Citrus Sinensis ID: 045006
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 167 | ||||||
| 224113213 | 687 | predicted protein [Populus trichocarpa] | 0.748 | 0.181 | 0.417 | 1e-10 | |
| 307135796 | 1393 | TIR-NBS-LRR disease resistance protein [ | 0.694 | 0.083 | 0.375 | 3e-10 | |
| 224284598 | 1071 | unknown [Picea sitchensis] | 0.473 | 0.073 | 0.441 | 8e-09 | |
| 224094841 | 491 | predicted protein [Populus trichocarpa] | 0.700 | 0.238 | 0.381 | 9e-09 | |
| 255556649 | 1108 | leucine-rich repeat-containing protein, | 0.688 | 0.103 | 0.374 | 1e-08 | |
| 359493227 | 1536 | PREDICTED: TMV resistance protein N-like | 0.766 | 0.083 | 0.333 | 3e-08 | |
| 147799119 | 1520 | hypothetical protein VITISV_024719 [Viti | 0.766 | 0.084 | 0.333 | 3e-08 | |
| 298205188 | 1027 | unnamed protein product [Vitis vinifera] | 0.479 | 0.077 | 0.387 | 3e-08 | |
| 296081088 | 744 | unnamed protein product [Vitis vinifera] | 0.766 | 0.172 | 0.333 | 3e-08 | |
| 21655201 | 416 | NBS [Pinus taeda] | 0.748 | 0.300 | 0.34 | 4e-08 |
| >gi|224113213|ref|XP_002332638.1| predicted protein [Populus trichocarpa] gi|222832865|gb|EEE71342.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 71.2 bits (173), Expect = 1e-10, Method: Compositional matrix adjust.
Identities = 61/146 (41%), Positives = 72/146 (49%), Gaps = 21/146 (14%)
Query: 2 LNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRVLIRC-------GCKRLKSL 54
L+L GC L SLP I L+ LK LN SGCS+L LP S +++C GC RL SL
Sbjct: 96 LDLSGCSSLTSLPNNIDALKSLKSLNLSGCSRLASLPNSIGVLKCLDQLDLSGCSRLASL 155
Query: 55 PSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWLL---AH 111
P SI LK L+ LNL G S L LP N RL S P L+ L H
Sbjct: 156 PDSIGALKCLKSLNLSGCSRLASLP----------NSIGRLASLPDSIGELKCLKLLNLH 205
Query: 112 RCTALESGLIFSISYESPLRHFDLSG 137
C+ L S L +I L+ DLSG
Sbjct: 206 GCSGLAS-LPDNIGELKSLKSLDLSG 230
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|307135796|gb|ADN33675.1| TIR-NBS-LRR disease resistance protein [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|224284598|gb|ACN40032.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|224094841|ref|XP_002334784.1| predicted protein [Populus trichocarpa] gi|222874625|gb|EEF11756.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255556649|ref|XP_002519358.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223541425|gb|EEF42975.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359493227|ref|XP_002264747.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147799119|emb|CAN61627.1| hypothetical protein VITISV_024719 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|298205188|emb|CBI17247.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296081088|emb|CBI18282.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|21655201|gb|AAM28915.1| NBS [Pinus taeda] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 167 | ||||||
| TAIR|locus:2118106 | 1219 | AT4G12010 [Arabidopsis thalian | 0.485 | 0.066 | 0.387 | 2.4e-12 | |
| TAIR|locus:2094498 | 1981 | AT3G25510 [Arabidopsis thalian | 0.694 | 0.058 | 0.338 | 2.3e-06 | |
| TAIR|locus:2153207 | 1165 | AT5G45060 [Arabidopsis thalian | 0.676 | 0.096 | 0.338 | 1.7e-09 | |
| TAIR|locus:2170333 | 1197 | CSA1 "constitutive shade-avoid | 0.784 | 0.109 | 0.315 | 2.2e-09 | |
| TAIR|locus:2827629 | 1355 | AT2G17050 [Arabidopsis thalian | 0.562 | 0.069 | 0.323 | 3.8e-09 | |
| TAIR|locus:2076043 | 1194 | RPP1 "recognition of peronospo | 0.796 | 0.111 | 0.351 | 7.4e-09 | |
| TAIR|locus:2153328 | 1231 | AT5G45230 [Arabidopsis thalian | 0.700 | 0.095 | 0.362 | 2.6e-08 | |
| TAIR|locus:2133662 | 853 | AT4G09360 [Arabidopsis thalian | 0.838 | 0.164 | 0.335 | 9.4e-08 | |
| TAIR|locus:2081810 | 1226 | AT3G51570 [Arabidopsis thalian | 0.700 | 0.095 | 0.344 | 1.5e-07 | |
| TAIR|locus:2163426 | 1187 | TAO1 "target of AVRB operation | 0.628 | 0.088 | 0.348 | 1.8e-07 |
| TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 119 (46.9 bits), Expect = 2.4e-12, Sum P(2) = 2.4e-12
Identities = 36/93 (38%), Positives = 50/93 (53%)
Query: 30 GCSKLKRLPESRVLIRCGCKRLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNK-- 87
GCS+L L L RC L LP +I L LQ L L G+ N+ LP+ + N
Sbjct: 853 GCSRLTDL----YLSRCS---LYKLPDNIGGLSSLQSLCLSGN-NIENLPESFNQLNNLK 904
Query: 88 --NLNYSERLQSRPKLPSNLEWLLAHRCTALES 118
+L + + L+S P LP NL++L AH C +LE+
Sbjct: 905 WFDLKFCKMLKSLPVLPQNLQYLDAHECESLET 937
|
|
| TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2076043 RPP1 "recognition of peronospora parasitica 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133662 AT4G09360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00038688001 | SubName- Full=Chromosome chr18 scaffold_96, whole genome shotgun sequence; (430 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 167 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 3e-05 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 42.9 bits (101), Expect = 3e-05
Identities = 31/86 (36%), Positives = 42/86 (48%), Gaps = 9/86 (10%)
Query: 2 LNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPES-------RVLIRCGCKRLKSL 54
++L G + LK +P ++ + L+ L S CS L LP S L C+ L+ L
Sbjct: 639 IDLRGSKNLKEIP-DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEIL 697
Query: 55 PSSICQLKPLQVLNLHGSSNLHRLPD 80
P+ I LK L LNL G S L PD
Sbjct: 698 PTGI-NLKSLYRLNLSGCSRLKSFPD 722
|
syringae 6; Provisional. Length = 1153 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 167 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.46 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.41 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.02 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.01 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.72 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.61 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.53 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.46 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.45 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.44 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.42 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.39 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.35 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 98.21 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.19 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.02 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 97.84 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.81 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 97.81 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.7 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.62 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.61 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.59 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.58 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.5 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.47 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 97.42 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.33 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.31 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.31 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.22 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.21 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.93 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.87 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.66 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 96.55 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.32 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 95.98 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 95.44 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 95.41 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.11 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.88 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 94.78 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 94.4 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 94.23 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 94.07 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.04 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 94.0 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 93.33 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 92.68 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 92.44 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 92.36 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 90.45 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 89.7 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 88.87 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 88.49 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 88.49 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 88.39 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 88.35 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 88.22 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 87.03 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 86.5 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 86.3 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 81.65 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=99.46 E-value=2.7e-13 Score=121.36 Aligned_cols=95 Identities=29% Similarity=0.353 Sum_probs=61.8
Q ss_pred CCccCCccCCCCCCCCeeeecCCCCCccCCCCC---ccCccccccccccccCCCC-----------------------cc
Q 045006 50 RLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEH---SIPNKNLNYSERLQSRPKL-----------------------PS 103 (167)
Q Consensus 50 ~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~~---~L~~l~l~~c~~l~~l~~~-----------------------~~ 103 (167)
.+..+|.+++++++|+.|++++|+.++.+|... +|+.|++++|..++.+|.. ++
T Consensus 790 ~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~ 869 (1153)
T PLN03210 790 SLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFS 869 (1153)
T ss_pred CccccChhhhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCccccccccccccCEeECCCCCCccChHHHhcCC
Confidence 344456666677778888888887777777653 6677777777766655532 23
Q ss_pred ccccccccCCccchhccccccccCCCccEEeecCCCCCCHHH
Q 045006 104 NLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNE 145 (167)
Q Consensus 104 ~L~~L~l~~c~~L~~~~~~~~~~~~~l~~l~~~~C~~l~~~~ 145 (167)
+|+.|++.+|.+|+.++..... ...++.+++.+|.+|+...
T Consensus 870 ~L~~L~L~~C~~L~~l~~~~~~-L~~L~~L~l~~C~~L~~~~ 910 (1153)
T PLN03210 870 NLSFLDMNGCNNLQRVSLNISK-LKHLETVDFSDCGALTEAS 910 (1153)
T ss_pred CCCEEECCCCCCcCccCccccc-ccCCCeeecCCCccccccc
Confidence 5666667777777776332222 2457778888888886543
|
syringae 6; Provisional |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 167 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-12 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-11 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-10 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-07 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 6e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 6e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-04 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
Score = 61.1 bits (149), Expect = 6e-12
Identities = 27/87 (31%), Positives = 35/87 (40%), Gaps = 9/87 (10%)
Query: 2 LNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPES-------RVLIRCGCKRLKSL 54
L L ++SLPA I L+ LK L L L + L GC L++
Sbjct: 188 LRLEWTG-IRSLPASIANLQNLKSLKIRNS-PLSALGPAIHHLPKLEELDLRGCTALRNY 245
Query: 55 PSSICQLKPLQVLNLHGSSNLHRLPDE 81
P PL+ L L SNL LP +
Sbjct: 246 PPIFGGRAPLKRLILKDCSNLLTLPLD 272
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 167 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.48 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.38 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.14 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.11 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.11 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.11 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.1 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.1 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.08 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.03 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.03 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.03 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.02 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.01 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.01 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.0 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.0 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.0 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.99 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.98 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.98 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.98 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.97 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.96 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.95 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.93 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.93 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.92 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.91 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.91 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.91 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.91 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.91 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.91 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.91 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.9 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.89 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.88 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.88 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.88 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.87 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.87 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.87 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.87 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.87 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.86 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.86 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.86 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.86 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.85 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.84 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.83 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.83 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.83 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.81 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.81 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.81 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.8 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.8 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.8 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.79 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.78 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.77 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.77 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.77 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.77 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.77 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.76 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.75 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.75 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.75 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.75 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.74 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.74 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.73 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.72 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.72 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.72 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.71 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.71 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.7 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.7 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.69 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.69 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.69 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.69 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.68 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.68 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.67 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.67 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.66 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.66 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.66 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.65 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.64 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.63 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.63 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.62 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.62 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.62 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.61 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.57 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.56 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.55 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.55 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.54 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.53 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.52 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.52 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.52 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.51 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.51 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.5 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.5 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.49 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.45 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.42 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.4 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.38 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.38 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.32 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.3 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.28 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.13 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.08 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.03 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.96 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.94 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.92 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.88 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.86 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.83 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.78 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.74 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.72 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.6 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.57 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.46 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.35 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.57 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.48 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.09 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 95.28 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.18 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 94.68 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 94.66 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 94.4 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 94.07 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 93.88 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 93.7 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 92.66 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 92.49 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 92.32 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 90.8 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 90.37 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 87.15 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 85.8 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 83.37 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=99.48 E-value=1.6e-13 Score=106.26 Aligned_cols=139 Identities=29% Similarity=0.398 Sum_probs=92.8
Q ss_pred EeecCCCCCCccCcccCCCCCCCEEeccCCCCCccCCCCce----------------EEecCCCCCccCCccCCCCCCCC
Q 045006 2 LNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRV----------------LIRCGCKRLKSLPSSICQLKPLQ 65 (167)
Q Consensus 2 L~l~~c~~l~~lp~~~~~l~~L~~L~ls~c~~l~~lp~~~~----------------L~l~~c~~l~~lp~~l~~l~~L~ 65 (167)
|++++| .++.+|..++.+++|++|++++|..++.+|..+. |++++| .++.+|..++++++|+
T Consensus 132 L~Ls~n-~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n-~l~~lp~~l~~l~~L~ 209 (328)
T 4fcg_A 132 LTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWT-GIRSLPASIANLQNLK 209 (328)
T ss_dssp EEEESC-CCCCCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEE-CCCCCCGGGGGCTTCC
T ss_pred EECCCC-ccccCcHHHhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCC-CcCcchHhhcCCCCCC
Confidence 556655 3446666666666666666666666666665431 666663 4456777777777788
Q ss_pred eeeecCCCCCccCCCCC----ccCccccccccccccCCCC---ccccccccccCCccchhccccccccCCCccEEeecCC
Q 045006 66 VLNLHGSSNLHRLPDEH----SIPNKNLNYSERLQSRPKL---PSNLEWLLAHRCTALESGLIFSISYESPLRHFDLSGD 138 (167)
Q Consensus 66 ~L~l~~c~~l~~lp~~~----~L~~l~l~~c~~l~~l~~~---~~~L~~L~l~~c~~L~~~~~~~~~~~~~l~~l~~~~C 138 (167)
+|++++| .+..+|... +|+.|++++|...+.+|.. +++|+.|++++|..+..++.... ..+.++.|++++|
T Consensus 210 ~L~L~~N-~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~-~l~~L~~L~L~~n 287 (328)
T 4fcg_A 210 SLKIRNS-PLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIH-RLTQLEKLDLRGC 287 (328)
T ss_dssp EEEEESS-CCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGG-GCTTCCEEECTTC
T ss_pred EEEccCC-CCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhh-cCCCCCEEeCCCC
Confidence 8888774 455555432 7777888888888887764 46788888988877766644432 2346888999999
Q ss_pred CCCCHH
Q 045006 139 FKLDRN 144 (167)
Q Consensus 139 ~~l~~~ 144 (167)
+.+...
T Consensus 288 ~~~~~i 293 (328)
T 4fcg_A 288 VNLSRL 293 (328)
T ss_dssp TTCCCC
T ss_pred Cchhhc
Confidence 877654
|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 167 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.94 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.93 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.9 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.79 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.77 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.75 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.69 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.65 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.63 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.6 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.59 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.58 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.57 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.56 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.55 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.5 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.5 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.47 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.45 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.41 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.41 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.36 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.35 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.29 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.28 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.25 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.21 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.08 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.99 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.99 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.97 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.53 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 95.26 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.12 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 94.18 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 91.33 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 91.29 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 88.79 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 80.36 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.94 E-value=1.1e-11 Score=92.33 Aligned_cols=129 Identities=19% Similarity=0.195 Sum_probs=58.0
Q ss_pred cCCCCCCCEEeccCCCCCccCCC------Cce-EEecCCCCCcc--CCccCCCCCCCCeeeecCCCCCccC--C----C-
Q 045006 17 IFLLELLKKLNFSGCSKLKRLPE------SRV-LIRCGCKRLKS--LPSSICQLKPLQVLNLHGSSNLHRL--P----D- 80 (167)
Q Consensus 17 ~~~l~~L~~L~ls~c~~l~~lp~------~~~-L~l~~c~~l~~--lp~~l~~l~~L~~L~l~~c~~l~~l--p----~- 80 (167)
+..+++|++|++++|..-...+. .+. |++++|..++. +..-..++++|++|++++|..+.+- . .
T Consensus 67 ~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~ 146 (284)
T d2astb2 67 LSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHV 146 (284)
T ss_dssp HTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHS
T ss_pred HHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhccc
Confidence 45566666666666532211111 122 66666655542 1222234566666666666544210 0 0
Q ss_pred CCccCcccccccc-ccc-----cCCCCccccccccccCCccchhc-cccccccCCCccEEeecCCCCCCHHHH
Q 045006 81 EHSIPNKNLNYSE-RLQ-----SRPKLPSNLEWLLAHRCTALESG-LIFSISYESPLRHFDLSGDFKLDRNEV 146 (167)
Q Consensus 81 ~~~L~~l~l~~c~-~l~-----~l~~~~~~L~~L~l~~c~~L~~~-~~~~~~~~~~l~~l~~~~C~~l~~~~~ 146 (167)
...|+.+.+++|. .++ .+....++|+.|++++|..+++. +.... ..+.+++|++++|..+++...
T Consensus 147 ~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~-~~~~L~~L~L~~C~~i~~~~l 218 (284)
T d2astb2 147 SETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-QLNYLQHLSLSRCYDIIPETL 218 (284)
T ss_dssp CTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTCTTCCGGGG
T ss_pred ccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhc-ccCcCCEEECCCCCCCChHHH
Confidence 0134555555442 111 11112345555666555555544 22221 223455566666655555443
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|