Citrus Sinensis ID: 045074


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQFVEPSSEPAISRLRSALNQLVAWFVKSRIIKLRVIRITYCLPM
ccEEEHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEccc
ccEEEHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHEcccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEcccc
VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLdaykstkadpkQLVEFYRSRFVvqfvepssepAISRLRSALNQLVAWFVKSRIIKLRVIRITYCLPM
VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQFVEPSSEPAISRLRSALNQLVAWfvksriiklrvirityclpm
VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQFVEPSSEPAISRLRSALNQLVAWFVKSRIIKLRVIRITYCLPM
**IAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQFVEPSSEPAISRLRSALNQLVAWFVKSRIIKLRVIRITYCL**
VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVV***************SALNQLVAWFVKSRIIKLRVIRITYCLPM
VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQFVEPSSEPAISRLRSALNQLVAWFVKSRIIKLRVIRITYCLPM
VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQFVEPSSEPAISRLRSALNQLVAWFVKSRIIKLRVIRITYCLPM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQFVEPSSEPAISRLRSALNQLVAWFVKSRIIKLRVIRITYCLPM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query108 2.2.26 [Sep-21-2011]
Q9LZ06235 Glutathione S-transferase yes no 0.583 0.268 0.650 4e-18
Q6NLB0237 Glutathione S-transferase no no 0.574 0.261 0.603 9e-16
Q9M2W2292 Glutathione S-transferase no no 0.564 0.208 0.557 1e-15
Q8H8U5244 Protein IN2-1 homolog B O yes no 0.592 0.262 0.562 3e-14
A1XBB7244 Protein IN2-1 homolog B O N/A no 0.592 0.262 0.562 3e-14
Q10N44243 Protein IN2-1 homolog A O no no 0.592 0.263 0.468 2e-10
P49248243 Protein IN2-1 OS=Zea mays N/A no 0.592 0.263 0.421 4e-09
>sp|Q9LZ06|GSTL3_ARATH Glutathione S-transferase L3 OS=Arabidopsis thaliana GN=GSTL3 PE=2 SV=1 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (80%)

Query: 1   VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRS 60
           VDIAYIPF+ERFQ  L+E FK DITA RPKL+AWIEE+NK D Y  TK DPK++VE ++ 
Sbjct: 173 VDIAYIPFIERFQTVLNELFKCDITAERPKLSAWIEEINKSDGYAQTKMDPKEIVEVFKK 232

Query: 61  RFV 63
           +F+
Sbjct: 233 KFM 235




Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 8
>sp|Q6NLB0|GSTL1_ARATH Glutathione S-transferase L1 OS=Arabidopsis thaliana GN=GSTL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2W2|GSTL2_ARATH Glutathione S-transferase L2, chloroplastic OS=Arabidopsis thaliana GN=GSTL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8H8U5|IN21B_ORYSJ Protein IN2-1 homolog B OS=Oryza sativa subsp. japonica GN=GSTZ5 PE=2 SV=1 Back     alignment and function description
>sp|A1XBB7|IN21B_ORYSI Protein IN2-1 homolog B OS=Oryza sativa subsp. indica GN=GSTZ5 PE=1 SV=1 Back     alignment and function description
>sp|Q10N44|IN21A_ORYSJ Protein IN2-1 homolog A OS=Oryza sativa subsp. japonica GN=Os03g0283200 PE=2 SV=1 Back     alignment and function description
>sp|P49248|IN21_MAIZE Protein IN2-1 OS=Zea mays GN=IN2-1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
284433794 240 glutathione S-transferase omega [Jatroph 0.601 0.270 0.8 2e-23
225439775 236 PREDICTED: glutathione S-transferase L3- 0.601 0.275 0.8 2e-22
283135902 212 lambda class glutathione transferase GST 0.592 0.301 0.796 4e-22
224138562 228 predicted protein [Populus trichocarpa] 0.583 0.276 0.809 4e-22
297741498 242 unnamed protein product [Vitis vinifera] 0.592 0.264 0.796 7e-22
255568460 242 glutathione-s-transferase omega, putativ 0.601 0.268 0.753 1e-21
283136130 212 lambda class glutathione transferase GST 0.601 0.306 0.753 2e-20
225439785 236 PREDICTED: glutathione S-transferase L3 0.601 0.275 0.753 1e-19
449483358 233 PREDICTED: glutathione S-transferase L3- 0.583 0.270 0.761 2e-19
449440047 233 PREDICTED: glutathione S-transferase L3- 0.583 0.270 0.761 2e-19
>gi|284433794|gb|ADB85103.1| glutathione S-transferase omega [Jatropha curcas] Back     alignment and taxonomy information
 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%)

Query: 1   VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRS 60
           VDIAYIPFVERFQIF SE FKYDITAGRPKLAAWIEE+NK++AYK TK DPK+LVEFY+ 
Sbjct: 176 VDIAYIPFVERFQIFFSEVFKYDITAGRPKLAAWIEEMNKIEAYKQTKTDPKELVEFYKK 235

Query: 61  RFVVQ 65
           R + Q
Sbjct: 236 RLLAQ 240




Source: Jatropha curcas

Species: Jatropha curcas

Genus: Jatropha

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225439775|ref|XP_002275882.1| PREDICTED: glutathione S-transferase L3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|283135902|gb|ADB11342.1| lambda class glutathione transferase GSTL2 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224138562|ref|XP_002322845.1| predicted protein [Populus trichocarpa] gi|222867475|gb|EEF04606.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297741498|emb|CBI32630.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568460|ref|XP_002525204.1| glutathione-s-transferase omega, putative [Ricinus communis] gi|223535501|gb|EEF37170.1| glutathione-s-transferase omega, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|283136130|gb|ADB11384.1| lambda class glutathione transferase GSTL3 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225439785|ref|XP_002276301.1| PREDICTED: glutathione S-transferase L3 [Vitis vinifera] gi|297741504|emb|CBI32636.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449483358|ref|XP_004156566.1| PREDICTED: glutathione S-transferase L3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440047|ref|XP_004137796.1| PREDICTED: glutathione S-transferase L3-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
TAIR|locus:2151326235 GSTL3 "Glutathione transferase 0.583 0.268 0.650 1.4e-18
TAIR|locus:2151286237 GSTL1 "AT5G02780" [Arabidopsis 0.574 0.261 0.603 5.3e-17
TAIR|locus:2097233292 GSTL2 "glutathione transferase 0.564 0.208 0.557 4.7e-16
TAIR|locus:2151326 GSTL3 "Glutathione transferase L3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 224 (83.9 bits), Expect = 1.4e-18, P = 1.4e-18
 Identities = 41/63 (65%), Positives = 51/63 (80%)

Query:     1 VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRS 60
             VDIAYIPF+ERFQ  L+E FK DITA RPKL+AWIEE+NK D Y  TK DPK++VE ++ 
Sbjct:   173 VDIAYIPFIERFQTVLNELFKCDITAERPKLSAWIEEINKSDGYAQTKMDPKEIVEVFKK 232

Query:    61 RFV 63
             +F+
Sbjct:   233 KFM 235




GO:0005737 "cytoplasm" evidence=ISM
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005829 "cytosol" evidence=IDA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
TAIR|locus:2151286 GSTL1 "AT5G02780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097233 GSTL2 "glutathione transferase lambda 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
cd03203120 cd03203, GST_C_Lambda, C-terminal, alpha helical d 1e-31
cd03184124 cd03184, GST_C_Omega, C-terminal, alpha helical do 6e-05
cd03185127 cd03185, GST_C_Tau, C-terminal, alpha helical doma 0.002
>gnl|CDD|198312 cd03203, GST_C_Lambda, C-terminal, alpha helical domain of Class Lambda Glutathione S-transferases Back     alignment and domain information
 Score =  107 bits (269), Expect = 1e-31
 Identities = 40/59 (67%), Positives = 48/59 (81%)

Query: 1   VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYR 59
           VDIAY PF+ERFQI LSE   YDITAGRP LA WIEE+NK++AY  TK DP++L+E Y+
Sbjct: 62  VDIAYAPFIERFQIVLSELRNYDITAGRPNLAKWIEEMNKIEAYTQTKVDPEELLELYK 120


Glutathione S-transferase (GST) C-terminal domain family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs. GSTs are cytosolic, usually dimeric, proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Lambda subfamily was recently discovered, together with dehydroascorbate reductases (DHARs), as two outlying groups of the GST superfamily in Arabidopsis thaliana, which contain conserved active site cysteines. Characterization of recombinant A. thaliana proteins show that Lambda class GSTs are monomeric, similar to DHARs. They do not exhibit GSH conjugating or DHAR activities, but are active as thiol transferases, similar to glutaredoxins. Members of this subfamily were originally identified as encoded proteins of the In2-1 gene, which can be induced by treatment with herbicide safeners. Length = 120

>gnl|CDD|198293 cd03184, GST_C_Omega, C-terminal, alpha helical domain of Class Omega Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|198294 cd03185, GST_C_Tau, C-terminal, alpha helical domain of Class Tau Glutathione S-transferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 108
KOG0406231 consensus Glutathione S-transferase [Posttranslati 99.13
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 98.88
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 98.61
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 98.57
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 98.5
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 98.49
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 98.21
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 98.18
PLN02378213 glutathione S-transferase DHAR1 97.65
PLN02817265 glutathione dehydrogenase (ascorbate) 97.47
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 97.4
PRK09481211 sspA stringent starvation protein A; Provisional 97.07
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 96.84
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 96.8
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 96.79
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 96.76
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 96.75
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 96.71
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 96.68
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 96.64
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 96.56
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 96.32
PTZ00057205 glutathione s-transferase; Provisional 96.31
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 96.28
PRK10357202 putative glutathione S-transferase; Provisional 96.27
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 96.2
PLN02395215 glutathione S-transferase 96.12
PRK10542201 glutathionine S-transferase; Provisional 96.1
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 96.05
PLN02473214 glutathione S-transferase 96.02
PRK11752264 putative S-transferase; Provisional 95.83
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 95.82
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 95.79
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 95.79
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 95.64
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 95.52
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 95.46
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 95.0
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 94.97
PRK15113214 glutathione S-transferase; Provisional 94.64
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 94.32
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 93.82
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 93.49
PRK10387210 glutaredoxin 2; Provisional 90.58
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 89.64
COG0625211 Gst Glutathione S-transferase [Posttranslational m 89.44
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 88.05
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 87.77
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 86.14
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 83.96
KOG4420325 consensus Uncharacterized conserved protein (Gangl 83.73
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 80.17
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.13  E-value=5.2e-11  Score=92.84  Aligned_cols=66  Identities=29%  Similarity=0.364  Sum_probs=56.9

Q ss_pred             CcEEeehhHHHHHHHhhhcccccc--CCCCccHHHHHHHHcCCcchhhcCCChHHHHHHHHHhhhhhc
Q 045074            1 VDIAYIPFVERFQIFLSEEFKYDI--TAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQF   66 (108)
Q Consensus         1 vDiaiwPwfeRl~vl~~~~~g~~l--~ee~PkL~aW~eaM~e~PaVKks~~~~Ekl~ef~k~~~~~~~   66 (108)
                      +||++||||+|+.......++.++  .+++|+|.+|+++|.++|+|++++++.|++.+|++.++++..
T Consensus       160 vDi~~~p~~~~~~~~~~~~~~~~~~~~~~~P~L~~W~~~~~~~~~V~~~~p~~e~~~e~~~~~~~~~~  227 (231)
T KOG0406|consen  160 VDIAIGPSFERWLAVLEKFGGVKFIIEEETPKLIKWIKRMKEDEAVKAVLPDSEKVVEFMKKYRQGSP  227 (231)
T ss_pred             hhhhHHhhHHHHHHHHHHhcCcccCCCCCCccHHHHHHHHhcChhHHhhcCCHHHHHHHHHHHHHhcc
Confidence            699999999998877644554443  456799999999999999999999999999999999998753



>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 4e-14
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 3e-12
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 2e-11
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 5e-11
2r4v_A247 XAP121, chloride intracellular channel protein 2; 5e-11
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 6e-11
2ahe_A267 Chloride intracellular channel protein 4; glutathi 7e-11
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 9e-11
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 2e-10
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 3e-10
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 4e-10
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 6e-10
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 2e-08
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 3e-07
3lxz_A229 Glutathione S-transferase family protein; structur 1e-06
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 1e-06
4dej_A231 Glutathione S-transferase related protein; transfe 2e-05
3lyk_A216 Stringent starvation protein A homolog; structural 2e-05
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 5e-05
3lyp_A215 Stringent starvation protein A; structural genomic 6e-05
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 8e-05
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 2e-04
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 8e-04
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 8e-04
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
 Score = 65.5 bits (160), Expect = 4e-14
 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 1/63 (1%)

Query: 1   VDIAYIPFVERFQIFLSEEF-KYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYR 59
            D+A +PF+ R + F+ E    YD+ A  P L    E        KS     ++  E  R
Sbjct: 403 GDVAILPFLVRAKAFMPEFSGGYDLFAHFPLLNGLAEAGMATPEAKSVFRTLEEYKEHIR 462

Query: 60  SRF 62
            R 
Sbjct: 463 KRQ 465


>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 98.68
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 98.4
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 98.31
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 98.26
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 98.26
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 98.21
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 98.2
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 98.19
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 98.17
2r4v_A247 XAP121, chloride intracellular channel protein 2; 98.14
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 98.13
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 98.12
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 98.11
3lxz_A229 Glutathione S-transferase family protein; structur 98.03
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 98.01
2ahe_A267 Chloride intracellular channel protein 4; glutathi 97.98
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 97.94
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 97.84
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 97.68
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 97.65
3lyk_A216 Stringent starvation protein A homolog; structural 97.65
4glt_A225 Glutathione S-transferase-like protein; structural 97.64
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 97.57
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 97.51
4dej_A231 Glutathione S-transferase related protein; transfe 97.48
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 97.45
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 97.33
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 97.32
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 97.26
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 97.21
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 97.18
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 97.17
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 97.1
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 97.08
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 97.04
4gci_A211 Glutathione S-transferase; GST, enzyme function in 97.03
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 97.02
4exj_A238 Uncharacterized protein; transferase-like protein, 97.0
3tou_A226 Glutathione S-transferase protein; GSH binding sit 96.99
3lyp_A215 Stringent starvation protein A; structural genomic 96.96
3n5o_A235 Glutathione transferase; seattle structural genomi 96.93
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 96.93
4ikh_A244 Glutathione S-transferase; enzyme function initiat 96.92
3niv_A222 Glutathione S-transferase; structural genomics, PS 96.92
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 96.92
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 96.9
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 96.9
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 96.9
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 96.88
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 96.83
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 96.71
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 96.71
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 96.7
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 96.7
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 96.64
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 96.61
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 96.58
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 96.58
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 96.57
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 96.57
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 96.57
1r5a_A218 Glutathione transferase; glutathione S-transferase 96.56
2fhe_A216 GST, glutathione S-transferase; transferase-substr 96.56
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 96.55
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 96.54
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 96.54
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 96.51
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 96.49
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 96.49
4ecj_A244 Glutathione S-transferase; transferase-like protei 96.47
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 96.46
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 96.43
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 96.41
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 96.4
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 96.39
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 96.37
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 96.37
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 96.36
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 96.35
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 96.3
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 96.3
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 96.29
1axd_A209 Glutathione S-transferase I; transferase, herbicid 96.25
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 96.24
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 96.23
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 96.22
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 96.18
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 96.18
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 96.17
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 96.15
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 96.13
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 96.1
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 96.03
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 95.97
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 95.96
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 95.88
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 95.85
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 95.8
1f2e_A201 Glutathione S-transferase; GST complexed with glut 95.8
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 95.79
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 95.7
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 95.66
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 95.33
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 95.25
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 95.22
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 95.05
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 95.02
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 94.55
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 93.59
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 92.85
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 87.57
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
Probab=98.68  E-value=4.2e-09  Score=79.12  Aligned_cols=62  Identities=15%  Similarity=0.261  Sum_probs=53.1

Q ss_pred             CcEEeehhHHHHHHHhhhccccccCCCCccHHHHHHHHcCCcchhhcCCChHHHHHHHHHhhhhh
Q 045074            1 VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQ   65 (108)
Q Consensus         1 vDiaiwPwfeRl~vl~~~~~g~~l~ee~PkL~aW~eaM~e~PaVKks~~~~Ekl~ef~k~~~~~~   65 (108)
                      +|++++|++.|+..+. ...++++.+++|+|.+|.++|.++|+||++.  +|++.++++.+..|+
T Consensus       160 ADi~l~p~l~~l~~l~-~~~~~~~~~~~P~l~~w~~r~~~rPa~q~t~--~ee~~~~~~~~~~g~  221 (265)
T 4g10_A          160 AEVAFTPMFKRLWFLD-YYEDYEVPANFDRVLRWRAACTAHPAAQYRS--KEELLKLYYDYTQGG  221 (265)
T ss_dssp             HHHHHHHHHHHTHHHH-HHSCCCCCTTCHHHHHHHHHHHHSGGGCSSC--HHHHHHHTHHHHTTC
T ss_pred             eHHHHHHHHHHHHHHh-hhcCCCccccCHHHHHHHHHHHcCHHHHhhC--cHHHHHHHHHHHcCC
Confidence            5999999999998876 3446777788999999999999999999885  567999999988876



>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 108
d1oyja1145 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat 6e-07
d1eema1139 a.45.1.1 (A:103-241) Class omega GST {Human (Homo 2e-06
d1k0ma1149 a.45.1.1 (A:92-240) Chloride intracellular channel 4e-06
d1gwca1138 a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch 3e-04
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class tau GST
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 42.8 bits (100), Expect = 6e-07
 Identities = 14/61 (22%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 1   VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRS 60
           VD+A +PF   F  +      + +    P+LAAW     ++D+       P+++ +F   
Sbjct: 80  VDVALVPFTAWFYSY-ERCGGFSVEEVAPRLAAWARRCGRIDSVVKHLPSPEKVYDFVGV 138

Query: 61  R 61
            
Sbjct: 139 L 139


>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.39
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.24
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.21
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 98.92
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 97.9
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 97.85
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 97.71
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 97.61
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 97.54
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 97.54
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 97.53
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 97.53
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 97.41
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 97.4
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 97.39
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 97.38
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 97.37
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 97.26
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 97.24
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 97.23
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 97.2
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 97.2
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 97.18
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 97.08
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 97.07
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 96.95
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 96.82
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 96.82
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 96.74
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 96.72
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 96.65
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 96.63
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 96.44
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 96.02
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 95.64
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 95.56
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 92.45
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class tau GST
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.39  E-value=1.6e-14  Score=99.63  Aligned_cols=66  Identities=23%  Similarity=0.383  Sum_probs=59.1

Q ss_pred             CcEEeehhHHHHHHHhhhccccccCCCCccHHHHHHHHcCCcchhhcCCChHHHHHHHHHhhhhhcc
Q 045074            1 VDIAYIPFVERFQIFLSEEFKYDITAGRPKLAAWIEELNKLDAYKSTKADPKQLVEFYRSRFVVQFV   67 (108)
Q Consensus         1 vDiaiwPwfeRl~vl~~~~~g~~l~ee~PkL~aW~eaM~e~PaVKks~~~~Ekl~ef~k~~~~~~~~   67 (108)
                      +|++++||+.|+.+++ ...|+++.+++|+|.+|.++|.++|+||++++++|++.+|++.+++..++
T Consensus        80 ~Di~~~p~~~~~~~~~-~~~g~~~~~~~P~l~~W~~rl~~rpavk~~lp~~e~~~e~~~~~~~~~~~  145 (145)
T d1oyja1          80 VDVALVPFTAWFYSYE-RCGGFSVEEVAPRLAAWARRCGRIDSVVKHLPSPEKVYDFVGVLKKKYGV  145 (145)
T ss_dssp             HHHHHGGGGGGHHHHH-HHHTCCHHHHCHHHHHHHHHHTTSHHHHHHCCCHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHhHHHHHHHHHH-HhhcccccccCHHHHHHHHHHhCChHHHHHCCCHHHHHHHHHHHHHHhCc
Confidence            5999999999999887 35577777788999999999999999999999999999999999887653



>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure