Citrus Sinensis ID: 045044
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 122 | ||||||
| 255541578 | 449 | calmodulin-binding heat-shock protein, p | 0.991 | 0.269 | 0.743 | 5e-49 | |
| 224127664 | 450 | predicted protein [Populus trichocarpa] | 0.991 | 0.268 | 0.735 | 3e-48 | |
| 224064029 | 449 | predicted protein [Populus trichocarpa] | 0.991 | 0.269 | 0.719 | 2e-47 | |
| 225454222 | 451 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.268 | 0.735 | 7e-47 | |
| 147773896 | 511 | hypothetical protein VITISV_005615 [Viti | 0.991 | 0.236 | 0.735 | 7e-47 | |
| 356530854 | 444 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.272 | 0.719 | 7e-47 | |
| 357443977 | 486 | Calmodulin-binding heat shock protein [M | 0.991 | 0.248 | 0.719 | 1e-46 | |
| 55793838 | 457 | calmodulin-binding heat shock protein [G | 0.991 | 0.264 | 0.719 | 3e-46 | |
| 356559786 | 444 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.272 | 0.702 | 4e-46 | |
| 225464491 | 453 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.267 | 0.719 | 5e-46 |
| >gi|255541578|ref|XP_002511853.1| calmodulin-binding heat-shock protein, putative [Ricinus communis] gi|223549033|gb|EEF50522.1| calmodulin-binding heat-shock protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 197 bits (502), Expect = 5e-49, Method: Composition-based stats.
Identities = 90/121 (74%), Positives = 103/121 (85%)
Query: 1 LAIRGLNLAKEGDYAVLLDNKLGQTKFDGGYVHNGLLKATRWVFDAKCEFLRGLVDRNLN 60
LAIRGLNLAKE DYAVLLDNKLGQTKFDGGYVHNGLLKA +WVF+ +C+ LR LVD N +
Sbjct: 110 LAIRGLNLAKESDYAVLLDNKLGQTKFDGGYVHNGLLKAAKWVFNTECKVLRNLVDMNPD 169
Query: 61 YTLTFARHSLGAGVVALLVLIVVQNLDKFGNIKRNKIRCFAIAPTKCMSLNLAVRYEWII 120
Y LTFA HSLGAGVVAL+ + +QN DK GNI+R +IRCFA+AP +CMSLNLAVRY +I
Sbjct: 170 YKLTFAGHSLGAGVVALMTMYAIQNQDKLGNIERKRIRCFAVAPARCMSLNLAVRYADVI 229
Query: 121 N 121
N
Sbjct: 230 N 230
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224127664|ref|XP_002320130.1| predicted protein [Populus trichocarpa] gi|222860903|gb|EEE98445.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224064029|ref|XP_002301356.1| predicted protein [Populus trichocarpa] gi|222843082|gb|EEE80629.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225454222|ref|XP_002274561.1| PREDICTED: uncharacterized protein LOC100265467 [Vitis vinifera] gi|297745287|emb|CBI40367.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147773896|emb|CAN69548.1| hypothetical protein VITISV_005615 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356530854|ref|XP_003533994.1| PREDICTED: uncharacterized protein LOC100776475 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357443977|ref|XP_003592266.1| Calmodulin-binding heat shock protein [Medicago truncatula] gi|355481314|gb|AES62517.1| Calmodulin-binding heat shock protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|55793838|gb|AAV65493.1| calmodulin-binding heat shock protein [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|356559786|ref|XP_003548178.1| PREDICTED: uncharacterized protein LOC100796283 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225464491|ref|XP_002271771.1| PREDICTED: uncharacterized protein LOC100259313 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 122 | ||||||
| TAIR|locus:2127048 | 460 | AT4G00500 [Arabidopsis thalian | 0.991 | 0.263 | 0.619 | 4.6e-34 | |
| TAIR|locus:2101338 | 477 | AT3G49050 [Arabidopsis thalian | 0.991 | 0.253 | 0.570 | 4.1e-33 | |
| TAIR|locus:2151769 | 436 | AT5G37710 [Arabidopsis thalian | 0.991 | 0.277 | 0.508 | 1.5e-26 |
| TAIR|locus:2127048 AT4G00500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 370 (135.3 bits), Expect = 4.6e-34, P = 4.6e-34
Identities = 75/121 (61%), Positives = 87/121 (71%)
Query: 1 LAIRGLNLAKEGDYAVLLDNKLGQTKFDGGYVHNGLLKATRWVFDAKCEFLRGLVDRNLN 60
LAIRGLNLAKE DYAVLLDNKLGQTKFDGGYVHNGLLKA WVF+ + LR L++ N +
Sbjct: 110 LAIRGLNLAKECDYAVLLDNKLGQTKFDGGYVHNGLLKAAMWVFEEEHVVLRELLEANPS 169
Query: 61 YTLTFARHSXXXXXXXXXXXXXXQNLDKFGNIKRNKIRCFAIAPTKCMSLNLAVRYEWII 120
Y+LTF HS QN + GNI+R +IRCFAIAP +CMSL+LAV Y +I
Sbjct: 170 YSLTFVGHSLGAGVVSLLVLFVIQNRVRLGNIERKRIRCFAIAPPRCMSLHLAVTYADVI 229
Query: 121 N 121
N
Sbjct: 230 N 230
|
|
| TAIR|locus:2101338 AT3G49050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151769 AT5G37710 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 122 | |||
| pfam01764 | 141 | pfam01764, Lipase_3, Lipase (class 3) | 2e-17 | |
| cd00519 | 229 | cd00519, Lipase_3, Lipase (class 3) | 1e-11 | |
| PLN02847 | 633 | PLN02847, PLN02847, triacylglycerol lipase | 1e-09 | |
| cd00741 | 153 | cd00741, Lipase, Lipase | 3e-04 |
| >gnl|CDD|216688 pfam01764, Lipase_3, Lipase (class 3) | Back alignment and domain information |
|---|
Score = 72.0 bits (177), Expect = 2e-17
Identities = 29/124 (23%), Positives = 50/124 (40%), Gaps = 9/124 (7%)
Query: 1 LAIRGLNLAKEGDYAVLLDNKLGQTKF---DGGYVHNGLLKATRWVFDAKCEFLRGLVDR 57
+A RG N ++ LD L GG VH G L A V D L+ L+++
Sbjct: 2 VAFRGTN--TILEWLTDLDFSLVPFDLLFVSGGKVHKGFLDAYTSVRDQILPELKRLIEK 59
Query: 58 NLNYTLTFARHSLGAGVVALLVLIVVQNLDKFGNIKRNKIRCFAIAPTKCMSLNLAVRYE 117
+Y + HSLG + +L + +N G ++IR + + + A ++
Sbjct: 60 YPDYKIVVTGHSLGGALASLAAADLAEN----GLFPSSRIRVYTFGSPRVGNYAFAELHD 115
Query: 118 WIIN 121
+
Sbjct: 116 SLGP 119
|
Length = 141 |
| >gnl|CDD|238287 cd00519, Lipase_3, Lipase (class 3) | Back alignment and domain information |
|---|
| >gnl|CDD|178439 PLN02847, PLN02847, triacylglycerol lipase | Back alignment and domain information |
|---|
| >gnl|CDD|238382 cd00741, Lipase, Lipase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| PLN02847 | 633 | triacylglycerol lipase | 99.97 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 99.96 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 99.96 | |
| PLN02934 | 515 | triacylglycerol lipase | 99.94 | |
| PLN02162 | 475 | triacylglycerol lipase | 99.94 | |
| PLN02408 | 365 | phospholipase A1 | 99.93 | |
| PLN02454 | 414 | triacylglycerol lipase | 99.93 | |
| PLN02310 | 405 | triacylglycerol lipase | 99.93 | |
| PLN02719 | 518 | triacylglycerol lipase | 99.93 | |
| PLN00413 | 479 | triacylglycerol lipase | 99.93 | |
| PLN02802 | 509 | triacylglycerol lipase | 99.93 | |
| PLN02753 | 531 | triacylglycerol lipase | 99.93 | |
| PLN02324 | 415 | triacylglycerol lipase | 99.93 | |
| PLN02571 | 413 | triacylglycerol lipase | 99.92 | |
| PLN02761 | 527 | lipase class 3 family protein | 99.92 | |
| PLN03037 | 525 | lipase class 3 family protein; Provisional | 99.92 | |
| KOG4569 | 336 | consensus Predicted lipase [Lipid transport and me | 99.89 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 99.79 | |
| KOG2088 | 596 | consensus Predicted lipase/calmodulin-binding heat | 99.55 | |
| PF11187 | 224 | DUF2974: Protein of unknown function (DUF2974); In | 99.04 | |
| COG3675 | 332 | Predicted lipase [Lipid metabolism] | 98.82 | |
| COG5153 | 425 | CVT17 Putative lipase essential for disintegration | 98.77 | |
| KOG4540 | 425 | consensus Putative lipase essential for disintegra | 98.77 | |
| PF05057 | 217 | DUF676: Putative serine esterase (DUF676); InterPr | 98.06 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 97.97 | |
| COG3675 | 332 | Predicted lipase [Lipid metabolism] | 97.81 | |
| KOG2088 | 596 | consensus Predicted lipase/calmodulin-binding heat | 97.61 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 97.42 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 97.39 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 97.38 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 97.35 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 97.32 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 97.31 | |
| PF01083 | 179 | Cutinase: Cutinase; InterPro: IPR000675 Aerial pla | 97.28 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 97.24 | |
| PLN02965 | 255 | Probable pheophorbidase | 97.24 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 97.21 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 97.18 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 97.18 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 97.17 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 97.16 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 97.13 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 97.11 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 97.11 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 97.08 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 97.06 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 97.03 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 97.01 | |
| KOG3724 | 973 | consensus Negative regulator of COPII vesicle form | 96.96 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 96.93 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 96.92 | |
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 96.92 | |
| PLN02511 | 388 | hydrolase | 96.91 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 96.9 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 96.84 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 96.84 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 96.83 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 96.78 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 96.74 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 96.72 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 96.62 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 96.61 | |
| PRK10566 | 249 | esterase; Provisional | 96.61 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 96.56 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 96.52 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 96.44 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 96.38 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 96.35 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 96.34 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 96.32 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 96.28 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 96.26 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 96.21 | |
| PF06259 | 177 | Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR | 96.15 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 96.05 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 96.05 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 96.04 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 96.03 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 96.02 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 95.93 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 95.92 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 95.92 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 95.87 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 95.87 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 95.84 | |
| PLN00021 | 313 | chlorophyllase | 95.8 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 95.78 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 95.7 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 95.69 | |
| PLN02578 | 354 | hydrolase | 95.62 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 95.6 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 95.58 | |
| PF11288 | 207 | DUF3089: Protein of unknown function (DUF3089); In | 95.53 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 95.48 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 95.41 | |
| PF00091 | 216 | Tubulin: Tubulin/FtsZ family, GTPase domain; Inter | 95.38 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 95.35 | |
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 95.33 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 95.23 | |
| PRK07581 | 339 | hypothetical protein; Validated | 95.21 | |
| PF08237 | 225 | PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum | 95.17 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 95.14 | |
| PF05677 | 365 | DUF818: Chlamydia CHLPS protein (DUF818); InterPro | 94.99 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 94.92 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 94.91 | |
| COG3319 | 257 | Thioesterase domains of type I polyketide synthase | 94.85 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 94.82 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 94.79 | |
| PF00756 | 251 | Esterase: Putative esterase; InterPro: IPR000801 T | 94.77 | |
| KOG4409 | 365 | consensus Predicted hydrolase/acyltransferase (alp | 94.53 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 94.51 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 94.48 | |
| PLN02517 | 642 | phosphatidylcholine-sterol O-acyltransferase | 94.34 | |
| KOG1838 | 409 | consensus Alpha/beta hydrolase [General function p | 94.33 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 94.1 | |
| PF05277 | 345 | DUF726: Protein of unknown function (DUF726); Inte | 94.09 | |
| PF01674 | 219 | Lipase_2: Lipase (class 2); InterPro: IPR002918 Li | 94.01 | |
| COG3571 | 213 | Predicted hydrolase of the alpha/beta-hydrolase fo | 93.96 | |
| smart00824 | 212 | PKS_TE Thioesterase. Peptide synthetases are invol | 93.79 | |
| PLN02872 | 395 | triacylglycerol lipase | 93.76 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 93.76 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 93.62 | |
| PF09752 | 348 | DUF2048: Uncharacterized conserved protein (DUF204 | 93.4 | |
| KOG2382 | 315 | consensus Predicted alpha/beta hydrolase [General | 93.35 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 93.29 | |
| PF03403 | 379 | PAF-AH_p_II: Platelet-activating factor acetylhydr | 92.89 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 92.74 | |
| COG3458 | 321 | Acetyl esterase (deacetylase) [Secondary metabolit | 92.73 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 92.63 | |
| COG1075 | 336 | LipA Predicted acetyltransferases and hydrolases w | 92.42 | |
| PF00450 | 415 | Peptidase_S10: Serine carboxypeptidase; InterPro: | 92.21 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 91.76 | |
| PRK04940 | 180 | hypothetical protein; Provisional | 91.69 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 91.4 | |
| KOG2369 | 473 | consensus Lecithin:cholesterol acyltransferase (LC | 91.03 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 91.03 | |
| COG2819 | 264 | Predicted hydrolase of the alpha/beta superfamily | 90.83 | |
| PRK03482 | 215 | phosphoglycerate mutase; Provisional | 90.36 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 90.32 | |
| TIGR00976 | 550 | /NonD putative hydrolase, CocE/NonD family. This m | 90.21 | |
| cd02189 | 446 | delta_tubulin The tubulin superfamily includes fiv | 89.99 | |
| PF08840 | 213 | BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term | 89.92 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 89.85 | |
| cd02188 | 431 | gamma_tubulin Gamma-tubulin is a ubiquitous phylog | 89.47 | |
| cd00286 | 328 | Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin | 89.4 | |
| COG5023 | 443 | Tubulin [Cytoskeleton] | 89.14 | |
| COG4782 | 377 | Uncharacterized protein conserved in bacteria [Fun | 88.88 | |
| PF01738 | 218 | DLH: Dienelactone hydrolase family; InterPro: IPR0 | 88.62 | |
| KOG4627 | 270 | consensus Kynurenine formamidase [Amino acid trans | 88.59 | |
| PRK15004 | 199 | alpha-ribazole phosphatase; Provisional | 88.45 | |
| PF07224 | 307 | Chlorophyllase: Chlorophyllase; InterPro: IPR01082 | 88.38 | |
| TIGR03162 | 177 | ribazole_cobC alpha-ribazole phosphatase. Members | 88.27 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 87.79 | |
| cd06059 | 382 | Tubulin The tubulin superfamily includes five dist | 87.78 | |
| PLN03016 | 433 | sinapoylglucose-malate O-sinapoyltransferase | 87.71 | |
| cd02190 | 379 | epsilon_tubulin The tubulin superfamily includes f | 87.66 | |
| PLN02213 | 319 | sinapoylglucose-malate O-sinapoyltransferase/ carb | 87.59 | |
| PLN02209 | 437 | serine carboxypeptidase | 87.55 | |
| KOG1552 | 258 | consensus Predicted alpha/beta hydrolase [General | 87.5 | |
| PF03959 | 212 | FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 | 87.49 | |
| KOG3847 | 399 | consensus Phospholipase A2 (platelet-activating fa | 87.35 | |
| cd02186 | 434 | alpha_tubulin The tubulin superfamily includes fiv | 87.35 | |
| KOG3101 | 283 | consensus Esterase D [General function prediction | 87.26 | |
| TIGR02802 | 104 | Pal_lipo peptidoglycan-associated lipoprotein. Mem | 86.51 | |
| PRK13463 | 203 | phosphatase PhoE; Provisional | 86.25 | |
| PLN00220 | 447 | tubulin beta chain; Provisional | 86.1 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 85.94 | |
| PF03583 | 290 | LIP: Secretory lipase ; InterPro: IPR005152 This e | 85.64 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 85.46 | |
| PRK10802 | 173 | peptidoglycan-associated outer membrane lipoprotei | 85.23 | |
| PTZ00335 | 448 | tubulin alpha chain; Provisional | 85.06 | |
| PRK14119 | 228 | gpmA phosphoglyceromutase; Provisional | 84.75 | |
| PLN00222 | 454 | tubulin gamma chain; Provisional | 84.7 | |
| TIGR03848 | 204 | MSMEG_4193 probable phosphomutase, MSMEG_4193 fami | 84.13 | |
| COG2945 | 210 | Predicted hydrolase of the alpha/beta superfamily | 83.75 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 83.66 | |
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 83.53 | |
| KOG1282 | 454 | consensus Serine carboxypeptidases (lysosomal cath | 83.38 | |
| COG4814 | 288 | Uncharacterized protein with an alpha/beta hydrola | 83.37 | |
| PF07082 | 250 | DUF1350: Protein of unknown function (DUF1350); In | 83.18 | |
| PF12715 | 390 | Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 | 83.07 | |
| PF12740 | 259 | Chlorophyllase2: Chlorophyllase enzyme; InterPro: | 82.96 | |
| COG2885 | 190 | OmpA Outer membrane protein and related peptidogly | 82.69 | |
| cd02187 | 425 | beta_tubulin The tubulin superfamily includes five | 82.69 | |
| PTZ00010 | 445 | tubulin beta chain; Provisional | 82.47 | |
| PF10081 | 289 | Abhydrolase_9: Alpha/beta-hydrolase family; InterP | 82.29 | |
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 82.07 | |
| PF00300 | 158 | His_Phos_1: Histidine phosphatase superfamily (bra | 82.01 | |
| KOG2112 | 206 | consensus Lysophospholipase [Lipid transport and m | 81.87 | |
| PRK13462 | 203 | acid phosphatase; Provisional | 81.75 | |
| PTZ00387 | 465 | epsilon tubulin; Provisional | 81.16 | |
| COG3150 | 191 | Predicted esterase [General function prediction on | 80.87 | |
| PLN00221 | 450 | tubulin alpha chain; Provisional | 80.61 | |
| KOG1516 | 545 | consensus Carboxylesterase and related proteins [G | 80.53 | |
| smart00864 | 192 | Tubulin Tubulin/FtsZ family, GTPase domain. This d | 80.47 | |
| KOG4372 | 405 | consensus Predicted alpha/beta hydrolase [General | 80.12 |
| >PLN02847 triacylglycerol lipase | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.5e-31 Score=221.28 Aligned_cols=112 Identities=29% Similarity=0.494 Sum_probs=99.6
Q ss_pred CEEeCCCCcCcCCceeEeeCCcccccc-------------CCCchhHhHHHHHHHHHHHHHHHHHHHHHhCCCCeEEEee
Q 045044 1 LAIRGLNLAKEGDYAVLLDNKLGQTKF-------------DGGYVHNGLLKATRWVFDAKCEFLRGLVDRNLNYTLTFAR 67 (122)
Q Consensus 1 laiRGT~~~~~~~~~~~~D~~~~~~~~-------------~~g~vH~Gf~~aa~~~~~~~~~~l~~~~~~~p~~~l~vtG 67 (122)
|+||||.+++| ++||+.+...++ ..|++|+||+++|+++++.+.+.|.+++++||+|+|+|||
T Consensus 182 VsIRGT~Si~D----~LTDL~~~~vPf~~s~l~~gG~~n~~~G~AH~Gml~AArwI~~~i~~~L~kal~~~PdYkLVITG 257 (633)
T PLN02847 182 LLIRGTHSIKD----TLTAATGAVVPFHHSVLHDGGVSNLVLGYAHCGMVAAARWIAKLSTPCLLKALDEYPDFKIKIVG 257 (633)
T ss_pred EEECCCCCHHH----HHHhcccccccCCcccccccCcccCcCCccCccHHHHHHHHHHHHHHHHHHHHHHCCCCeEEEec
Confidence 68999999888 999987655553 1368999999999999999999999999999999999999
Q ss_pred ccchHHHHHHHHHHHHhhccccCCCCCCceEEEEecCCCcCCHHHHHhccccccC
Q 045044 68 HSLGAGVVALLVLIVVQNLDKFGNIKRNKIRCFAIAPTKCMSLNLAVRYEWIING 122 (122)
Q Consensus 68 HSLGGavA~L~~~~l~~~~~~~~~~~~~~v~~~tfg~P~v~~~~~a~~~~~~i~s 122 (122)
||||||+|+|++++|+.+. . ..+++||+||||+|++.++++.|++||+|
T Consensus 258 HSLGGGVAALLAilLRe~~-~-----fssi~CyAFgPp~cvS~eLAe~~k~fVTS 306 (633)
T PLN02847 258 HSLGGGTAALLTYILREQK-E-----FSSTTCVTFAPAACMTWDLAESGKHFITT 306 (633)
T ss_pred cChHHHHHHHHHHHHhcCC-C-----CCCceEEEecCchhcCHHHHHHhhhheEE
Confidence 9999999999999997542 2 36899999999999999999999999975
|
|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >PLN02934 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02162 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02408 phospholipase A1 | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02310 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02719 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN00413 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02802 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02753 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02324 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02761 lipase class 3 family protein | Back alignment and domain information |
|---|
| >PLN03037 lipase class 3 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG4569 consensus Predicted lipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function | Back alignment and domain information |
|---|
| >COG3675 Predicted lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG3675 Predicted lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00091 Tubulin: Tubulin/FtsZ family, GTPase domain; InterPro: IPR003008 This domain is found in all tubulin chains, as well as the bacterial FtsZ family of proteins | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae | Back alignment and domain information |
|---|
| >KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02517 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >KOG1838 consensus Alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins | Back alignment and domain information |
|---|
| >PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] | Back alignment and domain information |
|---|
| >COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >smart00824 PKS_TE Thioesterase | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04940 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03482 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR00976 /NonD putative hydrolase, CocE/NonD family | Back alignment and domain information |
|---|
| >cd02189 delta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >cd02188 gamma_tubulin Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily | Back alignment and domain information |
|---|
| >cd00286 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation | Back alignment and domain information |
|---|
| >COG5023 Tubulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4782 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway | Back alignment and domain information |
|---|
| >KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15004 alpha-ribazole phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >TIGR03162 ribazole_cobC alpha-ribazole phosphatase | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd06059 Tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >PLN03016 sinapoylglucose-malate O-sinapoyltransferase | Back alignment and domain information |
|---|
| >cd02190 epsilon_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase | Back alignment and domain information |
|---|
| >PLN02209 serine carboxypeptidase | Back alignment and domain information |
|---|
| >KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family | Back alignment and domain information |
|---|
| >KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02186 alpha_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >KOG3101 consensus Esterase D [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02802 Pal_lipo peptidoglycan-associated lipoprotein | Back alignment and domain information |
|---|
| >PRK13463 phosphatase PhoE; Provisional | Back alignment and domain information |
|---|
| >PLN00220 tubulin beta chain; Provisional | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >PRK10802 peptidoglycan-associated outer membrane lipoprotein; Provisional | Back alignment and domain information |
|---|
| >PTZ00335 tubulin alpha chain; Provisional | Back alignment and domain information |
|---|
| >PRK14119 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PLN00222 tubulin gamma chain; Provisional | Back alignment and domain information |
|---|
| >TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family | Back alignment and domain information |
|---|
| >COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants | Back alignment and domain information |
|---|
| >PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A | Back alignment and domain information |
|---|
| >PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >COG2885 OmpA Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd02187 beta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa | Back alignment and domain information |
|---|
| >PTZ00010 tubulin beta chain; Provisional | Back alignment and domain information |
|---|
| >PF10081 Abhydrolase_9: Alpha/beta-hydrolase family; InterPro: IPR012037 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13462 acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00387 epsilon tubulin; Provisional | Back alignment and domain information |
|---|
| >COG3150 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00221 tubulin alpha chain; Provisional | Back alignment and domain information |
|---|
| >KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >smart00864 Tubulin Tubulin/FtsZ family, GTPase domain | Back alignment and domain information |
|---|
| >KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 122 | |||
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 4e-07 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 5e-06 | |
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 8e-06 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 2e-05 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 2e-05 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 3e-05 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 3e-05 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 3e-05 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 4e-04 |
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269 | Back alignment and structure |
|---|
Score = 46.0 bits (109), Expect = 4e-07
Identities = 16/91 (17%), Positives = 30/91 (32%), Gaps = 3/91 (3%)
Query: 27 FDGGYVHNGLLKATRWVFDAKCEFLRGLVDRNLNYTLTFARHSLGAGVVALLVLIVVQNL 86
G VH G L + V + ++ + + Y + HSLG L + + Q
Sbjct: 103 VKGAKVHAGFLSSYEQVVNDYFPVVQEQLTAHPTYKVIVTGHSLGGAQALLAGMDLYQR- 161
Query: 87 DKFGNIKRNKIRCFAIAPTKCMSLNLAVRYE 117
+ + F + + + A E
Sbjct: 162 --EPRLSPKNLSIFTVGGPRVGNPTFAYYVE 190
|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301 | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258 | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269 | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279 | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279 | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269 | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261 | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 99.97 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 99.96 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 99.96 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 99.95 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 99.95 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 99.94 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 99.94 | |
| 2yij_A | 419 | Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid | 99.89 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 99.93 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 99.92 | |
| 2ory_A | 346 | Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph | 99.91 | |
| 2qub_A | 615 | Extracellular lipase; beta roll, alpha/beta hydrol | 97.83 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 97.8 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 97.66 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 97.6 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 97.58 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 97.53 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 97.52 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 97.52 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 97.49 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 97.44 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 97.43 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 97.43 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 97.42 | |
| 1g66_A | 207 | Acetyl xylan esterase II; serine hydrolase, acetyl | 97.42 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 97.4 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 97.4 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 97.4 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 97.4 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 97.39 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 97.39 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 97.38 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 97.38 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 97.37 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 97.37 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 97.37 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 97.37 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 97.36 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 97.36 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 97.35 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 97.35 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 97.35 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 97.34 | |
| 1qoz_A | 207 | AXE, acetyl xylan esterase; hydrolase, xylan degra | 97.34 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 97.32 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 97.31 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 97.31 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 97.31 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 97.31 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 97.3 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 97.3 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 97.3 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 97.29 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 97.29 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 97.28 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 97.27 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 97.27 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 97.27 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 97.27 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 97.27 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 97.27 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 97.27 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 97.27 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 97.26 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 97.26 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 97.25 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 97.25 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 97.24 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 97.24 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 97.24 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 97.24 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 97.23 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 97.23 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 97.23 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 97.22 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 97.21 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 97.21 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 97.2 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 97.2 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 97.2 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 97.2 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 97.2 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 97.2 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 97.19 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 97.19 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 97.19 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 97.19 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 97.17 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 97.17 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 97.16 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 97.15 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 97.15 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 97.14 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 97.13 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 97.13 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 97.12 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 97.12 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 97.11 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 97.11 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 97.1 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 97.09 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 97.09 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 97.08 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 97.07 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 97.06 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 97.06 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 97.04 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 97.04 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 97.02 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 97.02 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 97.01 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 97.01 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 97.0 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 97.0 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 96.98 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 96.97 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 96.97 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 96.96 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 96.95 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 96.95 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 96.93 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 96.91 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 96.89 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 96.88 | |
| 2dsn_A | 387 | Thermostable lipase; T1 lipase, hydrolase; 1.50A { | 96.88 | |
| 2z8x_A | 617 | Lipase; beta roll, calcium binding protein, RTX pr | 96.85 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 96.85 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 96.83 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 96.83 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 96.81 | |
| 3hc7_A | 254 | Gene 12 protein, GP12; alpha/beta sandwich, cell a | 96.8 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 96.78 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 96.78 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 96.78 | |
| 2hih_A | 431 | Lipase 46 kDa form; A1 phospholipase, phospholipid | 96.77 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 96.77 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 96.76 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 96.76 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 96.74 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 96.74 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 96.72 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 96.71 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 96.71 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 96.69 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 96.69 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 96.66 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 96.65 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 96.65 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 96.65 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 96.64 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 96.61 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 96.59 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 96.57 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 96.54 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 96.53 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 96.52 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 96.5 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 96.49 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 96.48 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 95.47 | |
| 3aja_A | 302 | Putative uncharacterized protein; alpha-beta hydro | 96.44 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 96.4 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 96.4 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 96.4 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 96.39 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 96.37 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 96.36 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 96.36 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 96.35 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 96.35 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 96.34 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 96.34 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 96.3 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 96.28 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 96.27 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 96.26 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 96.25 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 96.24 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 96.22 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 96.22 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 96.21 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 96.18 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 96.17 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 96.17 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 96.13 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 96.13 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 96.12 | |
| 3qpa_A | 197 | Cutinase; alpha-beta hydrolase fold, esterase, hyd | 96.09 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 96.08 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 96.08 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 96.07 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 96.06 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 96.04 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 96.04 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 96.04 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 95.99 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 95.98 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 95.97 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 95.93 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 95.91 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 95.9 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 95.86 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 95.85 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 95.84 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 95.83 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 95.75 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 95.64 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 95.64 | |
| 2czq_A | 205 | Cutinase-like protein; alpha/beta hydrolase fold, | 95.6 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 95.59 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 95.58 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 95.48 | |
| 2gzs_A | 278 | IROE protein; enterobactin, salmochelin, DFP, hydr | 95.48 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 95.44 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 95.4 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 95.37 | |
| 3dcn_A | 201 | Cutinase, cutin hydrolase; catalytic triad, secret | 95.31 | |
| 1whs_A | 255 | Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T | 95.27 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 95.21 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 95.17 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 95.11 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 95.1 | |
| 3qpd_A | 187 | Cutinase 1; alpha-beta hydrolase fold, esterase, h | 95.06 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 94.89 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 94.64 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 94.45 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 94.45 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 94.44 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 94.26 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 94.25 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 94.18 | |
| 3pic_A | 375 | CIP2; alpha/beta hydrolase fold, glucuronoyl ester | 94.0 | |
| 1ivy_A | 452 | Human protective protein; carboxypeptidase, serine | 93.91 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 93.81 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 93.78 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 93.5 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 93.49 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 93.48 | |
| 4g4g_A | 433 | 4-O-methyl-glucuronoyl methylesterase; alpha/beta | 93.29 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 92.96 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 92.82 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 92.68 | |
| 1ac5_A | 483 | KEX1(delta)P; carboxypeptidase, hydrolase, glycopr | 92.42 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 92.38 | |
| 1mpx_A | 615 | Alpha-amino acid ester hydrolase; alpha/beta hydro | 92.33 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 92.31 | |
| 2d81_A | 318 | PHB depolymerase; alpha/beta hydrolase fold, circu | 92.2 | |
| 3gff_A | 331 | IROE-like serine hydrolase; NP_718593.1, structura | 91.63 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 91.53 | |
| 1gxs_A | 270 | P-(S)-hydroxymandelonitrIle lyase chain A; inhibit | 91.51 | |
| 4fol_A | 299 | FGH, S-formylglutathione hydrolase; D-type esteras | 91.39 | |
| 3ryc_B | 445 | Tubulin beta chain; alpha-tubulin, beta-tubulin, G | 90.95 | |
| 3ryc_A | 451 | Tubulin alpha chain; alpha-tubulin, beta-tubulin, | 90.87 | |
| 3v3t_A | 360 | Cell division GTPase FTSZ, diverged; TUBZ, tubulin | 90.82 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 90.56 | |
| 3cb2_A | 475 | Gamma-1-tubulin, tubulin gamma-1 chain; lattice, m | 90.56 | |
| 2bto_A | 473 | Tubulin btuba; bacterial tubulin, polymerization, | 90.54 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 90.29 | |
| 3oon_A | 123 | Outer membrane protein (TPN50); protein structure | 90.1 | |
| 2btq_B | 426 | Tubulin btubb; structural protein, cytoskeletal pr | 90.1 | |
| 2b9v_A | 652 | Alpha-amino acid ester hydrolase; catalytic triad, | 90.05 | |
| 1cpy_A | 421 | Serine carboxypeptidase; hydrolase (carboxypeptida | 90.0 | |
| 3i2k_A | 587 | Cocaine esterase; alpha/beta hydrolase, hydrolase; | 89.68 | |
| 3td3_A | 123 | Outer membrane protein OMP38; OMPA-like fold, cell | 89.52 | |
| 2kgw_A | 129 | Outer membrane protein A; OMPA-L membrane, transme | 89.49 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 89.16 | |
| 3iii_A | 560 | COCE/NOND family hydrolase; structural genomics, c | 89.0 | |
| 2k1s_A | 149 | Inner membrane lipoprotein YIAD; abbababab, OMPA, | 87.17 | |
| 2hqs_H | 118 | Peptidoglycan-associated lipoprotein; TOLB, PAL, T | 87.11 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 86.38 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 85.96 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 85.0 | |
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 84.78 | |
| 2aiz_P | 134 | Outer membrane protein P6; alpha-beta sandwich; HE | 83.6 | |
| 1lns_A | 763 | X-prolyl dipeptidyl aminopetidase; alpha beta hydr | 83.54 | |
| 2h7c_A | 542 | Liver carboxylesterase 1; enzyme, cholesteryl este | 82.79 | |
| 4az3_A | 300 | Lysosomal protective protein 32 kDa chain; hydrola | 82.62 | |
| 3ldt_A | 169 | Outer membrane protein, OMPA family protein; OMPA- | 82.49 | |
| 1qe3_A | 489 | PNB esterase, para-nitrobenzyl esterase; alpha-bet | 81.83 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 81.63 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 81.31 | |
| 2ogt_A | 498 | Thermostable carboxylesterase EST50; alpha/beta hy | 81.2 | |
| 2ha2_A | 543 | ACHE, acetylcholinesterase; hydrolase fold, serine | 80.35 | |
| 3hjg_A | 213 | Putative alpha-ribazole-5'-phosphate phosphatase C | 80.17 |
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
Probab=99.97 E-value=2.1e-30 Score=197.87 Aligned_cols=108 Identities=17% Similarity=0.168 Sum_probs=92.6
Q ss_pred CEEeCCCCcCcCCceeEeeCCcccccc--------CCCchhHhHHHHHHHHHHHHHHHHHHHHHhCCCCeEEEeeccchH
Q 045044 1 LAIRGLNLAKEGDYAVLLDNKLGQTKF--------DGGYVHNGLLKATRWVFDAKCEFLRGLVDRNLNYTLTFARHSLGA 72 (122)
Q Consensus 1 laiRGT~~~~~~~~~~~~D~~~~~~~~--------~~g~vH~Gf~~aa~~~~~~~~~~l~~~~~~~p~~~l~vtGHSLGG 72 (122)
|+||||.++.| |++|+.+...++ .+++||+||+++++.+++++.+.++++++++|+++|++|||||||
T Consensus 60 VafRGT~s~~d----w~~Dl~~~~~~~~~~g~~~~~~~~VH~GF~~~~~~~~~~~~~~l~~~~~~~p~~~i~vtGHSLGG 135 (258)
T 3g7n_A 60 VIMRGSTTITD----FVNDIDIALITPELSGVTFPSDVKIMRGVHRPWSAVHDTIITEVKALIAKYPDYTLEAVGHSLGG 135 (258)
T ss_dssp EEECCCSCCCC--------CCCCEECCCCTTCCCCTTCCEEHHHHHHHHHHHHHHHHHHHHHHHHSTTCEEEEEEETHHH
T ss_pred EEECCCCCHHH----HHHhcccceeccccCCCcCCCCcEEehhHHHHHHHHHHHHHHHHHHHHHhCCCCeEEEeccCHHH
Confidence 68999998777 999998866552 468899999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhhccccCCCCCCceEEEEecCCCcCCHHHHHhccc
Q 045044 73 GVVALLVLIVVQNLDKFGNIKRNKIRCFAIAPTKCMSLNLAVRYEW 118 (122)
Q Consensus 73 avA~L~~~~l~~~~~~~~~~~~~~v~~~tfg~P~v~~~~~a~~~~~ 118 (122)
|+|+|++++++.+. |..+++|||||+|||||.+|++.++.
T Consensus 136 alA~l~a~~l~~~~------~~~~v~~~tFg~PrvGn~~fa~~~~~ 175 (258)
T 3g7n_A 136 ALTSIAHVALAQNF------PDKSLVSNALNAFPIGNQAWADFGTA 175 (258)
T ss_dssp HHHHHHHHHHHHHC------TTSCEEEEEESCCCCBCHHHHHHHHH
T ss_pred HHHHHHHHHHHHhC------CCCceeEEEecCCCCCCHHHHHHHHh
Confidence 99999999997652 34679999999999999999997754
|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} | Back alignment and structure |
|---|
| >2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A | Back alignment and structure |
|---|
| >2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* | Back alignment and structure |
|---|
| >1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* | Back alignment and structure |
|---|
| >3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* | Back alignment and structure |
|---|
| >3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3ut5_B* 4eb6_B* 4f6r_B* 4f61_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 4aqv_B* 4aqw_B* 4atu_A* ... | Back alignment and structure |
|---|
| >3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3ut5_A* 4eb6_A* 4f61_A* 4f6r_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* ... | Back alignment and structure |
|---|
| >3v3t_A Cell division GTPase FTSZ, diverged; TUBZ, tubulin/FTSZ related, rossmann fold, GTP bindi structural protein; 2.30A {Clostridium botulinum C} | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* | Back alignment and structure |
|---|
| >2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} | Back alignment and structure |
|---|
| >3oon_A Outer membrane protein (TPN50); protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; 1.79A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} | Back alignment and structure |
|---|
| >2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A | Back alignment and structure |
|---|
| >1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* | Back alignment and structure |
|---|
| >3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A | Back alignment and structure |
|---|
| >3td3_A Outer membrane protein OMP38; OMPA-like fold, cell-WALL attachment, peptidoglycan-binding, protein,peptide binding protein; 1.59A {Acinetobacter baumannii} PDB: 3td4_A* 3td5_A* | Back alignment and structure |
|---|
| >2kgw_A Outer membrane protein A; OMPA-L membrane, transmembrane; NMR {Mycobacterium tuberculosis} PDB: 2lca_A 2lbt_A | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
| >3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* | Back alignment and structure |
|---|
| >2k1s_A Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, ME palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A | Back alignment and structure |
|---|
| >2aiz_P Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} SCOP: d.79.7.1 | Back alignment and structure |
|---|
| >1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* | Back alignment and structure |
|---|
| >4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* | Back alignment and structure |
|---|
| >3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} | Back alignment and structure |
|---|
| >1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A | Back alignment and structure |
|---|
| >2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A | Back alignment and structure |
|---|
| >2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... | Back alignment and structure |
|---|
| >3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 122 | ||||
| d1uwca_ | 261 | c.69.1.17 (A:) Feruloyl esterase A {Aspergillus ni | 4e-07 | |
| d1tiba_ | 269 | c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces | 1e-06 | |
| d1lgya_ | 265 | c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus ni | 3e-06 | |
| d3tgla_ | 265 | c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor | 5e-05 |
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Length = 261 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Fungal lipases domain: Feruloyl esterase A species: Aspergillus niger [TaxId: 5061]
Score = 44.4 bits (104), Expect = 4e-07
Identities = 25/126 (19%), Positives = 35/126 (27%), Gaps = 18/126 (14%)
Query: 1 LAIRGLNLAKEGDYAVLLDNKLGQTKFD------GGYVHNGLLKATRWVFDAKCEFLRGL 54
RG + LD T FD VH G V D ++
Sbjct: 63 TVFRGTGSDTN----LQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQ 118
Query: 55 VDRNLNYTLTFARHSLGAGVVALLVLIVVQNLDKFGNIKRNKIRCFAIAPTKCMSLNLAV 114
+ +Y LT HSLGA + AL + D R + + + A
Sbjct: 119 ASQYPDYALTVTGHSLGASMAALTAAQLSATYDNV--------RLYTFGEPRSGNQAFAS 170
Query: 115 RYEWII 120
Sbjct: 171 YMNDAF 176
|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Length = 269 | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Length = 265 | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Length = 265 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 99.97 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 99.97 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 99.97 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 99.97 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 99.97 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 97.9 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 97.79 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 97.73 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 97.56 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 97.5 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 97.48 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 97.39 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 97.37 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 97.35 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 97.3 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 97.2 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 97.18 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 97.17 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 97.11 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 97.1 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 97.06 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 97.0 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 96.99 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 96.93 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 96.93 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 96.9 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 96.89 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 96.89 | |
| d1cexa_ | 197 | Cutinase {Fungus (Fusarium solani), subsp. pisi [T | 96.85 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 96.82 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 96.72 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 96.7 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 96.69 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 96.69 | |
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 96.63 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 96.62 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 96.6 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 96.52 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 96.44 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 96.44 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 96.22 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 96.16 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 96.09 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 96.08 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 96.02 | |
| d1qoza_ | 207 | Acetylxylan esterase {Trichoderma reesei [TaxId: 5 | 95.84 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 95.8 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 95.77 | |
| d1g66a_ | 207 | Acetylxylan esterase {Penicillium purpurogenum [Ta | 95.77 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 95.71 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 95.64 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 95.57 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 95.32 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 95.24 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 95.16 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 94.98 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 94.97 | |
| d2btoa1 | 244 | Tubulin alpha-subunit {Prosthecobacter dejongeii [ | 94.92 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 94.5 | |
| d1ku0a_ | 388 | Lipase L1 {Bacillus stearothermophilus [TaxId: 142 | 94.26 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 93.95 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 93.94 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 93.9 | |
| d1pv1a_ | 299 | Hypothetical esterase YJL068C {Baker's yeast (Sacc | 93.41 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 93.34 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 93.26 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 93.08 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 92.84 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 92.32 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 91.27 | |
| d2hqsc1 | 106 | Peptidoglycan-associated lipoprotein, PAL, peripla | 90.98 | |
| d2aizp1 | 134 | Peptidoglycan-associated lipoprotein, PAL, peripla | 90.85 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 90.42 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 89.31 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 89.2 | |
| d1tubb1 | 243 | Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 982 | 89.16 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 88.99 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 88.99 | |
| d2d81a1 | 318 | Polyhydroxybutyrate depolymerase {Penicillium funi | 88.87 | |
| d1tuba1 | 245 | Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 98 | 88.53 | |
| d1r1ma_ | 140 | Outer membrane protein class 4, RmpM, C-terminal d | 88.19 | |
| d1wpxa1 | 421 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 88.19 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 87.86 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 87.77 | |
| d1h2ea_ | 207 | Broad specificity phosphatase PhoE (YhfR) {Bacillu | 87.56 | |
| d1ivya_ | 452 | Human 'protective protein', HPP {Human (Homo sapie | 87.42 | |
| g1wht.1 | 409 | Serine carboxypeptidase II {Wheat (Triticum vulgar | 86.99 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 86.84 | |
| d1fzta_ | 211 | Phosphoglycerate mutase {Fission yeast (Schizosacc | 84.74 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 83.11 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 83.09 | |
| g1gxs.1 | 425 | Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T | 82.68 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 81.93 | |
| d2hhja1 | 248 | Phosphoglycerate mutase {Human (Homo sapiens) [Tax | 81.48 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 80.64 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 80.61 |
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Fungal lipases domain: Triacylglycerol lipase species: Rhizopus niveus [TaxId: 4844]
Probab=99.97 E-value=2.7e-32 Score=207.26 Aligned_cols=112 Identities=19% Similarity=0.280 Sum_probs=98.9
Q ss_pred CEEeCCCCcCcCCceeEeeCCcccccc---CCCchhHhHHHHHHHHHHHHHHHHHHHHHhCCCCeEEEeeccchHHHHHH
Q 045044 1 LAIRGLNLAKEGDYAVLLDNKLGQTKF---DGGYVHNGLLKATRWVFDAKCEFLRGLVDRNLNYTLTFARHSLGAGVVAL 77 (122)
Q Consensus 1 laiRGT~~~~~~~~~~~~D~~~~~~~~---~~g~vH~Gf~~aa~~~~~~~~~~l~~~~~~~p~~~l~vtGHSLGGavA~L 77 (122)
|+||||.++.| |++|+.+...++ .+++||+||+++++.+++++.+.++++++++|+++|++||||||||+|.|
T Consensus 74 VafRGT~s~~d----~~~Dl~~~~~~~~~~~~~~VH~GF~~~~~~~~~~i~~~v~~~~~~~~~~~i~vtGHSLGGAlA~L 149 (265)
T d1lgya_ 74 LVFRGTNSFRS----AITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDYFPVVQEQLTAHPTYKVIVTGHSLGGAQALL 149 (265)
T ss_dssp EEEECCSCCHH----HHHTCCCCEEECTTSTTCEEEHHHHHHHHHHHHHHHHHHHHHHHHCTTCEEEEEEETHHHHHHHH
T ss_pred EEECCCCCHHH----HHHhCccccccccCCCCcEEeHHHHHHHHHHHHHHHHHHHHHHhhCCCceEEEEecccchHHHHH
Confidence 68999997766 999998876654 57899999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhhccccCCCCCCceEEEEecCCCcCCHHHHHhcccc
Q 045044 78 LVLIVVQNLDKFGNIKRNKIRCFAIAPTKCMSLNLAVRYEWI 119 (122)
Q Consensus 78 ~~~~l~~~~~~~~~~~~~~v~~~tfg~P~v~~~~~a~~~~~~ 119 (122)
++++|....+.+ +..+++|||||+|||||.+||+++++.
T Consensus 150 ~a~~l~~~~~~~---~~~~i~~~tFG~PrvGn~~fa~~~~~~ 188 (265)
T d1lgya_ 150 AGMDLYQREPRL---SPKNLSIFTVGGPRVGNPTFAYYVEST 188 (265)
T ss_dssp HHHHHHHHCTTC---STTTEEEEEESCCCCBCHHHHHHHHHH
T ss_pred HHHHHHHhCccc---CCCcceEEEecCccccCHHHHHHHhhc
Confidence 999997664332 356899999999999999999977653
|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2btoa1 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} | Back information, alignment and structure |
|---|
| >d1tuba1 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|