Citrus Sinensis ID: 044941

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
LRRVLGASRIWRRKENECDEDDDWESVEEGPAEIIWQGNEIIIRKKKVRVPKKDANPLSKKEDVDRPTSNPLPPQSEAFADHQNAQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQRCSRVHFYPNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDILL
cHHHcccHHHHHHHccccccccccHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHccccc
ccEEEcccEEEEEcccccccccccEEEcccccEEEEcccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHcHHHHHHHHHccccccccccccccccEEEEEccccccccccccccccccccEEEHHHHcccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccHHHEEEEEEEc
lrrvlgasriwrrkenecdedddwesveegPAEIIWQGNEIIIRkkkvrvpkkdanplskkedvdrptsnplppqseafADHQNAQQALETVAQqvpnfgtehdkahcplhlktgacrfgqrcsrvhfypnksCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKAlpaggkliacepvlpddsnesQRTRALLEGDILL
lrrvlgasriwrrkenecdedddwesveegpaeiiwqgneiiirkkkvrvpkkdanplskkedvdrptSNPLPPQSEAFADHQNAQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQRCSRVHFYPNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPvlpddsnesqrtrallegdill
LRRVLGASRIWRRKENECDEDDDWESVEEGPAEIIWQGNEiiirkkkvrvpkkDANPLSKKEDVDRPTSNPLPPQSEAFADHQNAQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQRCSRVHFYPNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDILL
******************************PAEIIWQGNEIIIRKK****************************************************FGTEHDKAHCPLHLKTGACRFGQRCSRVHFYPNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPV*********************
*****************CDEDDDWESVEEGPAEIIWQGNEIIIRKKKVRVPKKDANPL************PLPPQSEAFADHQNAQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQRCSRVHFYPNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDILL
LRRVLGASRIWRRKEN***********EEGPAEIIWQGNEIIIRKKKV**********************PLPPQSEAFADHQNAQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQRCSRVHFYPNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDILL
LRRVLGASRIWRRKENECDEDDDWESVEEGPAEIIWQGNEIIIRKKKVRVPKK***************SNPLPPQSEAFADHQNAQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQRCSRVHFYPNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDILL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LRRVLGASRIWRRKENECDEDDDWESVEEGPAEIIWQGNEIIIRKKKVRVPKKDANPLSKKEDVDRPTSNPLPPQSEAFADHQNAQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQRCSRVHFYPNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDILL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query202 2.2.26 [Sep-21-2011]
Q9SY74 757 Zinc finger CCCH domain-c yes no 0.762 0.203 0.622 3e-51
Q6YVX9 678 Zinc finger CCCH domain-c yes no 0.430 0.128 0.460 6e-21
Q15696 482 U2 small nuclear ribonucl yes no 0.247 0.103 0.5 2e-09
Q9FMY5 283 Splicing factor U2af smal no no 0.217 0.155 0.590 3e-09
Q15695 479 U2 small nuclear ribonucl no no 0.247 0.104 0.5 3e-09
Q9S709 296 Splicing factor U2af smal no no 0.217 0.148 0.590 3e-09
Q62377 462 U2 small nuclear ribonucl no no 0.331 0.145 0.386 4e-09
Q9ZQW8 290 Splicing factor U2af smal no no 0.217 0.151 0.590 4e-09
Q6AUG0 304 Splicing factor U2af smal no no 0.217 0.144 0.545 1e-08
O81646359 Caffeic acid 3-O-methyltr N/A no 0.292 0.164 0.389 2e-08
>sp|Q9SY74|C3H5_ARATH Zinc finger CCCH domain-containing protein 5 OS=Arabidopsis thaliana GN=At1g10320 PE=2 SV=2 Back     alignment and function desciption
 Score =  201 bits (511), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 125/172 (72%), Gaps = 18/172 (10%)

Query: 16  NECDEDDD--WESVEEGPAEIIWQGNEIIIRKKKVRVPKK-----DANPLSKKEDV---- 64
           +EC ED+D  +E +EEGP EII+QGNEII++K KVRVPKK     D +  S  E V    
Sbjct: 140 DECGEDEDGEYEYIEEGPPEIIFQGNEIILKKNKVRVPKKSVVQVDGHESSNAEFVLQIS 199

Query: 65  DRPTSNPLPPQSEAFADHQN---AQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQ 121
           DRPTSNPLPP SEA A++QN   AQQ LE+VAQ+VPNFGTE DKAHCP HLKTGACRFGQ
Sbjct: 200 DRPTSNPLPPGSEASANYQNVSSAQQILESVAQEVPNFGTEQDKAHCPFHLKTGACRFGQ 259

Query: 122 RCSRVHFYPNKSCTLLIKNMYNV-KFQWVLT---TWTDDECKLIMENCYKAL 169
           RCSRVHFYPNKSCTLL+KNMYN     W       +TD+E +L  E  Y+ +
Sbjct: 260 RCSRVHFYPNKSCTLLMKNMYNGPGITWEQDEGLEYTDEEAELCYEEFYEDV 311

Arabidopsis thaliana (taxid: 3702)
>sp|Q6YVX9|C3H16_ORYSJ Zinc finger CCCH domain-containing protein 16 OS=Oryza sativa subsp. japonica GN=Os02g0557500 PE=2 SV=2 Back     alignment and function description
>sp|Q15696|U2AFM_HUMAN U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 OS=Homo sapiens GN=ZRSR2 PE=1 SV=2 Back     alignment and function description
>sp|Q9FMY5|U2AFB_ARATH Splicing factor U2af small subunit B OS=Arabidopsis thaliana GN=U2AF35B PE=2 SV=1 Back     alignment and function description
>sp|Q15695|U2AFL_HUMAN U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 OS=Homo sapiens GN=ZRSR1 PE=2 SV=2 Back     alignment and function description
>sp|Q9S709|U2AFA_ARATH Splicing factor U2af small subunit A OS=Arabidopsis thaliana GN=U2AF35A PE=1 SV=1 Back     alignment and function description
>sp|Q62377|U2AFM_MOUSE U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 OS=Mus musculus GN=Zrsr2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQW8|U2AFA_ORYSJ Splicing factor U2af small subunit A OS=Oryza sativa subsp. japonica GN=U2AF35A PE=2 SV=1 Back     alignment and function description
>sp|Q6AUG0|U2AFB_ORYSJ Splicing factor U2af small subunit B OS=Oryza sativa subsp. japonica GN=U2AF35B PE=2 SV=1 Back     alignment and function description
>sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
297739459 875 unnamed protein product [Vitis vinifera] 0.613 0.141 0.715 1e-49
15218489 757 zinc finger CCCH domain-containing prote 0.762 0.203 0.622 1e-49
225465261 887 PREDICTED: uncharacterized protein LOC10 0.742 0.169 0.589 2e-49
255573856 857 U2 snrnp auxiliary factor, small subunit 0.633 0.149 0.733 5e-48
297849356 772 hypothetical protein ARALYDRAFT_471143 [ 0.762 0.199 0.610 3e-47
449432946 867 PREDICTED: uncharacterized protein LOC10 0.599 0.139 0.698 9e-42
449478305 838 PREDICTED: zinc finger CCCH domain-conta 0.599 0.144 0.698 1e-41
359392832 790 rough endosperm 3-umu1 alpha isoform [Ze 0.628 0.160 0.676 2e-40
359392870 368 rough endosperm 3 epsilon isoform [Zea m 0.628 0.345 0.676 2e-40
359392834 311 rough endosperm 3-umu1 gamma isoform [Ze 0.628 0.408 0.676 2e-40
>gi|297739459|emb|CBI29641.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 93/130 (71%), Positives = 109/130 (83%), Gaps = 6/130 (4%)

Query: 19  DEDDDWESVEEGPAEIIWQGNEIIIRKKKVRVPKKDANPLSKKE-DVDRPTSNPLPPQSE 77
           +EDDDWE  E GPAEIIWQGNEII++KK+VR+ KKD +  S+KE D +RPTSNPLPPQSE
Sbjct: 110 NEDDDWEYAE-GPAEIIWQGNEIIVKKKRVRIAKKDVDQHSRKEEDTERPTSNPLPPQSE 168

Query: 78  AFADHQ----NAQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQRCSRVHFYPNKS 133
           AF+DH     ++QQ    V++Q+PNFGTE DK HCP H+KTGACRFGQRCSRVHFYP+KS
Sbjct: 169 AFSDHNASIISSQQLFADVSEQIPNFGTEQDKDHCPFHIKTGACRFGQRCSRVHFYPDKS 228

Query: 134 CTLLIKNMYN 143
           CTLLIKNMYN
Sbjct: 229 CTLLIKNMYN 238

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|15218489|ref|NP_172503.1| zinc finger CCCH domain-containing protein 5 [Arabidopsis thaliana] gi|229621703|sp|Q9SY74.2|C3H5_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 5; Short=AtC3H5 gi|332190444|gb|AEE28565.1| zinc finger CCCH domain-containing protein 5 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225465261|ref|XP_002268270.1| PREDICTED: uncharacterized protein LOC100247160 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255573856|ref|XP_002527847.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis] gi|223532771|gb|EEF34550.1| U2 snrnp auxiliary factor, small subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297849356|ref|XP_002892559.1| hypothetical protein ARALYDRAFT_471143 [Arabidopsis lyrata subsp. lyrata] gi|297338401|gb|EFH68818.1| hypothetical protein ARALYDRAFT_471143 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449432946|ref|XP_004134259.1| PREDICTED: uncharacterized protein LOC101216050 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449478305|ref|XP_004155279.1| PREDICTED: zinc finger CCCH domain-containing protein 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359392832|gb|AEV45823.1| rough endosperm 3-umu1 alpha isoform [Zea mays] Back     alignment and taxonomy information
>gi|359392870|gb|AEV45842.1| rough endosperm 3 epsilon isoform [Zea mays] Back     alignment and taxonomy information
>gi|359392834|gb|AEV45824.1| rough endosperm 3-umu1 gamma isoform [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
TAIR|locus:2012843 757 AT1G10320 [Arabidopsis thalian 0.752 0.200 0.570 5e-41
TAIR|locus:2102038359 AT3G53140 [Arabidopsis thalian 0.277 0.155 0.767 1e-20
UNIPROTKB|F1NHR6 459 ZRSR2 "Uncharacterized protein 0.222 0.098 0.6 4.2e-13
ZFIN|ZDB-GENE-030131-1495 635 zrsr2 "zinc finger (CCCH type) 0.237 0.075 0.612 6.8e-12
UNIPROTKB|I3LMZ7 385 LOC100624937 "Uncharacterized 0.410 0.215 0.406 4e-10
TAIR|locus:2165447 283 U2AF35B [Arabidopsis thaliana 0.217 0.155 0.590 6.4e-10
TAIR|locus:2196929 296 ATU2AF35A [Arabidopsis thalian 0.217 0.148 0.590 7.3e-10
UNIPROTKB|F1PIC2 455 F1PIC2 "Uncharacterized protei 0.202 0.090 0.634 1.2e-09
POMBASE|SPAP8A3.06 216 SPAP8A3.06 "U2AF small subunit 0.217 0.203 0.568 1.4e-09
UNIPROTKB|G3MYL6 439 ZRSR2Y "Uncharacterized protei 0.202 0.093 0.634 1.4e-09
TAIR|locus:2012843 AT1G10320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 442 (160.7 bits), Expect = 5.0e-41, P = 5.0e-41
 Identities = 97/170 (57%), Positives = 112/170 (65%)

Query:    16 NECDEDDD--WESVEEGPAEIIWQGNEXXXXXXXX-----XXXXXDANPLSKKEDV---- 64
             +EC ED+D  +E +EEGP EII+QGNE                  D +  S  E V    
Sbjct:   140 DECGEDEDGEYEYIEEGPPEIIFQGNEIILKKNKVRVPKKSVVQVDGHESSNAEFVLQIS 199

Query:    65 DRPTSNPLPPQSEAFADHQN---AQQALETVAQQVPNFGTEHDKAHCPLHLKTGACRFGQ 121
             DRPTSNPLPP SEA A++QN   AQQ LE+VAQ+VPNFGTE DKAHCP HLKTGACRFGQ
Sbjct:   200 DRPTSNPLPPGSEASANYQNVSSAQQILESVAQEVPNFGTEQDKAHCPFHLKTGACRFGQ 259

Query:   122 RCSRVHFYPNKSCTLLIKNMYNVK-FQWVLTT---WTDDECKLIMENCYK 167
             RCSRVHFYPNKSCTLL+KNMYN     W       +TD+E +L  E  Y+
Sbjct:   260 RCSRVHFYPNKSCTLLMKNMYNGPGITWEQDEGLEYTDEEAELCYEEFYE 309
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2102038 AT3G53140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHR6 ZRSR2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1495 zrsr2 "zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LMZ7 LOC100624937 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2165447 U2AF35B [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196929 ATU2AF35A [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIC2 F1PIC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
POMBASE|SPAP8A3.06 SPAP8A3.06 "U2AF small subunit, U2AF-23" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYL6 ZRSR2Y "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035343001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (333 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
pfam00891239 pfam00891, Methyltransf_2, O-methyltransferase 8e-12
>gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase Back     alignment and domain information 
 Score = 61.9 bits (151), Expect = 8e-12
 Identities = 24/51 (47%), Positives = 35/51 (68%)

Query: 146 FQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALL 196
            +WVL  W+D++C  I++ CY+ALP GGK+I  E VLP+D ++   T  LL
Sbjct: 165 LKWVLHDWSDEDCVKILKRCYEALPPGGKVIVVEMVLPEDPDDDLETEVLL 215

This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 99.82
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 99.67
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.44
KOG2202 260 consensus U2 snRNP splicing factor, small subunit, 98.83
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.04
PRK06922 677 hypothetical protein; Provisional 97.98
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 97.87
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.87
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.29
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 97.21
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 97.13
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.08
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 97.0
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 96.98
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 96.93
PLN02336 475 phosphoethanolamine N-methyltransferase 96.87
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 96.83
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 96.82
PLN03075296 nicotianamine synthase; Provisional 96.81
PRK11207197 tellurite resistance protein TehB; Provisional 96.78
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 96.74
PLN02233261 ubiquinone biosynthesis methyltransferase 96.66
TIGR03438 301 probable methyltransferase. This model represents 96.5
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 96.4
PLN02244340 tocopherol O-methyltransferase 96.36
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.35
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 96.35
PLN02490 340 MPBQ/MSBQ methyltransferase 96.3
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 96.26
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 96.24
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 96.19
PRK08317241 hypothetical protein; Provisional 96.11
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 96.04
PLN02336475 phosphoethanolamine N-methyltransferase 96.02
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 96.01
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 95.99
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 95.97
PRK04457262 spermidine synthase; Provisional 95.97
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 95.83
PRK12335287 tellurite resistance protein TehB; Provisional 95.83
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 95.81
TIGR00452314 methyltransferase, putative. Known examples to dat 95.66
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 95.64
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 95.4
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 95.21
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 95.19
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 95.1
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 95.01
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 95.01
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 94.75
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 94.63
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 94.58
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 94.52
PRK06202232 hypothetical protein; Provisional 94.34
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 94.29
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 94.22
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 94.22
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 93.88
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 93.79
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 93.59
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 93.41
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 92.81
PLN02232160 ubiquinone biosynthesis methyltransferase 92.56
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 92.16
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 91.88
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 91.68
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 91.3
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 91.27
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 91.16
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 91.16
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 90.59
PLN02366308 spermidine synthase 90.49
PRK10611287 chemotaxis methyltransferase CheR; Provisional 90.38
PRK04266226 fibrillarin; Provisional 90.29
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 89.65
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 89.5
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 89.42
PRK07402196 precorrin-6B methylase; Provisional 89.31
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 89.31
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 89.04
TIGR00536284 hemK_fam HemK family putative methylases. The gene 89.0
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 88.94
PRK00811283 spermidine synthase; Provisional 88.61
PRK14904445 16S rRNA methyltransferase B; Provisional 88.06
PRK14901434 16S rRNA methyltransferase B; Provisional 87.86
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 87.4
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 87.4
PRK10901427 16S rRNA methyltransferase B; Provisional 87.29
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 87.04
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 86.99
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 86.97
KOG2361264 consensus Predicted methyltransferase [General fun 86.28
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 86.27
PRK14902444 16S rRNA methyltransferase B; Provisional 86.21
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 85.73
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 85.7
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 85.49
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 85.02
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 84.83
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 84.72
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 84.35
PRK05785226 hypothetical protein; Provisional 83.74
PRK10258251 biotin biosynthesis protein BioC; Provisional 83.55
PRK14968188 putative methyltransferase; Provisional 82.63
KOG2899288 consensus Predicted methyltransferase [General fun 81.66
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 81.5
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 81.36
COG4798238 Predicted methyltransferase [General function pred 81.0
COG0421282 SpeE Spermidine synthase [Amino acid transport and 80.47
COG4123248 Predicted O-methyltransferase [General function pr 80.19
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information 
Probab=99.82  E-value=1.2e-20  Score=160.20  Aligned_cols=149  Identities=23%  Similarity=0.285  Sum_probs=108.6

Q ss_pred             CcccccccCcchhhccCCcEEEEecccccCCCCCCCCCCCCCCCCCCCCCCCCCCcceeecC-ChHHHHHHHHHHCCCC-
Q 044941           22 DDWESVEEGPAEIIWQGNEIIIRKKKVRVPKKDANPLSKKEDVDRPTSNPLPPQSEAFADHQ-NAQQALETVAQQVPNF-   99 (202)
Q Consensus        22 ~~we~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~d~~-g~G~ll~~ll~~~P~l-   99 (202)
                      +.|||+++.|+.      ...|...|........ ....  ...++|++.     ..++|+| |.|.++.+++++||++ 
T Consensus        61 ~~~~~~~~~~~~------~~~f~~~m~~~~~~~~-~~~~--~~~~d~~~~-----~~vvDvGGG~G~~~~~l~~~~P~l~  126 (241)
T PF00891_consen   61 PFFEYLEEDPEL------AKRFNAAMAEYSRLNA-FDIL--LEAFDFSGF-----KTVVDVGGGSGHFAIALARAYPNLR  126 (241)
T ss_dssp             -HHHHHHCSHHH------HHHHHHHHHHHHHHHH-HHHH--HHHSTTTTS-----SEEEEET-TTSHHHHHHHHHSTTSE
T ss_pred             cHHHhhhhChHH------HHHHHHHHHhhhhcch-hhhh--hccccccCc-----cEEEeccCcchHHHHHHHHHCCCCc
Confidence            489999998866      3345556653211111 0111  246788855     3699997 9999999999999997 


Q ss_pred             ----CccccccccchhhhccCCCCCCceeee--eec---CCCcceeeeehhcccccccccCCCCHHHHHHHHHHHHhhCC
Q 044941          100 ----GTEHDKAHCPLHLKTGACRFGQRCSRV--HFY---PNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALP  170 (202)
Q Consensus       100 ----dl~~d~~~~~~~~k~gacr~~dRcs~v--hff---P~~AD~ylLk~m~~~P~k~VLHdW~Dee~~~IL~~~~~AL~  170 (202)
                          |+|.+.+.+..         .+|++++  +||   |. +|+|+|++        |||+|+|++|++||++++.+|+
T Consensus       127 ~~v~Dlp~v~~~~~~---------~~rv~~~~gd~f~~~P~-~D~~~l~~--------vLh~~~d~~~~~iL~~~~~al~  188 (241)
T PF00891_consen  127 ATVFDLPEVIEQAKE---------ADRVEFVPGDFFDPLPV-ADVYLLRH--------VLHDWSDEDCVKILRNAAAALK  188 (241)
T ss_dssp             EEEEE-HHHHCCHHH---------TTTEEEEES-TTTCCSS-ESEEEEES--------SGGGS-HHHHHHHHHHHHHHSE
T ss_pred             ceeeccHhhhhcccc---------ccccccccccHHhhhcc-ccceeeeh--------hhhhcchHHHHHHHHHHHHHhC
Confidence                45555444443         6799999  576   78 99999999        8899999999999999999999


Q ss_pred             CC--CEEEEeeeccCCCCCchHHhhhhhhccccC
Q 044941          171 AG--GKLIACEPVLPDDSNESQRTRALLEGDILL  202 (202)
Q Consensus       171 ~g--GrLlI~E~vl~~~~~~~~~~~~~~~mDm~M  202 (202)
                      ||  |+|+|+|.++++.+...........+||.|
T Consensus       189 pg~~g~llI~e~~~~~~~~~~~~~~~~~~~dl~m  222 (241)
T PF00891_consen  189 PGKDGRLLIIEMVLPDDRTGPPSAEMDALFDLNM  222 (241)
T ss_dssp             ECTTEEEEEEEEEECSSSSSHHHHHHHHHHHHHH
T ss_pred             CCCCCeEEEEeeccCCCCCCchHHHHHHHHHHHH
Confidence            88  999999999999887644332334556554

The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. This domain includes a range of O-methyltransferases some of which utilise S-adenosyl methionine as substrate []. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. In eukaryotes, DNA methylation has been implicated in the control of several cellular processes, including differentiation, gene regulation, and embryonic development. O-methyltransferases have a common catalytic domain structure, which might be universal among S-adenosyl-L-methionine (AdoMet)-dependent methyltransferases []. Comparative analysis of the predicted amino acid sequences of a number of plant O-methyltransferase cDNA clones show that they share some 32-71% sequence identity, and can be grouped according to the different compounds they utilise as substrates [].; GO: 0008171 O-methyltransferase activity; PDB: 1FPQ_A 1FP1_D 3P9K_B 3P9I_D 3P9C_A 3I53_A 3I5U_A 3I64_A 3I58_A 1ZG3_A ....
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
1kyw_A365 Crystal Structure Analysis Of Caffeic Acid5-Hydroxy 7e-07
3reo_A368 Monolignol O-Methyltransferase (Momt) Length = 368 8e-07
3p9c_A364 Crystal Structure Of Perennial Ryegrass Lpomt1 Boun 1e-06
1fp1_D372 Crystal Structure Analysis Of Chalcone O-Methyltran 2e-04
1fpq_A372 Crystal Structure Analysis Of Selenomethionine Subs 2e-04
>pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 Back     alignment and structure 
Iteration: 1

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 36/59 (61%)
Query: 144 VKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDILL 202
           V  +W+   W+D+ C   ++NCY+ALP  GK+I  E +LP   + S  T+ ++  D+++
Sbjct: 262 VFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDVIM 320
>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 Back     alignment and structure
>pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 Back     alignment and structure
>pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Back     alignment and structure
>pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 4e-15
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 6e-15
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 7e-15
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 5e-14
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 1e-13
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 2e-13
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 3e-13
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 5e-13
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 1e-12
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 1e-12
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 1e-12
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 2e-12
2r3s_A335 Uncharacterized protein; methyltransferase domain, 3e-11
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 9e-11
3dp7_A363 SAM-dependent methyltransferase; structural genomi 6e-10
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
 Score = 71.4 bits (175), Expect = 4e-15
 Identities = 20/57 (35%), Positives = 34/57 (59%)

Query: 146 FQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDILL 202
            +W+   W+D+ C  +++NCY ALP  GK+I  E +LP   + S  T+ ++  D L+
Sbjct: 267 IKWICHDWSDEHCLKLLKNCYAALPDHGKVIVAEYILPPSPDPSIATKVVIHTDALM 323
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.74
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.48
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.44
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.39
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.37
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.32
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.31
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.27
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.27
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.15
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.12
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.11
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.07
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.05
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.03
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.98
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.18
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.07
3hnr_A220 Probable methyltransferase BT9727_4108; structural 97.71
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 97.66
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 97.64
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 97.55
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 97.52
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 97.51
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.5
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 97.45
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 97.43
3ocj_A305 Putative exported protein; structural genomics, PS 97.43
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.42
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.39
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 97.29
3f4k_A257 Putative methyltransferase; structural genomics, P 97.28
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 97.25
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 97.25
3lcc_A235 Putative methyl chloride transferase; halide methy 97.2
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 97.16
1vl5_A260 Unknown conserved protein BH2331; putative methylt 97.15
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 97.14
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 97.09
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 97.07
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 97.05
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 97.04
2p7i_A250 Hypothetical protein; putative methyltransferase, 96.98
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 96.95
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 96.94
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 96.93
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 96.9
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 96.88
1xxl_A239 YCGJ protein; structural genomics, protein structu 96.86
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 96.84
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 96.84
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 96.82
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 96.81
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 96.81
3m70_A286 Tellurite resistance protein TEHB homolog; structu 96.8
3dh0_A219 SAM dependent methyltransferase; cystal structure, 96.77
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 96.76
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.66
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 96.62
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 96.62
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 96.57
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 96.47
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.47
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 96.43
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 96.41
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 96.37
3i9f_A170 Putative type 11 methyltransferase; structural gen 96.32
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 96.31
3ege_A 261 Putative methyltransferase from antibiotic biosyn 96.2
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 96.14
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 95.96
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 95.95
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 95.93
2qm3_A373 Predicted methyltransferase; putative methyltransf 95.91
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 95.88
2kw5_A202 SLR1183 protein; structural genomics, northeast st 95.88
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 95.86
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 95.77
4hg2_A257 Methyltransferase type 11; structural genomics, PS 95.67
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 95.66
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 95.65
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 95.64
1wzn_A252 SAM-dependent methyltransferase; structural genomi 95.59
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 95.49
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 95.45
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 95.45
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 95.41
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 95.38
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 95.35
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 95.29
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 95.23
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 95.21
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 95.14
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 94.97
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 94.94
3duw_A223 OMT, O-methyltransferase, putative; alternating of 94.87
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 94.74
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 94.64
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 94.59
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 94.52
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 94.46
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 94.4
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 94.39
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 94.37
3lpm_A259 Putative methyltransferase; structural genomics, p 94.31
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 94.27
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 94.25
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 94.15
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 94.14
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 94.08
1vlm_A219 SAM-dependent methyltransferase; possible histamin 94.04
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 93.99
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 93.8
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 93.73
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 93.73
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 93.71
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 93.68
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 93.65
3cc8_A230 Putative methyltransferase; structural genomics, j 93.61
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 93.52
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 93.44
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 93.4
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 93.27
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 93.26
2b3t_A276 Protein methyltransferase HEMK; translation termin 93.24
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 93.21
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 93.21
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 93.13
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 92.91
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 92.79
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 92.78
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 92.76
2i7c_A283 Spermidine synthase; transferase, structural genom 92.7
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 92.61
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 92.54
1jsx_A207 Glucose-inhibited division protein B; methyltransf 92.47
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 92.47
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 92.41
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 92.3
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 92.28
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 92.2
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 92.05
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 91.96
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 91.93
3giw_A277 Protein of unknown function DUF574; rossmann-fold 91.89
2avd_A229 Catechol-O-methyltransferase; structural genomics, 91.84
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 91.84
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 91.83
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 91.81
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 91.76
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 91.7
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 91.68
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 91.61
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 91.51
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 91.38
2pt6_A321 Spermidine synthase; transferase, structural genom 91.27
3gjy_A317 Spermidine synthase; APC62791, structural genomics 91.12
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 91.01
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 90.96
1ws6_A171 Methyltransferase; structural genomics, riken stru 90.88
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 90.82
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 90.72
2frn_A278 Hypothetical protein PH0793; structural genomics, 90.69
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 90.66
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 90.6
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 90.43
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 90.23
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 90.2
2esr_A177 Methyltransferase; structural genomics, hypothetic 90.19
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 90.18
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 90.14
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 90.07
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 89.75
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 89.72
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 89.71
1xj5_A334 Spermidine synthase 1; structural genomics, protei 89.69
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 89.68
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 89.62
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 89.53
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 89.43
2o07_A304 Spermidine synthase; structural genomics, structur 89.37
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 89.3
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 89.23
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 89.21
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 88.9
1yb2_A275 Hypothetical protein TA0852; structural genomics, 88.89
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 88.63
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 88.47
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 88.24
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 88.12
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 88.09
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 87.99
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 87.64
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 87.41
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 87.26
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 86.69
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 86.33
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 86.33
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 86.27
1ne2_A200 Hypothetical protein TA1320; structural genomics, 85.86
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 85.81
2h00_A254 Methyltransferase 10 domain containing protein; st 85.67
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 85.59
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 85.5
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 85.49
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 85.03
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 84.72
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 83.76
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 83.63
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 81.67
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 81.47
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 81.39
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 80.62
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=99.74  E-value=1.7e-18  Score=153.51  Aligned_cols=144  Identities=15%  Similarity=0.208  Sum_probs=107.0

Q ss_pred             CCCCcccccccCcchhhccCCcEEEEecccccCCCCCCCCCCCCCCCCCCCCCCCCCCcceeecC-ChHHHHHHHHHHCC
Q 044941           19 DEDDDWESVEEGPAEIIWQGNEIIIRKKKVRVPKKDANPLSKKEDVDRPTSNPLPPQSEAFADHQ-NAQQALETVAQQVP   97 (202)
Q Consensus        19 ~~~~~we~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~d~~-g~G~ll~~ll~~~P   97 (202)
                      ...+.|+|+.++|++      ...|.+.|..+..  .....+  .+.++|+..     ..++|+| |.|.++.+++++||
T Consensus       138 ~~~~~~~~~~~~~~~------~~~f~~aM~~~~~--~~~~~~--~~~~~~~~~-----~~v~DvGgG~G~~~~~l~~~~p  202 (353)
T 4a6d_A          138 PAEELFTAIYRSEGE------RLQFMQALQEVWS--VNGRSV--LTAFDLSVF-----PLMCDLGGGAGALAKECMSLYP  202 (353)
T ss_dssp             CCSSHHHHHTSSHHH------HHHHHHHHHTTHH--HHHHHH--HHSSCGGGC-----SEEEEETCTTSHHHHHHHHHCS
T ss_pred             ChHHHHHHHhhCHHH------HHHHHHHHHHHHH--HHHHHH--HHhcCcccC-----CeEEeeCCCCCHHHHHHHHhCC
Confidence            445789999988877      3345566653211  000111  235567643     3699997 99999999999999


Q ss_pred             CC-----CccccccccchhhhccCCCCCCceeee--eec---CCCcceeeeehhcccccccccCCCCHHHHHHHHHHHHh
Q 044941           98 NF-----GTEHDKAHCPLHLKTGACRFGQRCSRV--HFY---PNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYK  167 (202)
Q Consensus        98 ~l-----dl~~d~~~~~~~~k~gacr~~dRcs~v--hff---P~~AD~ylLk~m~~~P~k~VLHdW~Dee~~~IL~~~~~  167 (202)
                      ++     |+|.+.+.++.....   ...+||+++  |||   +.++|+|++++        |||+|+|++|.+||++|++
T Consensus       203 ~~~~~~~dlp~v~~~a~~~~~~---~~~~rv~~~~gD~~~~~~~~~D~~~~~~--------vlh~~~d~~~~~iL~~~~~  271 (353)
T 4a6d_A          203 GCKITVFDIPEVVWTAKQHFSF---QEEEQIDFQEGDFFKDPLPEADLYILAR--------VLHDWADGKCSHLLERIYH  271 (353)
T ss_dssp             SCEEEEEECHHHHHHHHHHSCC-----CCSEEEEESCTTTSCCCCCSEEEEES--------SGGGSCHHHHHHHHHHHHH
T ss_pred             CceeEeccCHHHHHHHHHhhhh---cccCceeeecCccccCCCCCceEEEeee--------ecccCCHHHHHHHHHHHHh
Confidence            96     555555555554432   347899999  677   35699999999        8999999999999999999


Q ss_pred             hCCCCCEEEEeeeccCCCCCc
Q 044941          168 ALPAGGKLIACEPVLPDDSNE  188 (202)
Q Consensus       168 AL~~gGrLlI~E~vl~~~~~~  188 (202)
                      +|+|||+|+|+|.++++++..
T Consensus       272 al~pgg~lli~e~~~~~~~~~  292 (353)
T 4a6d_A          272 TCKPGGGILVIESLLDEDRRG  292 (353)
T ss_dssp             HCCTTCEEEEEECCCCTTSCC
T ss_pred             hCCCCCEEEEEEeeeCCCCCC
Confidence            999999999999999987653
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d1fp1d2244 c.66.1.12 (D:129-372) Chalcone O-methyltransferase 7e-10
d1fp2a2244 c.66.1.12 (A:109-352) Isoflavone O-methyltransfera 1e-07
d1kyza2243 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli 8e-05
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Chalcone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

 Score = 54.7 bits (131), Expect = 7e-10
 Identities = 19/65 (29%), Positives = 36/65 (55%)

Query: 138 IKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLE 197
           +     +  + V   W+D++C   + NC+KAL   GK+I  E +LP++ N S+ ++ +  
Sbjct: 137 VPQGDAMILKAVCHNWSDEKCIEFLSNCHKALSPNGKVIIVEFILPEEPNTSEESKLVST 196

Query: 198 GDILL 202
            D L+
Sbjct: 197 LDNLM 201
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.78
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.78
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.75
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.74
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.66
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.11
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.89
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 97.8
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.78
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.39
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 97.31
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.24
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.14
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.09
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 97.02
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 96.96
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 96.51
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.34
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 96.03
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 96.02
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 95.93
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 95.88
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 95.68
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 95.65
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 94.94
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 94.78
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 94.73
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 94.65
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 94.63
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 94.62
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 94.59
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 94.17
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 93.95
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 93.82
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 93.1
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 93.06
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 92.95
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 91.97
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 91.38
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 90.05
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 89.91
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 88.2
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 88.14
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 87.37
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 86.22
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 85.35
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 85.13
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 85.02
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 81.31
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 81.12
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 80.15
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 80.01
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Isoflavone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

Probab=99.78  E-value=1.1e-19  Score=153.31  Aligned_cols=154  Identities=18%  Similarity=0.311  Sum_probs=110.4

Q ss_pred             CcccccccCcchhhccCCcEEEEecccccCCCCCCCCCCCCCCCCCCCCCCCCCCcceeecC-ChHHHHHHHHHHCCCC-
Q 044941           22 DDWESVEEGPAEIIWQGNEIIIRKKKVRVPKKDANPLSKKEDVDRPTSNPLPPQSEAFADHQ-NAQQALETVAQQVPNF-   99 (202)
Q Consensus        22 ~~we~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~d~~-g~G~ll~~ll~~~P~l-   99 (202)
                      +.|||++++|+.      -..|...|.......  .....+ ..++|+.     ..+++|+| |+|.++.+++++||++ 
T Consensus        41 ~~~e~l~~~pe~------~~~F~~aM~~~s~~~--~~~~~~-~~~~~~~-----~~~vvDvGGG~G~~~~~l~~~~P~l~  106 (244)
T d1fp2a2          41 GFWDFLDKNPEY------NTSFNDAMASDSKLI--NLALRD-CDFVFDG-----LESIVDVGGGTGTTAKIICETFPKLK  106 (244)
T ss_dssp             CHHHHHHHCHHH------HHHHHHHHHHTHHHH--HHHHHT-CHHHHTT-----CSEEEEETCTTSHHHHHHHHHCTTCE
T ss_pred             CHHHHHHhCHHH------HHHHHHHhhhhhhhh--hhhHhh-hcccccC-----ceEEEEecCCccHHHHHHHHhCCCCe
Confidence            689999999887      334666665431110  011111 1234442     35799997 9999999999999997 


Q ss_pred             CccccccccchhhhccCCCCCCceeee--eec--CCCcceeeeehhcccccccccCCCCHHHHHHHHHHHHhhCCCC---
Q 044941          100 GTEHDKAHCPLHLKTGACRFGQRCSRV--HFY--PNKSCTLLIKNMYNVKFQWVLTTWTDDECKLIMENCYKALPAG---  172 (202)
Q Consensus       100 dl~~d~~~~~~~~k~gacr~~dRcs~v--hff--P~~AD~ylLk~m~~~P~k~VLHdW~Dee~~~IL~~~~~AL~~g---  172 (202)
                      .+.+|++....   .  .+..+||+++  |||  +.++|+|++++        |||||+|++|++||++|++||+||   
T Consensus       107 ~~v~Dlp~vi~---~--~~~~~rv~~~~gD~f~~~p~aD~~~l~~--------vLHdw~d~~~~~iL~~~~~al~pgg~~  173 (244)
T d1fp2a2         107 CIVFDRPQVVE---N--LSGSNNLTYVGGDMFTSIPNADAVLLKY--------ILHNWTDKDCLRILKKCKEAVTNDGKR  173 (244)
T ss_dssp             EEEEECHHHHT---T--CCCBTTEEEEECCTTTCCCCCSEEEEES--------CGGGSCHHHHHHHHHHHHHHHSGGGCC
T ss_pred             EEEecCHHHHH---h--CcccCceEEEecCcccCCCCCcEEEEEe--------ecccCChHHHHHHHHHHHHHcCcccCC
Confidence            34455443221   1  1456899999  577  34699999999        889999999999999999999997   


Q ss_pred             CEEEEeeeccCCCCCchHHhhhhhhccccC
Q 044941          173 GKLIACEPVLPDDSNESQRTRALLEGDILL  202 (202)
Q Consensus       173 GrLlI~E~vl~~~~~~~~~~~~~~~mDm~M  202 (202)
                      |+|+|+|.++++.+...+.......|||+|
T Consensus       174 ~~lli~e~~~~~~~~~~~~~~~~~~~dl~m  203 (244)
T d1fp2a2         174 GKVTIIDMVIDKKKDENQVTQIKLLMDVNM  203 (244)
T ss_dssp             CEEEEEECEECTTTSCHHHHHHHHHHHHHG
T ss_pred             cEEEEEEeecCCCCCCchHHHHHHHHHHHH
Confidence            899999999998877644444444566654
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure