Citrus Sinensis ID: 045115

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVESDGSPGASPSAAPGQSPTTSSTSSGGSASTVPPGGGSGSTPPSSSSALLPYSLHTFLAAPGMLAVLLAGFA
cccEEEEcHHHHcccccccccccccccccEEEcccccEEEEEcccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcc
cccEEEEcHHHHHHccccccccEccccccEEEccccccEEEEEccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcc
mhdvhevteADYVACNAKASikhhisgsdaitlnapgiyyficgipghcqagqrlrievesdgspgaspsaapgqspttsstssggsastvppgggsgstppssssallpyslhtFLAAPGMLAVLLAGFA
MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVESDGSPGASPSAAPGQSPTTSSTSSGGSASTVPPGGGSGSTPPSSSSALLPYSLHTFLAAPGMLAVLLAGFA
MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVESDgspgaspsaapgqspttsstssggsastvppgggsgstppssssaLLPYSLHTFLAAPGMLAVLLAGFA
*******TEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLR***************************************************LLPYSLHTFLAAPGMLAVLLAG**
MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIE*****************************************************SLHTFLAAPGMLAVLLAGFA
********EADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEV**********************************************SALLPYSLHTFLAAPGMLAVLLAGFA
*HDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVESD********************************************ALLPYSLHTFLAAPGMLAVLLAGFA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVESDGSPGASPSAAPGQSPTTSSTSSGGSASTVPPGGGSGSTPPSSSSALLPYSLHTFLAAPGMLAVLLAGFA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.488 0.592 0.426 7e-12
Q9T076 349 Early nodulin-like protei no no 0.793 0.297 0.388 8e-10
Q07488196 Blue copper protein OS=Ar no no 0.809 0.540 0.378 1e-09
P00302107 Stellacyanin OS=Toxicoden N/A no 0.450 0.551 0.389 2e-08
Q41001189 Blue copper protein OS=Pi N/A no 0.450 0.312 0.440 2e-08
P93328180 Early nodulin-16 OS=Medic N/A no 0.442 0.322 0.362 4e-07
O80517202 Uclacyanin-2 OS=Arabidops no no 0.442 0.287 0.416 6e-07
P0030396 Basic blue protein OS=Cuc N/A no 0.435 0.593 0.413 2e-06
Q9SK27182 Early nodulin-like protei no no 0.534 0.384 0.357 4e-06
Q05544137 Early nodulin-55-1 (Fragm no no 0.458 0.437 0.369 2e-05
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function desciption
 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 1   MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVE 60
            H+V +V +  + +CN+ +    + SG+D+I L  PG +YF+CGIPGHCQ GQ++ I+V+
Sbjct: 43  FHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVD 102

Query: 61  SDGSPGAS 68
               PG+S
Sbjct: 103 ----PGSS 106

Cucurbita pepo (taxid: 3663)
>sp|Q9T076|ENL2_ARATH Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P93328|NO16_MEDTR Early nodulin-16 OS=Medicago truncatula GN=ENOD16 PE=3 SV=1 Back     alignment and function description
>sp|O80517|BCB2_ARATH Uclacyanin-2 OS=Arabidopsis thaliana GN=At2g44790 PE=1 SV=1 Back     alignment and function description
>sp|P00303|BABL_CUCSA Basic blue protein OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|Q05544|NO551_SOYBN Early nodulin-55-1 (Fragment) OS=Glycine max GN=ENOD55-1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
319433445200 copper binding protein 5 [Gossypium hirs 0.595 0.39 0.493 5e-13
297817658174 hypothetical protein ARALYDRAFT_907902 [ 0.557 0.419 0.445 7e-12
297826553186 hypothetical protein ARALYDRAFT_902137 [ 0.893 0.629 0.358 2e-11
413932719206 hypothetical protein ZEAMMB73_189474, pa 0.801 0.509 0.447 2e-11
223948621174 unknown [Zea mays] gi|414884648|tpg|DAA6 0.442 0.333 0.534 2e-11
326512894206 predicted protein [Hordeum vulgare subsp 0.450 0.286 0.491 2e-11
357150404190 PREDICTED: mavicyanin-like [Brachypodium 0.931 0.642 0.356 2e-11
326496352206 predicted protein [Hordeum vulgare subsp 0.450 0.286 0.491 2e-11
226505206174 blue copper protein precursor [Zea mays] 0.442 0.333 0.534 3e-11
242037707216 hypothetical protein SORBIDRAFT_01g00432 0.450 0.273 0.508 3e-11
>gi|319433445|gb|ADV57640.1| copper binding protein 5 [Gossypium hirsutum] Back     alignment and taxonomy information
 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 2   HDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVES 61
           HDV EVTE  Y AC    +I    +G   ITLN  G +YFIC +PGHC  GQ+L +EV  
Sbjct: 70  HDVAEVTETAYDACTTANTISTVSTGPARITLNRTGEFYFICAVPGHCSGGQKLNVEVR- 128

Query: 62  DGSPGASPSAAPGQSPTTS 80
           +G+ G +   APG SPTT+
Sbjct: 129 NGNNGTAAVPAPGPSPTTT 147

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297817658|ref|XP_002876712.1| hypothetical protein ARALYDRAFT_907902 [Arabidopsis lyrata subsp. lyrata] gi|297322550|gb|EFH52971.1| hypothetical protein ARALYDRAFT_907902 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297826553|ref|XP_002881159.1| hypothetical protein ARALYDRAFT_902137 [Arabidopsis lyrata subsp. lyrata] gi|297326998|gb|EFH57418.1| hypothetical protein ARALYDRAFT_902137 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|413932719|gb|AFW67270.1| hypothetical protein ZEAMMB73_189474, partial [Zea mays] Back     alignment and taxonomy information
>gi|223948621|gb|ACN28394.1| unknown [Zea mays] gi|414884648|tpg|DAA60662.1| TPA: blue copper protein [Zea mays] Back     alignment and taxonomy information
>gi|326512894|dbj|BAK03354.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357150404|ref|XP_003575447.1| PREDICTED: mavicyanin-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326496352|dbj|BAJ94638.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|226505206|ref|NP_001152010.1| blue copper protein precursor [Zea mays] gi|195651823|gb|ACG45379.1| blue copper protein precursor [Zea mays] Back     alignment and taxonomy information
>gi|242037707|ref|XP_002466248.1| hypothetical protein SORBIDRAFT_01g004320 [Sorghum bicolor] gi|241920102|gb|EER93246.1| hypothetical protein SORBIDRAFT_01g004320 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.442 0.281 0.482 5.6e-13
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.442 0.29 0.482 6.4e-12
TAIR|locus:2206986181 AT1G72230 [Arabidopsis thalian 0.442 0.320 0.482 3.5e-11
TAIR|locus:2009552174 AT1G22480 [Arabidopsis thalian 0.465 0.350 0.491 9.4e-11
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.442 0.310 0.448 5.2e-10
TAIR|locus:2062525261 UCC1 "uclacyanin 1" [Arabidops 0.442 0.222 0.413 3.8e-09
TAIR|locus:2124958210 AT4G01380 [Arabidopsis thalian 0.450 0.280 0.377 1.7e-08
TAIR|locus:2042426202 UCC2 "uclacyanin 2" [Arabidops 0.442 0.287 0.416 4.2e-08
TAIR|locus:504956334192 AT5G07475 [Arabidopsis thalian 0.465 0.317 0.377 4.2e-08
TAIR|locus:2086518174 AT3G27200 [Arabidopsis thalian 0.465 0.350 0.354 1.4e-07
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 171 (65.3 bits), Expect = 5.6e-13, P = 5.6e-13
 Identities = 28/58 (48%), Positives = 42/58 (72%)

Query:     2 HDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEV 59
             HDV EVT  D+  C +   ++ + +GSD+I+L  PG+ +FICG+PGHC+ GQ+L+I V
Sbjct:    68 HDVTEVTHNDFEMCESSKPLRRYKTGSDSISLTKPGLQHFICGVPGHCKKGQKLQIHV 125
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206986 AT1G72230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009552 AT1G22480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062525 UCC1 "uclacyanin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124958 AT4G01380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042426 UCC2 "uclacyanin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956334 AT5G07475 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086518 AT3G27200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 2e-24
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 4e-08
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score = 88.9 bits (221), Expect = 2e-24
 Identities = 28/53 (52%), Positives = 38/53 (71%)

Query: 1  MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQ 53
           H+V EVT+ADY +CN    I+ + +G+D I L  PG +YFICG+PGHC+ GQ
Sbjct: 32 FHNVVEVTKADYESCNTSKPIRTYTTGNDIIPLTKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
PLN03148167 Blue copper-like protein; Provisional 99.93
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.83
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 97.22
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 96.87
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 96.63
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 96.62
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.17
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 96.05
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 95.76
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 95.59
COG3794128 PetE Plastocyanin [Energy production and conversio 95.35
PRK02710119 plastocyanin; Provisional 95.27
COG4454158 Uncharacterized copper-binding protein [Inorganic 94.69
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 94.3
TIGR0265783 amicyanin amicyanin. Members of this family are am 90.51
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 84.76
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=99.93  E-value=1.2e-25  Score=174.31  Aligned_cols=60  Identities=37%  Similarity=0.696  Sum_probs=57.6

Q ss_pred             CCceEEeChhhcccccCCCCccccccCCcEEEcccCceeEEEcCCCCcccCCCeEEEEEec
Q 045115            1 MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVES   61 (131)
Q Consensus         1 ~HnV~eV~k~dY~~C~~~~pi~~~ssG~~~v~L~~~G~~YFICgv~gHC~~GmKLaI~V~~   61 (131)
                      +|||+||+|++||+|+.++++..|++|++.|+|+++|+|||||+ .+||++||||+|+|..
T Consensus        60 ~hnV~~V~~~~Y~~C~~~~pi~~~tsG~d~v~L~~~G~~YFIcg-~ghC~~GmKl~I~V~~  119 (167)
T PLN03148         60 QYNVFEVNQTGYDNCTTEGAAGNWTSGKDFIPLNKAKRYYFICG-NGQCFNGMKVTILVHP  119 (167)
T ss_pred             CceEEEEChHHcCcccCCCCcceecCCCcEEEecCCccEEEEcC-CCccccCCEEEEEEcC
Confidence            49999999999999999999999999999999999999999999 5999999999999963

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 4e-13
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 6e-08
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 2e-06
1f56_A91 Spinach Plantacyanin Length = 91 1e-05
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 5e-04
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure 
Iteration: 1

 Score = 69.7 bits (169), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%)
Query: 1   MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVE 60
            H+V +V +  + +CN+ +    + SG+D+I L  PG +YF+CGIPGHCQ GQ++ I+V+
Sbjct: 44  FHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVD 103
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 7e-25
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 2e-24
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 9e-24
2cbp_A96 Cucumber basic protein; electron transport, phytoc 3e-21
1jer_A138 Cucumber stellacyanin; electron transport, copper, 3e-18
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 6e-04
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
 Score = 90.4 bits (224), Expect = 7e-25
 Identities = 25/72 (34%), Positives = 34/72 (47%)

Query: 1   MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVE 60
           MHDV  VT+  +  C  +  I H  +    I LN  G  Y+IC +  HC+ GQ+L I V 
Sbjct: 44  MHDVAVVTKDAFDNCKKENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVV 103

Query: 61  SDGSPGASPSAA 72
             G  G   +  
Sbjct: 104 GAGGAGGGATPG 115
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Length = 140 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
1jer_A138 Cucumber stellacyanin; electron transport, copper, 99.93
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 99.92
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 99.91
2cbp_A96 Cucumber basic protein; electron transport, phytoc 99.89
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 99.89
2cal_A154 Rusticyanin; iron respiratory electron transport c 98.85
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 98.74
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.43
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.11
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 97.97
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.96
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 97.91
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 97.85
1byp_A99 Protein (plastocyanin); electron transfer, photosy 97.79
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 97.73
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 97.72
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 97.55
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 97.52
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 97.49
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 97.47
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 97.44
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 97.41
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 97.38
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 97.37
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 97.32
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.32
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 97.23
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 97.19
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 97.13
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.03
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 96.74
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 96.7
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 96.36
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 96.27
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 95.84
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 95.61
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 95.48
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 95.48
3c75_A132 Amicyanin; copper proteins, electron transfer comp 94.97
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 94.71
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 94.53
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 94.32
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 94.27
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 88.46
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 87.39
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 85.48
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 83.59
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 82.45
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=99.93  E-value=1.1e-26  Score=173.62  Aligned_cols=66  Identities=33%  Similarity=0.570  Sum_probs=61.0

Q ss_pred             CCceEEe-ChhhcccccCCCCccccccCCcEEEc-ccCceeEEEcCCCCcccCCCeEEEEEecCCCCC
Q 045115            1 MHDVHEV-TEADYVACNAKASIKHHISGSDAITL-NAPGIYYFICGIPGHCQAGQRLRIEVESDGSPG   66 (131)
Q Consensus         1 ~HnV~eV-~k~dY~~C~~~~pi~~~ssG~~~v~L-~~~G~~YFICgv~gHC~~GmKLaI~V~~~~s~~   66 (131)
                      .|||+|| +|++|+.|+..+++..+++|+++|+| +++|.+||||++++||++||||+|+|....+++
T Consensus        46 ~HsV~~V~~~~~y~~C~~s~p~~~~~~G~~~v~L~~~~G~~YFicg~~gHC~~GmKl~I~V~~~~~~~  113 (138)
T 1jer_A           46 AHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSINVVAANATV  113 (138)
T ss_dssp             TCCCEEESCHHHHHHTCCTTSCCCCCCCSCEEEECCSSEEEEEECCSTTTGGGTCEEEEEEECCC---
T ss_pred             CceEEEeCchhhcCccCCCCccccccCCCeEEEeccCCcCEEEEcCCCCccccCCEEEEEEcCCCCCC
Confidence            4999999 99999999999999999999999999 999999999999999999999999999876543
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 3e-22
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 1e-21
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 4e-20
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 1e-15
d1qhqa_139 b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus 5e-04
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

 Score = 82.2 bits (203), Expect = 3e-22
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 1  MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEV 59
          MH+V  V +  +  CN  A  K + SG D I L   G  YFIC  PGHCQ+G ++ +  
Sbjct: 38 MHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLP-KGQSYFICNFPGHCQSGMKIAVNA 95
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 99.9
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.87
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 99.87
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 99.82
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 97.94
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 97.87
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 97.82
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 97.82
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 97.77
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 97.66
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 97.58
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 97.5
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.48
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 97.47
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 97.42
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 97.41
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 97.36
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 97.31
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 97.27
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 97.21
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.17
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.12
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.09
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 96.87
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 96.11
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 96.0
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 95.89
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 95.74
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 95.72
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 93.96
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 93.22
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 92.65
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 87.32
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 80.07
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

Probab=99.90  E-value=1.5e-24  Score=152.03  Aligned_cols=59  Identities=41%  Similarity=0.792  Sum_probs=56.8

Q ss_pred             CCceEEeChhhcccccCCCCccccccCCcEEEcccCceeEEEcCCCCcccCCCeEEEEEe
Q 045115            1 MHDVHEVTEADYVACNAKASIKHHISGSDAITLNAPGIYYFICGIPGHCQAGQRLRIEVE   60 (131)
Q Consensus         1 ~HnV~eV~k~dY~~C~~~~pi~~~ssG~~~v~L~~~G~~YFICgv~gHC~~GmKLaI~V~   60 (131)
                      .|||+||+|++|++|+.++++..+++|++.|+|++ |++||||++++||++||||+|+|+
T Consensus        38 ~h~V~~V~~~~Y~~C~~~~~~~~~~~G~~~v~L~~-G~~YFic~~~~hC~~G~Kl~V~Vl   96 (96)
T d2cbpa_          38 MHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLPK-GQSYFICNFPGHCQSGMKIAVNAL   96 (96)
T ss_dssp             TCCEEEECHHHHHHTCCCTTCEEECSSEEEEECCS-EEEEEECCSTTTGGGTCEEEEEEC
T ss_pred             CceEEEEChHHcCccCCCCCcccccCCCeEEEeCC-CCCEEEeCCCCcCcCCCEEEEEEC
Confidence            49999999999999999999999999999999986 999999999999999999999985
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure