVVSSYS----PSLLKKFVSLRVLNL-----SYSKLEQLPSSIGD 548

Query: 353 LLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGT 412
           LLHL+YL L   +  + LPE LC+L NL+ LDV  C +L  L +   KL  L +L  +G 
Sbjct: 549 LLHLRYLDL-SCNNFRSLPERLCKLQNLQTLDVHNCYSLNCLPKQTSKLSSLRHLVVDGC 607

Query: 413 NSLRFLPVGIGELISLRN-------------LGSLKKLNLLRECWICGRGGVSDAGEARR 459
             L   P  IG L  L+              LG LK LNL     I     V +  +A  
Sbjct: 608 -PLTSTPPRIGLLTCLKTLGFFIVGSKKGYQLGELKNLNLCGSISITHLERVKNDTDA-E 665

Query: 460 AELEQKKNLLKLGLHFCHSRDGDEEQAGRRENEEDEAERLLEALGPPPNLKELRIHEYRG 519
           A L  K NL  L + +      D +   R E++E    ++LEAL P PNLK L I  + G
Sbjct: 666 ANLSAKANLQSLSMSW------DNDGPNRYESKE---VKVLEALKPHPNLKYLEIIAFGG 716

Query: 520 RRNVVPINWIMSLTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHIL-GMESVKRVGNKFLG 578
            R    IN  + L  +  + +  C+NC  LPP G+LP LE+L +  G   V+ V      
Sbjct: 717 FRFPSWINHSV-LEKVISVRIKSCKNCLCLPPFGELPCLENLELQNGSAEVEYVE----- 770

Query: 579 VESDTDG--SSVIAFPKLKRLAFHTMEELEEWDFRTAIKGEII-----IMPRLSSLSIDD 631
            E D     S+  +FP LK+L          W FR+ +KG +        P L  ++I  
Sbjct: 771 -EDDVHSRFSTRRSFPSLKKLRI--------WFFRS-LKGLMKEEGEEKFPMLEEMAILY 820

Query: 632 CPKLKALPDRLLQKTTLQRLEIYG 655
           CP L   P      +++++LE++G
Sbjct: 821 CP-LFVFPTL----SSVKKLEVHG 839
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query683
224115620 963 cc-nbs-lrr resistance protein [Populus t 0.942 0.668 0.442 1e-138
359482769 904 PREDICTED: putative disease resistance p 0.938 0.709 0.418 1e-136
147825450 927 hypothetical protein VITISV_000086 [Viti 0.942 0.694 0.423 1e-134
359482784 919 PREDICTED: putative disease resistance p 0.934 0.694 0.419 1e-131
359482790 923 PREDICTED: putative disease resistance p 0.934 0.691 0.416 1e-129
359482792 922 PREDICTED: putative disease resistance p 0.934 0.691 0.414 1e-128
224115686 938 cc-nbs-lrr resistance protein [Populus t 0.922 0.671 0.411 1e-127
224115608 922 cc-nbs-lrr resistance protein [Populus t 0.932 0.690 0.413 1e-127
359482788 903 PREDICTED: putative disease resistance p 0.939 0.710 0.419 1e-126
224134406 987 cc-nbs-lrr resistance protein [Populus t 0.950 0.657 0.418 1e-126
>gi|224115620|ref|XP_002332101.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874921|gb|EEF12052.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  498 bits (1281), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 326/737 (44%), Positives = 426/737 (57%), Gaps = 93/737 (12%)

Query: 3   GEPFIE---ARAIIEALKPGSTKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWE 59
            +PF E   A+AI+EALK GS  DL+E Q+L+++IQ  + G+KFLLVLDD+WN+D  KWE
Sbjct: 235 SDPFDETKIAKAILEALK-GSASDLIELQTLLENIQPLIRGKKFLLVLDDVWNEDSTKWE 293

Query: 60  PFYNCLKNGLHGSKILITTRNETTAHNMGS--TNIIQL----------MFS---FLGKSM 104
                L  GL GS IL+TTR    A  MGS  T+I++L          +FS   F  K+ 
Sbjct: 294 QLKYSLMCGLPGSSILVTTRKRNVASRMGSSPTDILELGLLSTDECWSLFSRLAFFEKNS 353

Query: 105 EGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNILESEIWEH-EVVKKGLL 163
             R +LE IGR+I  KCKGLPLA K++GSLLR K+  EEW+++L S +WE  E  +  +L
Sbjct: 354 RERGDLEDIGRQIAAKCKGLPLAAKSLGSLLRFKSRIEEWESVLNSHVWESAEEAESKIL 413

Query: 164 APLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLNEY------------ 211
           APL LSY +LPS ++  FSYCAVFPKD    +  L+KLWMAQG+L E             
Sbjct: 414 APLWLSYYDLPSDMRRCFSYCAVFPKDFTFERDTLVKLWMAQGFLRETHNKEMEVIGRQC 473

Query: 212 FNILASSSFFQEFNAD-GDGEVYMCKMHDLVHDLAQFIWRNECLTVKIPGGEESIMSSFE 270
           F  LA+ SFFQ+F  + GDG +Y CKMHD+VHDLAQ + +NEC +V I G  E  + SF 
Sbjct: 474 FEALAARSFFQDFQKETGDGSIYACKMHDMVHDLAQNLTKNECSSVDIDGPTELKIDSF- 532

Query: 271 QKKVLHLMLTIDEGTSVPISIWNNVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRA 330
                H M+      S P +I      +++LRSL V+G   S ++  LP L   L+CLR 
Sbjct: 533 SINARHSMVVFRNYNSFPATI----HSLKKLRSLIVDGDPSSMNA-ALPNLIANLSCLRT 587

Query: 331 ITLETYGWDYNPIKEIPTNIKNLLHLKYLSLFGESEIKRLPEVLCELYNLERLDVRFCVN 390
           + L   G     I+E+P+NI  L+HL+++       IK LPE + ELYN+  LDV FC  
Sbjct: 588 LKLSGCG-----IEEVPSNIGKLIHLRHVDFSWNENIKELPEEMFELYNMLTLDVSFCNK 642

Query: 391 LRELLQGIGKLRKLMYLDNEGTNSLRFLPV-GIGELISLR--------------NLGSLK 435
           L  L   IG+L KL +L       L F+ + G+  L SLR              N+G L+
Sbjct: 643 LERLPDNIGRLAKLRHLSIHDWRDLSFVKMRGVKGLTSLRELDDFHVSGSDKESNIGDLR 702

Query: 436 KLNLLR-ECWICGRGGVSDAGEARRAELEQKKNLLKLGLHFCHSRDGDEEQAGRRENEED 494
            LN L+    I   G V D  E ++AEL  KK+L  LGL+F            R + E+ 
Sbjct: 703 NLNHLQGSLMISWLGDVKDPDEVKKAELNSKKHLAHLGLNF----------QSRTDREKI 752

Query: 495 EAERLLEALGPPPNLKELRIHEYRGR--RNVVPINWIMSLTNLRDLYLSYCRNCEHLPPL 552
             + +LEAL PPPN+   RI  Y+G     V P  WI     LR + L   R  E+LPPL
Sbjct: 753 HDDEVLEALEPPPNIYSSRIGYYQGVILLRVFP-GWI---NKLRAVELRDWRKIENLPPL 808

Query: 553 GKLPSLEDLHILGMESVKRVGNKFLGVESDTD----------GSSVIAFPKLKRLAFHTM 602
           GKLPSLE LH++GME V RVG +FLG+  D+D           +++IAFPKLK L+F  M
Sbjct: 809 GKLPSLEALHVIGMECVGRVGREFLGLGDDSDISIGEMTSSSSNTIIAFPKLKSLSFWDM 868

Query: 603 EELEEW-------DFRTAIKGEIIIMPRLSSLSIDDCPKLKALPDRLLQKTTLQRLEIYG 655
           EE EEW       + +T I    IIMP L SL I DCPKLKALPD +LQ TTL++L+I G
Sbjct: 869 EEWEEWEGGEGGNEDKTNISISTIIMPSLRSLEIWDCPKLKALPDYVLQSTTLEQLKIRG 928

Query: 656 CPILEERCRKETGEDWP 672
            PIL E+  KE G+ WP
Sbjct: 929 SPILGEQYLKEGGKGWP 945

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147825450|emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115686|ref|XP_002332117.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874937|gb|EEF12068.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115608|ref|XP_002332098.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874918|gb|EEF12049.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482788|ref|XP_003632840.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134406|ref|XP_002321815.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222868811|gb|EEF05942.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query683
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.865 0.560 0.314 1e-61
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.755 0.362 0.303 3.1e-40
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.532 0.393 0.300 8.3e-36
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.510 0.193 0.282 3.8e-34
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.339 0.272 0.295 7.7e-34
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.585 0.440 0.274 4.8e-33
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.581 0.440 0.267 4.1e-32
TAIR|locus:2152536908 AT5G48620 [Arabidopsis thalian 0.591 0.444 0.270 5.2e-30
TAIR|locus:2008440899 AT1G61180 [Arabidopsis thalian 0.562 0.427 0.265 2.5e-27
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.557 0.5 0.256 7.4e-25
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 638 (229.6 bits), Expect = 1.0e-61, P = 1.0e-61
 Identities = 210/668 (31%), Positives = 318/668 (47%)

Query:    40 GEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLM--- 96
             G  FLLVLDDLWN+++  W+       +   GS+IL+TTR++  A  M + ++  L    
Sbjct:   276 GLPFLLVLDDLWNENFADWDLLRQPFIHAAQGSQILVTTRSQRVASIMCAVHVHNLQPLS 335

Query:    97 ----FSFLGKSMEGRE----NLE--KIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKN 146
                 +S   K++ G +    N E   +   IV KC+GLPLAVKT+G +LR +    EW+ 
Sbjct:   336 DGDCWSLFMKTVFGNQEPCLNREIGDLAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWER 395

Query:   147 ILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQG 206
             +L S IW+    K  LL  L +SY  LP+ +K  F+YC++FPK     K +++ LWMA+G
Sbjct:   396 VLSSRIWDLPADKSNLLPVLRVSYYYLPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEG 455

Query:   207 YL-------------NEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNEC 253
             +L             NEYF+ L S S  Q+         Y+  MHD +++LAQF    E 
Sbjct:   456 FLQQTRSSKNLEELGNEYFSELESRSLLQKTKTR-----YI--MHDFINELAQFA-SGE- 506

Query:   254 LTVKIPGGEESIMSSFEQKKVLHLMLTIDEGTSVPISIWNNVKRMRRLRSLSVEGGEYSW 313
              + K   G +  +S  E+ + L   L  +    +       VK +R    LS+     S 
Sbjct:   507 FSSKFEDGCKLQVS--ERTRYLSY-LRDNYAEPMEFEALREVKFLRTFLPLSLTNSSRSC 563

Query:   314 --SSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNI-KNLLHLKYLSLFGESEIKRL 370
                  V  +L   LT LR ++L  Y      I  +P +  KN+ H ++L L   +E+++L
Sbjct:   564 CLDQMVSEKLLPTLTRLRVLSLSHY-----KIARLPPDFFKNISHARFLDL-SRTELEKL 617

Query:   371 PEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRN 430
             P+ LC +YNL+ L + +C +L+EL   I  L  L YLD  GT  LR +P   G L SL+ 
Sbjct:   618 PKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTK-LRQMPRRFGRLKSLQT 676

Query:   431 L---------GS-LKKLNLLRECW----ICGRGGVSDAGEARRAELEQKKNLLKLGLHFC 476
             L         GS + +L  L +      I     V D  +A  A L  KK+L ++   F 
Sbjct:   677 LTTFFVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEANLNSKKHLREID--FV 734

Query:   477 HSRDGDEEQXXXXXXXXXXXXXXXXXXGPPPNLKELRIHEYRGRRNVVPINWIM--SLTN 534
                     +                   P  ++++L I  Y+GRR   P +W+   S + 
Sbjct:   735 WRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRR--FP-DWLSDPSFSR 791

Query:   535 LRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGVESDTDGSSVIAFPKL 594
             +  + L  C+ C  LP LG+LP L++LHI GM  ++ +G KF   +          F  L
Sbjct:   792 IVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQLRDQDQQPFRSL 851

Query:   595 KRLAFHTMEELEEW-DFRTAIKGEIIIMPRLSSLSIDDCPKLKA-LPDRLLQKTTLQRLE 652
             + L F  + + +EW D R   +G++   P L  L I  CP+L   LP  L    +L  L 
Sbjct:   852 ETLRFDNLPDWQEWLDVRVT-RGDLF--PSLKKLFILRCPELTGTLPTFL---PSLISLH 905

Query:   653 IYGCPILE 660
             IY C +L+
Sbjct:   906 IYKCGLLD 913
GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01930033
cc-nbs-lrr resistance protein (963 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query683
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-39
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  146 bits (371), Expect = 2e-39
 Identities = 71/190 (37%), Positives = 109/190 (57%), Gaps = 17/190 (8%)

Query: 34  IQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNII 93
           I+E +  ++FLLVLDD+W K    W+       +G +GS++++TTR+E+ A  MG T+  
Sbjct: 93  IKEALLRKRFLLVLDDVWEK--NDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKP 150

Query: 94  QLMFSF-------------LGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNN 140
             + S                K +     LE++ +EIV KCKGLPLA+K +G LL  K+ 
Sbjct: 151 HEVESLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKST 210

Query: 141 EEEWKNILESEIWEHEVVK--KGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYEL 198
            +EW+++LE    E         +L+ L LSY+ LP  +K  F Y A+FP+D  I K +L
Sbjct: 211 VQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNIRKEQL 270

Query: 199 IKLWMAQGYL 208
           IKLW+A+G++
Sbjct: 271 IKLWIAEGFV 280

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 683
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.65
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.5
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.49
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.46
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
KOG4237498 consensus Extracellular matrix protein slit, conta 99.43
KOG0617264 consensus Ras suppressor protein (contains leucine 99.36
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.34
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.31
KOG4237498 consensus Extracellular matrix protein slit, conta 99.31
KOG4341483 consensus F-box protein containing LRR [General fu 99.03
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.99
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.82
KOG4341483 consensus F-box protein containing LRR [General fu 98.82
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.8
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.79
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.75
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.73
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.72
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.66
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.52
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.5
PLN03150623 hypothetical protein; Provisional 98.39
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
PLN03150623 hypothetical protein; Provisional 98.28
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.2
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.15
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.13
PRK15386426 type III secretion protein GogB; Provisional 98.08
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
PRK15386426 type III secretion protein GogB; Provisional 97.92
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.77
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.67
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.61
PRK04841 903 transcriptional regulator MalT; Provisional 97.43
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.22
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.71
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.53
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.73
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.71
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.36
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.36
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.89
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 94.71
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.69
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.95
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.48
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.11
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.98
PRK00411394 cdc6 cell division control protein 6; Reviewed 92.96
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.9
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 92.47
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.88
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.22
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.07
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.11
smart0037026 LRR Leucine-rich repeats, outliers. 86.11
PF13173128 AAA_14: AAA domain 84.55
smart0037026 LRR Leucine-rich repeats, outliers. 83.45
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.45
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 81.21
KOG4308478 consensus LRR-containing protein [Function unknown 80.94
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 80.87
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.72
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-61  Score=535.69  Aligned_cols=588  Identities=28%  Similarity=0.432  Sum_probs=426.0

Q ss_pred             CCcccH---HHHHHHHHcCCCCC-CCchhHHHHHHHHHHHcCCceEEEEEEcCCCCCccChHhHHHhhhCCCCCcEEEEE
Q 044935            2 KGEPFI---EARAIIEALKPGST-KDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILIT   77 (683)
Q Consensus         2 ~s~~~~---l~~~il~~~~~~~~-~~~~~~~~~~~~l~~~l~~kr~LlvLDdv~~~~~~~~~~l~~~~~~~~~gs~iivT   77 (683)
                      ||++|+   ++++|++.++.... -.....++++..|.+.|+.|||+|||||||++  .+|+.|..++|...+||||++|
T Consensus       218 VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLDDIW~~--~dw~~I~~~~p~~~~g~KvvlT  295 (889)
T KOG4658|consen  218 VSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLDDIWEE--VDWDKIGVPFPSRENGSKVVLT  295 (889)
T ss_pred             EcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEeccccc--ccHHhcCCCCCCccCCeEEEEE
Confidence            788888   99999999983232 22234489999999999999999999999987  5699999999999999999999


Q ss_pred             ecCchhhhc-cCCcchHHH-----------HHHhhcCC-CCCcchHHHHHHHHHHHcCCchHHHHHHHhhhcCCCCHHHH
Q 044935           78 TRNETTAHN-MGSTNIIQL-----------MFSFLGKS-MEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEW  144 (683)
Q Consensus        78 Tr~~~v~~~-~~~~~~~~l-----------l~~~~~~~-~~~~~~~~~~~~~i~~~c~glPlal~~~~~~L~~~~~~~~w  144 (683)
                      ||++.||.. ++....+++           |....+.. ....+.++++|++++++|+|+|||+.++|+.|+.|.+.++|
T Consensus       296 TRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW  375 (889)
T KOG4658|consen  296 TRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEW  375 (889)
T ss_pred             eccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHH
Confidence            999999998 777666655           44444333 33335589999999999999999999999999999999999


Q ss_pred             HHHHHhhhhc----cccccccchHHHHHhhcCCChhhHHHhhhhccCCCCeeeChHHHHHHHHHhCcHH-----------
Q 044935          145 KNILESEIWE----HEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYLN-----------  209 (683)
Q Consensus       145 ~~~l~~~~~~----~~~~~~~~~~~l~~sy~~L~~~~k~~fl~~a~fp~~~~~~~~~li~~w~~~g~~~-----------  209 (683)
                      +++.+...+.    .....+.+++++++||+.||++.|.||+|||.||+|+.|.+++|+.+|+||||+.           
T Consensus       376 ~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~  455 (889)
T KOG4658|consen  376 RRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDV  455 (889)
T ss_pred             HHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcc
Confidence            9999875544    2223467999999999999999999999999999999999999999999999884           


Q ss_pred             --HHHHHHHhcCCceeecCCCCCCeeEEehhHHHHHHHHHHhh-----cceeEeecC-CCccccccccccCceEEEEEEe
Q 044935          210 --EYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWR-----NECLTVKIP-GGEESIMSSFEQKKVLHLMLTI  281 (683)
Q Consensus       210 --~~l~~L~~~~ll~~~~~~~~g~~~~~~mhdl~~~~~~~~~~-----~e~~~~~~~-~~~~~~~~~~~~~~~~~l~l~~  281 (683)
                        .++.+|++++|+......  ++...|+|||+||++|.+++.     +++.++..+ +..+.+....+ ..+|++++.+
T Consensus       456 G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~-~~~rr~s~~~  532 (889)
T KOG4658|consen  456 GYDYIEELVRASLLIEERDE--GRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSW-NSVRRMSLMN  532 (889)
T ss_pred             hHHHHHHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccch-hheeEEEEec
Confidence              789999999999876543  667789999999999999999     666555543 33333322222 6889999999


Q ss_pred             cCCCCcccccchhhhccCCccEEEEeCCCCccccccchhhhcCCCceeEEEecccCCcccCcccccccccCCCCCcEEee
Q 044935          282 DEGTSVPISIWNNVKRMRRLRSLSVEGGEYSWSSKVLPQLFDKLTCLRAITLETYGWDYNPIKEIPTNIKNLLHLKYLSL  361 (683)
Q Consensus       282 ~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~lp~~i~~l~~L~~L~L  361 (683)
                      +.+..++....     +++|++|.+.+|.. +.....+.+|..++.|++|||++|    ..+.++|+.|+.|.+||||++
T Consensus       533 ~~~~~~~~~~~-----~~~L~tLll~~n~~-~l~~is~~ff~~m~~LrVLDLs~~----~~l~~LP~~I~~Li~LryL~L  602 (889)
T KOG4658|consen  533 NKIEHIAGSSE-----NPKLRTLLLQRNSD-WLLEISGEFFRSLPLLRVLDLSGN----SSLSKLPSSIGELVHLRYLDL  602 (889)
T ss_pred             cchhhccCCCC-----CCccceEEEeecch-hhhhcCHHHHhhCcceEEEECCCC----CccCcCChHHhhhhhhhcccc
Confidence            99887766553     67899999999862 233445667899999999999984    667899999999999999999


Q ss_pred             cCCCCccccchHHhcccCCcEEeccCccchhhcccccccccccceEecCCCccccccccccCCCCCCCCccccccCccCC
Q 044935          362 FGESEIKRLPEVLCELYNLERLDVRFCVNLRELLQGIGKLRKLMYLDNEGTNSLRFLPVGIGELISLRNLGSLKKLNLLR  441 (683)
Q Consensus       362 ~~~~~~~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~l~~~~~~~~~p~~~~~l~~L~~l~~l~~L~~L~  441 (683)
                      +++. +..+|..+.+|++|.+|++..+..+..+|.....|++|++|.+....    ......      .+.++..|..|+
T Consensus       603 ~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~----~~~~~~------~l~el~~Le~L~  671 (889)
T KOG4658|consen  603 SDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSA----LSNDKL------LLKELENLEHLE  671 (889)
T ss_pred             cCCC-ccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccc----cccchh------hHHhhhcccchh
Confidence            9999 99999999999999999999988777776666779999999987653    111111      223333444444


Q ss_pred             CeeEcCCCCCCChhHhHHhccccCCCCCe----EEEEeecCCCCCcccccCCCCchhHHHHHhhhcCCCCCccEEEEeee
Q 044935          442 ECWICGRGGVSDAGEARRAELEQKKNLLK----LGLHFCHSRDGDEEQAGRRENEEDEAERLLEALGPPPNLKELRIHEY  517 (683)
Q Consensus       442 ~l~i~~~~~~~~~~~~~~~~l~~~~~L~~----L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~  517 (683)
                      .+.+.....      .....+..+..|.+    +.+.++                  .....+..+..+.+|+.|.+.++
T Consensus       672 ~ls~~~~s~------~~~e~l~~~~~L~~~~~~l~~~~~------------------~~~~~~~~~~~l~~L~~L~i~~~  727 (889)
T KOG4658|consen  672 NLSITISSV------LLLEDLLGMTRLRSLLQSLSIEGC------------------SKRTLISSLGSLGNLEELSILDC  727 (889)
T ss_pred             hheeecchh------HhHhhhhhhHHHHHHhHhhhhccc------------------ccceeecccccccCcceEEEEcC
Confidence            444322111      00111122222221    221111                  12334556677788888888888


Q ss_pred             cCCCCccCcch-----Hhh-ccccceEeecCCCCCCCCCCCCCCCCcceEEecCCCCeeEecccccCCCCCCCCcccccc
Q 044935          518 RGRRNVVPINW-----IMS-LTNLRDLYLSYCRNCEHLPPLGKLPSLEDLHILGMESVKRVGNKFLGVESDTDGSSVIAF  591 (683)
Q Consensus       518 ~~~~~~~~~~~-----~~~-l~~L~~L~l~~~~~~~~~~~l~~l~~L~~L~L~~~~~l~~~~~~~~~~~~~~~~~~~~~~  591 (683)
                      .+....  ..+     ... ++++..+.+.+|.....+......|+|+.|.+..|..++..-+.......  ....+..|
T Consensus       728 ~~~e~~--~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~~--l~~~i~~f  803 (889)
T KOG4658|consen  728 GISEIV--IEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALLE--LKELILPF  803 (889)
T ss_pred             CCchhh--cccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHhhh--cccEEecc
Confidence            876421  112     112 55677777777766665555556788888888888777665443222110  00012345


Q ss_pred             cccccc-cccccccccccccccccccccccCCcccEEeecCCCCCCcCCcCCCCCCCCceEEEeCC
Q 044935          592 PKLKRL-AFHTMEELEEWDFRTAIKGEIIIMPRLSSLSIDDCPKLKALPDRLLQKTTLQRLEIYGC  656 (683)
Q Consensus       592 ~~L~~L-~l~~~~~L~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~lp~~l~~l~~L~~L~l~~c  656 (683)
                      +++..+ .+.+.+.+..+..   .|-   .+++|+.+.+..||+++.+|.       +.++.+.+|
T Consensus       804 ~~~~~l~~~~~l~~l~~i~~---~~l---~~~~l~~~~ve~~p~l~~~P~-------~~~~~i~~~  856 (889)
T KOG4658|consen  804 NKLEGLRMLCSLGGLPQLYW---LPL---SFLKLEELIVEECPKLGKLPL-------LSTLTIVGC  856 (889)
T ss_pred             cccccceeeecCCCCceeEe---ccc---CccchhheehhcCcccccCcc-------ccccceecc
Confidence            666666 3554444444332   121   356688888888887776653       344555555

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query683
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 7e-07
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 4e-06
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 6e-06
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 3e-05
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure 
Iteration: 1

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 98/226 (43%), Gaps = 45/226 (19%)
Query: 44  LLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGSTNIIQLMFSFLGKS 103
           LL+LDD+W+     W      LK      +IL+TTR+++   ++     +  + S LGK 
Sbjct: 239 LLILDDVWDS----W-----VLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKE 289
Query: 104 M----------EGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNE----------EE 143
                        + +L +    I+ +CKG PL V  IG+LLR   N           ++
Sbjct: 290 KGLEILSLFVNMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQ 349
Query: 144 WKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFSYCAVFPKDREIWKYELIKLW- 202
           +K I +S  +++E + +     + +S   L   +K Y++  ++  KD ++    L  LW 
Sbjct: 350 FKRIRKSSSYDYEALDEA----MSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWD 405
Query: 203 ----MAQGYLNEYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDL 244
                 +  L E+ N    S  F     D +G+ +   +HDL  D 
Sbjct: 406 METEEVEDILQEFVN---KSLLF----CDRNGKSFRYYLHDLQVDF 444
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query683
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-64
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 8e-54
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-31
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  223 bits (570), Expect = 1e-64
 Identities = 49/253 (19%), Positives = 100/253 (39%), Gaps = 31/253 (12%)

Query: 13  IEALKPGSTKDLVEFQSLMQHIQECVEGE--KFLLVLDDLWNKDYYKWEPFYNCLKNGLH 70
           ++  +  S +  +  +     ++  +  +  + LL+LDD+W+    K             
Sbjct: 206 LDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLLILDDVWDSWVLKA---------FDS 256

Query: 71  GSKILITTRNETTAHNMGSTNIIQLMFSFLG----------KSMEGRENLEKIGREIVGK 120
             +IL+TTR+++   ++     +  + S LG               + +L +    I+ +
Sbjct: 257 QCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMKKADLPEQAHSIIKE 316

Query: 121 CKGLPLAVKTIGSLLRSKNNE-EEWKNILESEIWEHEVVKK-----GLLAPLLLSYNELP 174
           CKG PL V  IG+LLR   N  E +   L+++ ++            L   + +S   L 
Sbjct: 317 CKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLR 376

Query: 175 SKVKHYFSYCAVFPKDREIWKYELIKLWMAQGYL-NEYFNILASSSFFQEFNADGDGEVY 233
             +K Y++  ++  KD ++    L  LW  +     +      + S       D +G+ +
Sbjct: 377 EDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVNKSLLFC---DRNGKSF 433

Query: 234 MCKMHDLVHDLAQ 246
              +HDL  D   
Sbjct: 434 RYYLHDLQVDFLT 446
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query683
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.92
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.88
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.81
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.81
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.76
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.73
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.7
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.67
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.67
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.67
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.67
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.65
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.65
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.65
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.62
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.61
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.61
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.6
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.55
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.55
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.52
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.52
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.5
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.5
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.48
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.47
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.46
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.45
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.44
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.4
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.39
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.37
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.36
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.34
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.33
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.33
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.32
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.3
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.3
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.3
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.27
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.26
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.25
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.23
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.22
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.2
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.18
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.18
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.16
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.93
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.93
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.92
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.86
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.83
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.82
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.79
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.57
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.55
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.47
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.32
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.27
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.16
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.14
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.02
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.99
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.87
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.62
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.36
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.24
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.03
2fna_A357 Conserved hypothetical protein; structural genomic 96.98
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.52
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.9
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.69
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.33
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 95.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.73
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.45
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.64
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 92.75
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.49
2chg_A226 Replication factor C small subunit; DNA-binding pr 89.05
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 83.38
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.96  E-value=1.7e-29  Score=275.26  Aligned_cols=226  Identities=16%  Similarity=0.200  Sum_probs=170.4

Q ss_pred             HHHHHHHHcCCCCC-------CCchhHHHHHHHHHHHcCCc-eEEEEEEcCCCCCccChHhHHHhhhCCCCCcEEEEEec
Q 044935            8 EARAIIEALKPGST-------KDLVEFQSLMQHIQECVEGE-KFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTR   79 (683)
Q Consensus         8 l~~~il~~~~~~~~-------~~~~~~~~~~~~l~~~l~~k-r~LlvLDdv~~~~~~~~~~l~~~~~~~~~gs~iivTTr   79 (683)
                      ++++|+++++ ...       .+..+.+.+...+++.|++| ||||||||||+.++..|.       . .+||+||||||
T Consensus       203 ~~~~il~~l~-~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLDdv~~~~~~~~~-------~-~~gs~ilvTTR  273 (549)
T 2a5y_B          203 LFTDILLMLK-SEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWA-------Q-ELRLRCLVTTR  273 (549)
T ss_dssp             HHHHHHHHHT-TTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHH-------H-HTTCEEEEEES
T ss_pred             HHHHHHHHHh-cCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEECCCCchhhccc-------c-cCCCEEEEEcC
Confidence            9999999998 431       12335677899999999996 999999999975432222       1 27999999999


Q ss_pred             CchhhhccC-CcchH-----------HHHHHhhcCCCCCcchHHHHHHHHHHHcCCchHHHHHHHhhhcCCCCHHHHHHH
Q 044935           80 NETTAHNMG-STNII-----------QLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNI  147 (683)
Q Consensus        80 ~~~v~~~~~-~~~~~-----------~ll~~~~~~~~~~~~~~~~~~~~i~~~c~glPlal~~~~~~L~~~~~~~~w~~~  147 (683)
                      ++.++..++ ....|           ++|...++.. ...+.+++++++|+++|+|+||||+++|+.|+.+ ..+ |...
T Consensus       274 ~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~-~~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~w~-~~~~  350 (549)
T 2a5y_B          274 DVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPM-PVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFE-KMAQ  350 (549)
T ss_dssp             BGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCC-C--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHH-HHHH
T ss_pred             CHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCC-CCchhHHHHHHHHHHHhCCChHHHHHHHHHhccc-hHH-HHHH
Confidence            999998775 22233           3354444333 2246788899999999999999999999999876 332 3333


Q ss_pred             HHhhhhccccccccchHHHHHhhcCCChhhHHHhh-----------hhccCCCCeeeChHHHHHHHHHh--CcHH-----
Q 044935          148 LESEIWEHEVVKKGLLAPLLLSYNELPSKVKHYFS-----------YCAVFPKDREIWKYELIKLWMAQ--GYLN-----  209 (683)
Q Consensus       148 l~~~~~~~~~~~~~~~~~l~~sy~~L~~~~k~~fl-----------~~a~fp~~~~~~~~~li~~w~~~--g~~~-----  209 (683)
                      +....+..  ...++++++.+||+.||+++|.||+           |||+||+++.++    +..|+++  ||+.     
T Consensus       351 l~~~l~~~--~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~  424 (549)
T 2a5y_B          351 LNNKLESR--GLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEE  424 (549)
T ss_dssp             HHHHHHHH--CSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------C
T ss_pred             hHHHhhcc--cHHHHHHHHhcccccccHHHHHHHhccchhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCC
Confidence            43322211  2456888999999999999999999           999999999987    8899999  8774     


Q ss_pred             -------HHHHHHHhcCCceeecCCCCCCeeEEehhHHHHHHHHHHhhccee
Q 044935          210 -------EYFNILASSSFFQEFNADGDGEVYMCKMHDLVHDLAQFIWRNECL  254 (683)
Q Consensus       210 -------~~l~~L~~~~ll~~~~~~~~g~~~~~~mhdl~~~~~~~~~~~e~~  254 (683)
                             .++++|++++|++....+   ....|+|||++|++|+.++.+++.
T Consensus       425 ~~~~~~~~~l~~L~~rsLl~~~~~~---~~~~~~mHdlv~~~a~~~~~~~~~  473 (549)
T 2a5y_B          425 QLDDEVADRLKRLSKRGALLSGKRM---PVLTFKIDHIIHMFLKHVVDAQTI  473 (549)
T ss_dssp             CCTHHHHHHHHHTTTBSSCSEEECS---SSCEEECCHHHHHHHHTTSCTHHH
T ss_pred             CCHHHHHHHHHHHHHcCCeeEecCC---CceEEEeChHHHHHHHHHHHHHHH
Confidence                   479999999999987543   344689999999999988877653
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 683
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 87.2 bits (215), Expect = 1e-19
 Identities = 28/183 (15%), Positives = 51/183 (27%), Gaps = 27/183 (14%)

Query: 14  EALKPGSTKDLVEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSK 73
           + L   S + +             ++    L V DD+  ++  +W              +
Sbjct: 108 DLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQEL--------RLR 159

Query: 74  ILITTRNETTAHNMGSTNII-----------QLMFSFLGKSMEGRENLEKIGREIVGKCK 122
            L+TTR+   ++    T                     G  M   E  E +  + +    
Sbjct: 160 CLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSS 219

Query: 123 GLPLAVKTIGSLLRSKNNEE--EWKNILESEIWEHEVVKKGLLAPLLLSYNELPSKVKHY 180
           G P  +         K  E+  +  N LES          G+      SY  L   ++  
Sbjct: 220 GNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLV------GVECITPYSYKSLAMALQRC 273

Query: 181 FSY 183
              
Sbjct: 274 VEV 276
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query683
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.63
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.61
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.57
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.53
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.53
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.49
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.46
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.33
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.25
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.24
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.22
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.2
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.14
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.12
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.03
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.01
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.93
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.88
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.81
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.68
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.56
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.73
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.28
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.05
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.84  E-value=2.4e-21  Score=188.50  Aligned_cols=146  Identities=13%  Similarity=0.058  Sum_probs=112.0

Q ss_pred             hhHHHHHHHHHHHcCCceEEEEEEcCCCCCccChHhHHHhhhCCCCCcEEEEEecCchhhhccCCc-ch-----------
Q 044935           25 VEFQSLMQHIQECVEGEKFLLVLDDLWNKDYYKWEPFYNCLKNGLHGSKILITTRNETTAHNMGST-NI-----------   92 (683)
Q Consensus        25 ~~~~~~~~~l~~~l~~kr~LlvLDdv~~~~~~~~~~l~~~~~~~~~gs~iivTTr~~~v~~~~~~~-~~-----------   92 (683)
                      .........+++.+.+||+|+||||||+.  .+|..+.      ..|||||||||++.++..+... ..           
T Consensus       119 ~~~~~~~~~~~~~L~~kr~LlVLDDv~~~--~~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea  190 (277)
T d2a5yb3         119 TSVVLKRMICNALIDRPNTLFVFDDVVQE--ETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDEC  190 (277)
T ss_dssp             CHHHHHHHHHHHHTTSTTEEEEEEEECCH--HHHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHH
T ss_pred             hhHHHHHHHHHHHhccCCeeEecchhhHH--hhhhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHH
Confidence            44455566788999999999999999976  3455433      2489999999999999876543 23           


Q ss_pred             HHHHHHhhcCCCCCcchHHHHHHHHHHHcCCchHHHHHHHhhhcCCCCHHHHHHHHHhhhhccccccccchHHHHHhhcC
Q 044935           93 IQLMFSFLGKSMEGRENLEKIGREIVGKCKGLPLAVKTIGSLLRSKNNEEEWKNILESEIWEHEVVKKGLLAPLLLSYNE  172 (683)
Q Consensus        93 ~~ll~~~~~~~~~~~~~~~~~~~~i~~~c~glPlal~~~~~~L~~~~~~~~w~~~l~~~~~~~~~~~~~~~~~l~~sy~~  172 (683)
                      .++|..+++.. ...+..++++++|+++|+|+||||+++|+.|+.+ +.+.|....+...   .....++.+++.+||++
T Consensus       191 ~~Lf~~~~~~~-~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~~~~~~~~~L~---~~~~~~v~~il~~sY~~  265 (277)
T d2a5yb3         191 YDFLEAYGMPM-PVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLE---SRGLVGVECITPYSYKS  265 (277)
T ss_dssp             HHHHHHTSCCC-C--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHHHHHHHHH---HHCSSTTCCCSSSSSSS
T ss_pred             HHHHHHHhCCc-cCchhhHHHHHHHHHHhCCCHHHHHHHHHHhccC-CHHHHHHHHHHHh---cCcHHHHHHHHHHHHhc
Confidence            34455555544 3345578899999999999999999999999877 7888888766532   22346688999999999


Q ss_pred             CChhhHHHhhh
Q 044935          173 LPSKVKHYFSY  183 (683)
Q Consensus       173 L~~~~k~~fl~  183 (683)
                      ||+++|.||-+
T Consensus       266 L~~~lk~c~~~  276 (277)
T d2a5yb3         266 LAMALQRCVEV  276 (277)
T ss_dssp             HHHHHHHHHHT
T ss_pred             ccHHHHHHHHh
Confidence            99999999965
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure