Citrus Sinensis ID: 045006

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MLNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRVLIRCGCKRLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNEVRGIVEDALQDMQLLAAARWKQ
cEEEccccccccccccccccccccEEEcccccccccccccHHHHHccccccccccccccccccccEEEEccccccccccccccccEEEccccccccccccccccHHHccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHcccccccccccc
ccccccccHHHHcccccccHHHccEEcccccccHcccccccEEEcccccHHHHcccHHccHHHccEEcccccccHccccccccccEEEcccccHHHccccccccccEEEccccccccccccccccccccccEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccc
mlnlggceilkSLPAEIFLLELLKKLnfsgcsklkrlpesrvlIRCGckrlkslpssicqlkplqvlnlhgssnlhrlpdehsipnknlnyserlqsrpklpsNLEWLLAHRCTALESGLIFSisyesplrhfdlsgdfkldrnevRGIVEDALQDMQLLAAARWKQ
mlnlggceiLKSLPAEIFLLELLKKLNfsgcsklkrlpesrvLIRCGCKRLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNEVRGIVEDALQDMQLLAAARWKQ
MLNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRVLIRCGCKRLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNEVRGIVEdalqdmqllaaaRWKQ
***LGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRVLIRCGCKRLKSLPSSICQLKPLQVLNLH*********************************NLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNEVRGIVEDALQDMQLLAA*****
MLNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRVLIRCGCKRLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNEVRGIVEDALQDMQLLAA*****
MLNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRVLIRCGCKRLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNEVRGIVEDALQDMQLLAAARWKQ
MLNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRVLIRCGCKRLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNEVRGIVEDALQDMQLLAA*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiii
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRVLIRCGCKRLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNEVRGIVEDALQDMQLLAAARWKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
Q9FKZ0815 Probable disease resistan no no 0.718 0.147 0.307 0.0003
>sp|Q9FKZ0|DRL43_ARATH Probable disease resistance protein At5g66910 OS=Arabidopsis thaliana GN=At5g66910 PE=2 SV=1 Back     alignment and function desciption
 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 64/130 (49%), Gaps = 10/130 (7%)

Query: 2   LNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPES-------RVLIRCGCKRLKSL 54
           +++  C  L  LP  I  +  LK L+ + C+KL +LPE+        VL  C C  L  L
Sbjct: 660 IDIDYCYDLDELPYWIPEVVSLKTLSITNCNKLSQLPEAIGNLSRLEVLRMCSCMNLSEL 719

Query: 55  PSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWL--LAHR 112
           P +  +L  L+ L++     L +LP E     K  N S R  S  +LP ++ +L  L  +
Sbjct: 720 PEATERLSNLRSLDISHCLGLRKLPQEIGKLQKLENISMRKCSGCELPDSVRYLENLEVK 779

Query: 113 CTALESGLIF 122
           C  + +GL++
Sbjct: 780 CDEV-TGLLW 788
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
224113213 687 predicted protein [Populus trichocarpa] 0.748 0.181 0.417 1e-10
307135796 1393 TIR-NBS-LRR disease resistance protein [ 0.694 0.083 0.375 3e-10
224284598 1071 unknown [Picea sitchensis] 0.473 0.073 0.441 8e-09
224094841 491 predicted protein [Populus trichocarpa] 0.700 0.238 0.381 9e-09
255556649 1108 leucine-rich repeat-containing protein, 0.688 0.103 0.374 1e-08
359493227 1536 PREDICTED: TMV resistance protein N-like 0.766 0.083 0.333 3e-08
147799119 1520 hypothetical protein VITISV_024719 [Viti 0.766 0.084 0.333 3e-08
298205188 1027 unnamed protein product [Vitis vinifera] 0.479 0.077 0.387 3e-08
296081088 744 unnamed protein product [Vitis vinifera] 0.766 0.172 0.333 3e-08
21655201 416 NBS [Pinus taeda] 0.748 0.300 0.34 4e-08
>gi|224113213|ref|XP_002332638.1| predicted protein [Populus trichocarpa] gi|222832865|gb|EEE71342.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 72/146 (49%), Gaps = 21/146 (14%)

Query: 2   LNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRVLIRC-------GCKRLKSL 54
           L+L GC  L SLP  I  L+ LK LN SGCS+L  LP S  +++C       GC RL SL
Sbjct: 96  LDLSGCSSLTSLPNNIDALKSLKSLNLSGCSRLASLPNSIGVLKCLDQLDLSGCSRLASL 155

Query: 55  PSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNKNLNYSERLQSRPKLPSNLEWLL---AH 111
           P SI  LK L+ LNL G S L  LP          N   RL S P     L+ L     H
Sbjct: 156 PDSIGALKCLKSLNLSGCSRLASLP----------NSIGRLASLPDSIGELKCLKLLNLH 205

Query: 112 RCTALESGLIFSISYESPLRHFDLSG 137
            C+ L S L  +I     L+  DLSG
Sbjct: 206 GCSGLAS-LPDNIGELKSLKSLDLSG 230

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|307135796|gb|ADN33675.1| TIR-NBS-LRR disease resistance protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|224284598|gb|ACN40032.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|224094841|ref|XP_002334784.1| predicted protein [Populus trichocarpa] gi|222874625|gb|EEF11756.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255556649|ref|XP_002519358.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223541425|gb|EEF42975.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359493227|ref|XP_002264747.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147799119|emb|CAN61627.1| hypothetical protein VITISV_024719 [Vitis vinifera] Back     alignment and taxonomy information
>gi|298205188|emb|CBI17247.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081088|emb|CBI18282.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|21655201|gb|AAM28915.1| NBS [Pinus taeda] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.485 0.066 0.387 2.4e-12
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.694 0.058 0.338 2.3e-06
TAIR|locus:2153207 1165 AT5G45060 [Arabidopsis thalian 0.676 0.096 0.338 1.7e-09
TAIR|locus:2170333 1197 CSA1 "constitutive shade-avoid 0.784 0.109 0.315 2.2e-09
TAIR|locus:2827629 1355 AT2G17050 [Arabidopsis thalian 0.562 0.069 0.323 3.8e-09
TAIR|locus:2076043 1194 RPP1 "recognition of peronospo 0.796 0.111 0.351 7.4e-09
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.700 0.095 0.362 2.6e-08
TAIR|locus:2133662 853 AT4G09360 [Arabidopsis thalian 0.838 0.164 0.335 9.4e-08
TAIR|locus:2081810 1226 AT3G51570 [Arabidopsis thalian 0.700 0.095 0.344 1.5e-07
TAIR|locus:2163426 1187 TAO1 "target of AVRB operation 0.628 0.088 0.348 1.8e-07
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 119 (46.9 bits), Expect = 2.4e-12, Sum P(2) = 2.4e-12
 Identities = 36/93 (38%), Positives = 50/93 (53%)

Query:    30 GCSKLKRLPESRVLIRCGCKRLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEHSIPNK-- 87
             GCS+L  L     L RC    L  LP +I  L  LQ L L G+ N+  LP+  +  N   
Sbjct:   853 GCSRLTDL----YLSRCS---LYKLPDNIGGLSSLQSLCLSGN-NIENLPESFNQLNNLK 904

Query:    88 --NLNYSERLQSRPKLPSNLEWLLAHRCTALES 118
               +L + + L+S P LP NL++L AH C +LE+
Sbjct:   905 WFDLKFCKMLKSLPVLPQNLQYLDAHECESLET 937
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076043 RPP1 "recognition of peronospora parasitica 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133662 AT4G09360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00038688001
SubName- Full=Chromosome chr18 scaffold_96, whole genome shotgun sequence; (430 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-05
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 42.9 bits (101), Expect = 3e-05
 Identities = 31/86 (36%), Positives = 42/86 (48%), Gaps = 9/86 (10%)

Query: 2   LNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPES-------RVLIRCGCKRLKSL 54
           ++L G + LK +P ++ +   L+ L  S CS L  LP S         L    C+ L+ L
Sbjct: 639 IDLRGSKNLKEIP-DLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEIL 697

Query: 55  PSSICQLKPLQVLNLHGSSNLHRLPD 80
           P+ I  LK L  LNL G S L   PD
Sbjct: 698 PTGI-NLKSLYRLNLSGCSRLKSFPD 722

syringae 6; Provisional. Length = 1153

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.46
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.41
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.02
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.01
PRK15386 426 type III secretion protein GogB; Provisional 98.72
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.53
PRK15386 426 type III secretion protein GogB; Provisional 98.46
PLN03150623 hypothetical protein; Provisional 98.45
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.44
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.42
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.39
KOG0617264 consensus Ras suppressor protein (contains leucine 98.35
KOG0617264 consensus Ras suppressor protein (contains leucine 98.21
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.19
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.02
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.84
KOG0472 565 consensus Leucine-rich repeat protein [Function un 97.81
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.61
PLN03150623 hypothetical protein; Provisional 97.59
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.58
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.5
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.47
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.42
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.33
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.31
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.31
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.22
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.21
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 96.93
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 96.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.55
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.98
KOG4341 483 consensus F-box protein containing LRR [General fu 95.44
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.88
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 94.78
KOG4341483 consensus F-box protein containing LRR [General fu 94.4
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 94.23
KOG4237 498 consensus Extracellular matrix protein slit, conta 94.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 94.04
KOG1947 482 consensus Leucine rich repeat proteins, some prote 94.0
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 93.33
KOG4237 498 consensus Extracellular matrix protein slit, conta 92.68
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.44
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 90.45
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 89.7
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 88.87
smart0037026 LRR Leucine-rich repeats, outliers. 88.49
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.49
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 88.39
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 88.35
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 88.22
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 87.03
KOG1947 482 consensus Leucine rich repeat proteins, some prote 86.5
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 86.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 81.65
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=99.46  E-value=2.7e-13  Score=121.36  Aligned_cols=95  Identities=29%  Similarity=0.353  Sum_probs=61.8

Q ss_pred             CCccCCccCCCCCCCCeeeecCCCCCccCCCCC---ccCccccccccccccCCCC-----------------------cc
Q 045006           50 RLKSLPSSICQLKPLQVLNLHGSSNLHRLPDEH---SIPNKNLNYSERLQSRPKL-----------------------PS  103 (167)
Q Consensus        50 ~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~~---~L~~l~l~~c~~l~~l~~~-----------------------~~  103 (167)
                      .+..+|.+++++++|+.|++++|+.++.+|...   +|+.|++++|..++.+|..                       ++
T Consensus       790 ~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~  869 (1153)
T PLN03210        790 SLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFS  869 (1153)
T ss_pred             CccccChhhhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCccccccccccccCEeECCCCCCccChHHHhcCC
Confidence            344456666677778888888887777777653   6677777777766655532                       23


Q ss_pred             ccccccccCCccchhccccccccCCCccEEeecCCCCCCHHH
Q 045006          104 NLEWLLAHRCTALESGLIFSISYESPLRHFDLSGDFKLDRNE  145 (167)
Q Consensus       104 ~L~~L~l~~c~~L~~~~~~~~~~~~~l~~l~~~~C~~l~~~~  145 (167)
                      +|+.|++.+|.+|+.++..... ...++.+++.+|.+|+...
T Consensus       870 ~L~~L~L~~C~~L~~l~~~~~~-L~~L~~L~l~~C~~L~~~~  910 (1153)
T PLN03210        870 NLSFLDMNGCNNLQRVSLNISK-LKHLETVDFSDCGALTEAS  910 (1153)
T ss_pred             CCCEEECCCCCCcCccCccccc-ccCCCeeecCCCccccccc
Confidence            5666667777777776332222 2457778888888886543

syringae 6; Provisional
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 61.1 bits (149), Expect = 6e-12
 Identities = 27/87 (31%), Positives = 35/87 (40%), Gaps = 9/87 (10%)

Query: 2   LNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPES-------RVLIRCGCKRLKSL 54
           L L     ++SLPA I  L+ LK L       L  L  +         L   GC  L++ 
Sbjct: 188 LRLEWTG-IRSLPASIANLQNLKSLKIRNS-PLSALGPAIHHLPKLEELDLRGCTALRNY 245

Query: 55  PSSICQLKPLQVLNLHGSSNLHRLPDE 81
           P       PL+ L L   SNL  LP +
Sbjct: 246 PPIFGGRAPLKRLILKDCSNLLTLPLD 272
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.48
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.38
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.1
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.1
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.03
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.03
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.03
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.02
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.01
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.01
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.0
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.99
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.98
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.98
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.98
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.97
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.96
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.93
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.92
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.91
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.91
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.91
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.91
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.88
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.87
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.87
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.87
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.86
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.86
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.86
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.83
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.81
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.8
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.8
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.79
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.78
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.77
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.77
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.75
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.75
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.75
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.75
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 98.74
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.73
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.72
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.72
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.71
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.71
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.7
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.7
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.69
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.68
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.68
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.67
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.66
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.66
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.64
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.57
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.56
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.55
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.55
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.54
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.53
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.52
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.52
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.52
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.51
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.5
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.5
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.45
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.4
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.38
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.38
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.28
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.13
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.03
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.96
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.94
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.92
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.88
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.86
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.83
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.74
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.6
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.57
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.35
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.57
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 95.28
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.66
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 94.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.07
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.7
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.66
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.49
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 90.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 90.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 87.15
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 85.8
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 83.37
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.48  E-value=1.6e-13  Score=106.26  Aligned_cols=139  Identities=29%  Similarity=0.398  Sum_probs=92.8

Q ss_pred             EeecCCCCCCccCcccCCCCCCCEEeccCCCCCccCCCCce----------------EEecCCCCCccCCccCCCCCCCC
Q 045006            2 LNLGGCEILKSLPAEIFLLELLKKLNFSGCSKLKRLPESRV----------------LIRCGCKRLKSLPSSICQLKPLQ   65 (167)
Q Consensus         2 L~l~~c~~l~~lp~~~~~l~~L~~L~ls~c~~l~~lp~~~~----------------L~l~~c~~l~~lp~~l~~l~~L~   65 (167)
                      |++++| .++.+|..++.+++|++|++++|..++.+|..+.                |++++| .++.+|..++++++|+
T Consensus       132 L~Ls~n-~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n-~l~~lp~~l~~l~~L~  209 (328)
T 4fcg_A          132 LTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWT-GIRSLPASIANLQNLK  209 (328)
T ss_dssp             EEEESC-CCCCCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEE-CCCCCCGGGGGCTTCC
T ss_pred             EECCCC-ccccCcHHHhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCC-CcCcchHhhcCCCCCC
Confidence            556655 3446666666666666666666666666665431                666663 4456777777777788


Q ss_pred             eeeecCCCCCccCCCCC----ccCccccccccccccCCCC---ccccccccccCCccchhccccccccCCCccEEeecCC
Q 045006           66 VLNLHGSSNLHRLPDEH----SIPNKNLNYSERLQSRPKL---PSNLEWLLAHRCTALESGLIFSISYESPLRHFDLSGD  138 (167)
Q Consensus        66 ~L~l~~c~~l~~lp~~~----~L~~l~l~~c~~l~~l~~~---~~~L~~L~l~~c~~L~~~~~~~~~~~~~l~~l~~~~C  138 (167)
                      +|++++| .+..+|...    +|+.|++++|...+.+|..   +++|+.|++++|..+..++.... ..+.++.|++++|
T Consensus       210 ~L~L~~N-~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~-~l~~L~~L~L~~n  287 (328)
T 4fcg_A          210 SLKIRNS-PLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIH-RLTQLEKLDLRGC  287 (328)
T ss_dssp             EEEEESS-CCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGG-GCTTCCEEECTTC
T ss_pred             EEEccCC-CCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhh-cCCCCCEEeCCCC
Confidence            8888774 455555432    7777888888888887764   46788888988877766644432 2346888999999


Q ss_pred             CCCCHH
Q 045006          139 FKLDRN  144 (167)
Q Consensus       139 ~~l~~~  144 (167)
                      +.+...
T Consensus       288 ~~~~~i  293 (328)
T 4fcg_A          288 VNLSRL  293 (328)
T ss_dssp             TTCCCC
T ss_pred             Cchhhc
Confidence            877654
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.79
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.77
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.75
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.69
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 98.65
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.63
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.59
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.55
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.5
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.41
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.41
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.36
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.35
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.29
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.25
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.21
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.08
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.99
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.99
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.97
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.53
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.26
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.18
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 91.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 91.29
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 88.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 80.36
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.94  E-value=1.1e-11  Score=92.33  Aligned_cols=129  Identities=19%  Similarity=0.195  Sum_probs=58.0

Q ss_pred             cCCCCCCCEEeccCCCCCccCCC------Cce-EEecCCCCCcc--CCccCCCCCCCCeeeecCCCCCccC--C----C-
Q 045006           17 IFLLELLKKLNFSGCSKLKRLPE------SRV-LIRCGCKRLKS--LPSSICQLKPLQVLNLHGSSNLHRL--P----D-   80 (167)
Q Consensus        17 ~~~l~~L~~L~ls~c~~l~~lp~------~~~-L~l~~c~~l~~--lp~~l~~l~~L~~L~l~~c~~l~~l--p----~-   80 (167)
                      +..+++|++|++++|..-...+.      .+. |++++|..++.  +..-..++++|++|++++|..+.+-  .    . 
T Consensus        67 ~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~  146 (284)
T d2astb2          67 LSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHV  146 (284)
T ss_dssp             HTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHS
T ss_pred             HHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhccc
Confidence            45566666666666532211111      122 66666655542  1222234566666666666544210  0    0 


Q ss_pred             CCccCcccccccc-ccc-----cCCCCccccccccccCCccchhc-cccccccCCCccEEeecCCCCCCHHHH
Q 045006           81 EHSIPNKNLNYSE-RLQ-----SRPKLPSNLEWLLAHRCTALESG-LIFSISYESPLRHFDLSGDFKLDRNEV  146 (167)
Q Consensus        81 ~~~L~~l~l~~c~-~l~-----~l~~~~~~L~~L~l~~c~~L~~~-~~~~~~~~~~l~~l~~~~C~~l~~~~~  146 (167)
                      ...|+.+.+++|. .++     .+....++|+.|++++|..+++. +.... ..+.+++|++++|..+++...
T Consensus       147 ~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~-~~~~L~~L~L~~C~~i~~~~l  218 (284)
T d2astb2         147 SETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFF-QLNYLQHLSLSRCYDIIPETL  218 (284)
T ss_dssp             CTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGG-GCTTCCEEECTTCTTCCGGGG
T ss_pred             ccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhc-ccCcCCEEECCCCCCCChHHH
Confidence            0134555555442 111     11112345555666555555544 22221 223455566666655555443
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure