Citrus Sinensis ID: 045172
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 157 | ||||||
| 224074705 | 300 | predicted protein [Populus trichocarpa] | 0.993 | 0.52 | 0.698 | 2e-56 | |
| 255537067 | 375 | nucleic acid binding protein, putative [ | 1.0 | 0.418 | 0.687 | 3e-55 | |
| 255537065 | 294 | nucleic acid binding protein, putative [ | 1.0 | 0.534 | 0.687 | 1e-54 | |
| 357462889 | 411 | hypothetical protein MTR_3g084750 [Medic | 1.0 | 0.381 | 0.651 | 5e-52 | |
| 356538069 | 393 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.399 | 0.643 | 1e-51 | |
| 356569166 | 356 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.441 | 0.624 | 3e-50 | |
| 449494370 | 368 | PREDICTED: uncharacterized LOC101211196 | 0.993 | 0.423 | 0.634 | 2e-49 | |
| 449460491 | 367 | PREDICTED: uncharacterized protein LOC10 | 0.987 | 0.422 | 0.628 | 2e-47 | |
| 297809527 | 365 | zinc finger family protein [Arabidopsis | 1.0 | 0.430 | 0.573 | 8e-46 | |
| 15234485 | 364 | C2H2 type zinc finger protein [Arabidops | 1.0 | 0.431 | 0.566 | 4e-45 |
| >gi|224074705|ref|XP_002304433.1| predicted protein [Populus trichocarpa] gi|222841865|gb|EEE79412.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 223 bits (569), Expect = 2e-56, Method: Compositional matrix adjust.
Identities = 109/156 (69%), Positives = 129/156 (82%)
Query: 2 FYNNDKLVNHFRQIHEGEQKKRSNQIESARGKVRVLLVGNYSIKMEKNKMAASAILTPKV 61
FYNN+K +NHF+QIHE EQ+KR NQIESARGK RV+LVG Y++KM+K K AA ILTPKV
Sbjct: 51 FYNNEKFINHFKQIHEREQQKRLNQIESARGKRRVMLVGKYAMKMQKYKNAARDILTPKV 110
Query: 62 GYGFADELKRAWFWVRMVLVKPQDADVLLRNYMVAMVDKRRFGCLVVVSDDSDFVEVFQE 121
GYG ADELKRA FWVR VL KPQ ADV L+++MV M+DKRR C V+VSDDSDFV V +E
Sbjct: 111 GYGLADELKRAGFWVRTVLDKPQAADVALKDHMVDMMDKRRAECFVLVSDDSDFVHVLKE 170
Query: 122 ATLRWLKMVVVGDMSDGALKRIANAFFSWSDLLMGK 157
A R LK VVVGD++DGALKR+A+A FSW ++LMGK
Sbjct: 171 AKSRCLKTVVVGDVNDGALKRVADAGFSWQEILMGK 206
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255537067|ref|XP_002509600.1| nucleic acid binding protein, putative [Ricinus communis] gi|223549499|gb|EEF50987.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255537065|ref|XP_002509599.1| nucleic acid binding protein, putative [Ricinus communis] gi|223549498|gb|EEF50986.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357462889|ref|XP_003601726.1| hypothetical protein MTR_3g084750 [Medicago truncatula] gi|355490774|gb|AES71977.1| hypothetical protein MTR_3g084750 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356538069|ref|XP_003537527.1| PREDICTED: uncharacterized protein LOC100785257 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356569166|ref|XP_003552776.1| PREDICTED: uncharacterized protein LOC100789840 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449494370|ref|XP_004159528.1| PREDICTED: uncharacterized LOC101211196 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449460491|ref|XP_004147979.1| PREDICTED: uncharacterized protein LOC101211196 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297809527|ref|XP_002872647.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297318484|gb|EFH48906.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15234485|ref|NP_192961.1| C2H2 type zinc finger protein [Arabidopsis thaliana] gi|5281035|emb|CAB45971.1| hypothetical proteins [Arabidopsis thaliana] gi|7267925|emb|CAB78267.1| hypothetical proteins [Arabidopsis thaliana] gi|26452877|dbj|BAC43517.1| unknown protein [Arabidopsis thaliana] gi|28973009|gb|AAO63829.1| unknown protein [Arabidopsis thaliana] gi|332657707|gb|AEE83107.1| C2H2 type zinc finger protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 157 | ||||||
| TAIR|locus:2139119 | 364 | AT4G12240 "AT4G12240" [Arabido | 1.0 | 0.431 | 0.515 | 9.9e-39 | |
| TAIR|locus:2173038 | 396 | AT5G52010 "AT5G52010" [Arabido | 0.955 | 0.378 | 0.363 | 1.3e-14 |
| TAIR|locus:2139119 AT4G12240 "AT4G12240" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 414 (150.8 bits), Expect = 9.9e-39, P = 9.9e-39
Identities = 81/157 (51%), Positives = 106/157 (67%)
Query: 1 RFYNNDKLVNHFRQIHEGEQKKRSNQIESARGKVRVLLVGNYSIKMEKNKMAASAILTPK 60
RFY N+KL+NHF+QIHE E +KR QIES++G RV LV YS+K+EK K AA +LTPK
Sbjct: 125 RFYTNEKLINHFKQIHETENQKRMRQIESSKGHRRVRLVAKYSMKIEKYKRAARNVLTPK 184
Query: 61 VGYGFADELKRAWFWVRMVLVKPQDADVLLRNYMVAMVDKRRFGCLXXXXXXXXXXXXXQ 120
GYG ADELKRA FWV+MV KP AD L+ ++V ++DKR C+
Sbjct: 185 EGYGLADELKRAGFWVKMVSDKPDAADKALKEHLVEVMDKREVECVVLVSDDSDFAGILW 244
Query: 121 EATLRWLKMVVVGDMSDGALKRIANAFFSWSDLLMGK 157
EA R L+ VV+GD ++GALKR+A+ +SW ++ MGK
Sbjct: 245 EAKERCLRTVVIGDSNEGALKRVADVAYSWKEVTMGK 281
|
|
| TAIR|locus:2173038 AT5G52010 "AT5G52010" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 157 | |||
| cd06167 | 151 | cd06167, LabA_like, LabA_like proteins | 2e-06 |
| >gnl|CDD|199895 cd06167, LabA_like, LabA_like proteins | Back alignment and domain information |
|---|
Score = 44.4 bits (105), Expect = 2e-06
Identities = 28/106 (26%), Positives = 43/106 (40%), Gaps = 6/106 (5%)
Query: 52 AASAILTPKVGYGFADELKRAWFWVRMVL-----VKPQDADVLLRNYMVAMVDKRRFGCL 106
+A P F + L+R F V V + + DV L + + +RR +
Sbjct: 47 YNTARPDPSSPDRFQEALRRLGFEVIRVPRLRGKGEEKGVDVALALDALELAYERRIDTI 106
Query: 107 VVVSDDSDFVEVFQEATLRWLKMVVVGDMSDGALKRIANAFFSWSD 152
V+VS DSDFV + + K V+V A + NA + D
Sbjct: 107 VLVSGDSDFVPLLERL-RERGKRVIVVGFRRSASSALKNAADEFID 151
|
A well conserved group of domains found in all three kingdoms of life, with no defined function. LabA, a member from Synechococcus elongatus PCC 7942, has been shown to play a role in cyanobacterial circadian timing. It is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system. In particular, LabA seems necessary for KaiC-dependent repression of gene expression. Another member is the N-terminal domain of limkain b1, a human autoantigen associated with cytoplasmic vesicles. Curiously, a gene labeled NicB from Pseudomonas putida S16, which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls in the LabA_like family. LabA_like domains exhibit some similarity to the NYN domain, a distant relative of the PIN-domain nucleases. Length = 151 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| cd06167 | 149 | LabA_like LabA_like proteins. A well conserved gro | 99.5 | |
| TIGR00288 | 160 | conserved hypothetical protein TIGR00288. This fam | 99.48 | |
| PF01936 | 146 | NYN: NYN domain; InterPro: IPR021139 This highly c | 99.43 | |
| COG1432 | 181 | Uncharacterized conserved protein [Function unknow | 98.45 | |
| cd01545 | 270 | PBP1_SalR Ligand-binding domain of DNA transcripti | 96.24 | |
| cd05013 | 139 | SIS_RpiR RpiR-like protein. RpiR contains a SIS (S | 96.22 | |
| cd06305 | 273 | PBP1_methylthioribose_binding_like Methylthioribos | 96.0 | |
| cd01542 | 259 | PBP1_TreR_like Ligand-binding domain of DNA transc | 95.66 | |
| cd05014 | 128 | SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5 | 95.62 | |
| cd06295 | 275 | PBP1_CelR Ligand binding domain of a transcription | 95.6 | |
| TIGR02634 | 302 | xylF D-xylose ABC transporter, substrate-binding p | 95.59 | |
| cd06312 | 271 | PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi | 95.57 | |
| PF13407 | 257 | Peripla_BP_4: Periplasmic binding protein domain; | 95.38 | |
| cd06318 | 282 | PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi | 95.29 | |
| cd06324 | 305 | PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b | 95.25 | |
| PRK15482 | 285 | transcriptional regulator MurR; Provisional | 95.12 | |
| cd06303 | 280 | PBP1_LuxPQ_Quorum_Sensing Periplasmic binding prot | 95.12 | |
| cd06270 | 268 | PBP1_GalS_like Ligand binding domain of DNA transc | 95.05 | |
| cd06282 | 266 | PBP1_GntR_like_2 Ligand-binding domain of putative | 95.01 | |
| PRK15408 | 336 | autoinducer 2-binding protein lsrB; Provisional | 94.94 | |
| cd06281 | 269 | PBP1_LacI_like_5 Ligand-binding domain of uncharac | 94.91 | |
| cd06306 | 268 | PBP1_TorT-like TorT-like proteins, a periplasmic b | 94.91 | |
| cd06316 | 294 | PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-bi | 94.79 | |
| cd06302 | 298 | PBP1_LsrB_Quorum_Sensing Periplasmic binding domai | 94.74 | |
| cd06294 | 270 | PBP1_ycjW_transcription_regulator_like Ligand-bind | 94.74 | |
| PF01380 | 131 | SIS: SIS domain SIS domain web page.; InterPro: IP | 94.71 | |
| cd06313 | 272 | PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi | 94.66 | |
| cd01539 | 303 | PBP1_GGBP Periplasmic glucose/galactose-binding pr | 94.65 | |
| cd01540 | 289 | PBP1_arabinose_binding Periplasmic L-arabinose-bin | 94.6 | |
| cd06299 | 265 | PBP1_LacI_like_13 Ligand-binding domain of DNA-bin | 94.57 | |
| PRK10653 | 295 | D-ribose transporter subunit RbsB; Provisional | 94.51 | |
| PF00532 | 279 | Peripla_BP_1: Periplasmic binding proteins and sug | 94.51 | |
| cd01541 | 273 | PBP1_AraR Ligand-binding domain of DNA transcripti | 94.49 | |
| cd06322 | 267 | PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b | 94.47 | |
| cd06314 | 271 | PBP1_tmGBP Periplasmic sugar-binding domain of The | 94.45 | |
| cd06320 | 275 | PBP1_allose_binding Periplasmic allose-binding dom | 94.42 | |
| cd01538 | 288 | PBP1_ABC_xylose_binding Periplasmic xylose-binding | 94.42 | |
| TIGR02637 | 302 | RhaS rhamnose ABC transporter, rhamnose-binding pr | 94.4 | |
| cd06289 | 268 | PBP1_MalI_like Ligand-binding domain of MalI, a tr | 94.27 | |
| cd06323 | 268 | PBP1_ribose_binding Periplasmic sugar-binding doma | 94.2 | |
| PRK10014 | 342 | DNA-binding transcriptional repressor MalI; Provis | 94.17 | |
| cd05008 | 126 | SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repea | 94.15 | |
| cd06310 | 273 | PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi | 94.15 | |
| cd06317 | 275 | PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi | 94.09 | |
| cd06308 | 270 | PBP1_sensor_kinase_like Periplasmic binding domain | 93.98 | |
| cd06273 | 268 | PBP1_GntR_like_1 This group includes the ligand-bi | 93.98 | |
| cd06315 | 280 | PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-bi | 93.94 | |
| cd06285 | 265 | PBP1_LacI_like_7 Ligand-binding domain of uncharac | 93.93 | |
| cd06292 | 273 | PBP1_LacI_like_10 Ligand-binding domain of unchara | 93.91 | |
| cd06301 | 272 | PBP1_rhizopine_binding_like Periplasmic binding pr | 93.8 | |
| cd06296 | 270 | PBP1_CatR_like Ligand-binding domain of a LacI-lik | 93.8 | |
| cd06321 | 271 | PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b | 93.78 | |
| cd06311 | 274 | PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi | 93.71 | |
| cd01575 | 268 | PBP1_GntR Ligand-binding domain of DNA transcripti | 93.62 | |
| cd05005 | 179 | SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI | 93.57 | |
| cd06277 | 268 | PBP1_LacI_like_1 Ligand-binding domain of uncharac | 93.56 | |
| cd06298 | 268 | PBP1_CcpA_like Ligand-binding domain of the catabo | 93.55 | |
| cd06278 | 266 | PBP1_LacI_like_2 Ligand-binding domain of uncharac | 93.52 | |
| cd06319 | 277 | PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b | 93.5 | |
| TIGR02417 | 327 | fruct_sucro_rep D-fructose-responsive transcriptio | 93.45 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 93.38 | |
| PRK10355 | 330 | xylF D-xylose transporter subunit XylF; Provisiona | 93.38 | |
| PRK09701 | 311 | D-allose transporter subunit; Provisional | 93.36 | |
| cd06309 | 273 | PBP1_YtfQ_like Periplasmic binding domain of ABC-t | 93.35 | |
| cd06271 | 268 | PBP1_AglR_RafR_like Ligand-binding domain of DNA t | 93.1 | |
| PRK11557 | 278 | putative DNA-binding transcriptional regulator; Pr | 93.06 | |
| TIGR03590 | 279 | PseG pseudaminic acid biosynthesis-associated prot | 92.77 | |
| cd06297 | 269 | PBP1_LacI_like_12 Ligand-binding domain of unchara | 92.74 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 92.68 | |
| cd06283 | 267 | PBP1_RegR_EndR_KdgR_like Ligand-binding domain of | 92.65 | |
| PRK10936 | 343 | TMAO reductase system periplasmic protein TorT; Pr | 92.6 | |
| PRK14987 | 331 | gluconate operon transcriptional regulator; Provis | 92.56 | |
| cd06293 | 269 | PBP1_LacI_like_11 Ligand-binding domain of unchara | 92.45 | |
| cd06274 | 264 | PBP1_FruR Ligand binding domain of DNA transcripti | 92.32 | |
| cd05710 | 120 | SIS_1 A subgroup of the SIS domain. SIS (Sugar ISo | 92.25 | |
| TIGR00441 | 154 | gmhA phosphoheptose isomerase. Involved in lipopol | 92.08 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 91.98 | |
| TIGR03127 | 179 | RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of | 91.82 | |
| PRK11303 | 328 | DNA-binding transcriptional regulator FruR; Provis | 91.82 | |
| cd06300 | 272 | PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi | 91.79 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 91.73 | |
| cd01536 | 267 | PBP1_ABC_sugar_binding_like Periplasmic sugar-bind | 91.38 | |
| cd06267 | 264 | PBP1_LacI_sugar_binding_like Ligand binding domain | 91.29 | |
| cd01574 | 264 | PBP1_LacI Ligand-binding domain of DNA transcripti | 91.23 | |
| PRK12342 | 254 | hypothetical protein; Provisional | 91.22 | |
| cd06307 | 275 | PBP1_uncharacterized_sugar_binding Periplasmic sug | 91.15 | |
| cd06291 | 265 | PBP1_Qymf_like Ligand binding domain of the lacI-l | 91.13 | |
| cd06290 | 265 | PBP1_LacI_like_9 Ligand-binding domain of uncharac | 91.11 | |
| PRK11337 | 292 | DNA-binding transcriptional repressor RpiR; Provis | 91.09 | |
| cd05006 | 177 | SIS_GmhA Phosphoheptose isomerase is a member of t | 90.8 | |
| TIGR02955 | 295 | TMAO_TorT TMAO reductase system periplasmic protei | 90.67 | |
| PRK13937 | 188 | phosphoheptose isomerase; Provisional | 90.61 | |
| cd01537 | 264 | PBP1_Repressors_Sugar_Binding_like Ligand-binding | 90.52 | |
| PRK15395 | 330 | methyl-galactoside ABC transporter galactose-bindi | 90.4 | |
| COG1609 | 333 | PurR Transcriptional regulators [Transcription] | 90.22 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 90.18 | |
| TIGR01481 | 329 | ccpA catabolite control protein A. Catabolite cont | 89.99 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 89.83 | |
| cd06284 | 267 | PBP1_LacI_like_6 Ligand-binding domain of an uncha | 89.82 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 89.66 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 89.63 | |
| cd06279 | 283 | PBP1_LacI_like_3 Ligand-binding domain of uncharac | 89.52 | |
| PRK13936 | 197 | phosphoheptose isomerase; Provisional | 89.26 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 89.16 | |
| cd06360 | 336 | PBP1_alkylbenzenes_like Type I periplasmic binding | 88.81 | |
| cd06347 | 334 | PBP1_ABC_ligand_binding_like_12 Type I periplasmic | 88.72 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 88.69 | |
| cd06361 | 403 | PBP1_GPC6A_like Ligand-binding domain of the promi | 88.54 | |
| cd06280 | 263 | PBP1_LacI_like_4 Ligand-binding domain of uncharac | 88.54 | |
| COG1737 | 281 | RpiR Transcriptional regulators [Transcription] | 88.49 | |
| cd06275 | 269 | PBP1_PurR Ligand-binding domain of purine represso | 88.44 | |
| cd06272 | 261 | PBP1_hexuronate_repressor_like Ligand-binding doma | 88.36 | |
| PRK00414 | 192 | gmhA phosphoheptose isomerase; Reviewed | 88.28 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 87.98 | |
| PRK10423 | 327 | transcriptional repressor RbsR; Provisional | 87.94 | |
| cd06342 | 334 | PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind | 87.06 | |
| cd06304 | 260 | PBP1_BmpA_like Periplasmic binding component of a | 87.03 | |
| PRK10703 | 341 | DNA-binding transcriptional repressor PurR; Provis | 86.92 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 86.87 | |
| cd06286 | 260 | PBP1_CcpB_like Ligand-binding domain of a novel tr | 86.42 | |
| TIGR00147 | 293 | lipid kinase, YegS/Rv2252/BmrU family. The E. coli | 86.34 | |
| cd06330 | 346 | PBP1_Arsenic_SBP_like Periplasmic solute-binding d | 86.29 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 86.25 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 86.1 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 86.03 | |
| PF04123 | 344 | DUF373: Domain of unknown function (DUF373); Inter | 85.99 | |
| PRK07239 | 381 | bifunctional uroporphyrinogen-III synthetase/respo | 85.82 | |
| cd04509 | 299 | PBP1_ABC_transporter_GCPR_C_like Family C of G-pro | 85.79 | |
| PF02310 | 121 | B12-binding: B12 binding domain; InterPro: IPR0061 | 85.63 | |
| cd01391 | 269 | Periplasmic_Binding_Protein_Type_1 Type 1 periplas | 85.56 | |
| COG1879 | 322 | RbsB ABC-type sugar transport system, periplasmic | 85.56 | |
| PRK14101 | 638 | bifunctional glucokinase/RpiR family transcription | 85.43 | |
| PRK13938 | 196 | phosphoheptose isomerase; Provisional | 85.33 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 85.3 | |
| cd06276 | 247 | PBP1_FucR_like Ligand-binding domain of a transcri | 85.26 | |
| PRK02947 | 246 | hypothetical protein; Provisional | 85.21 | |
| cd06268 | 298 | PBP1_ABC_transporter_LIVBP_like Periplasmic bindin | 85.1 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 85.07 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 85.04 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 84.76 | |
| PF15608 | 100 | PELOTA_1: PELOTA RNA binding domain | 84.56 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 84.51 | |
| cd06337 | 357 | PBP1_ABC_ligand_binding_like_4 Type I periplasmic | 84.46 | |
| cd06354 | 265 | PBP1_BmpA_PnrA_like Periplasmic binding domain of | 84.38 | |
| PRK11302 | 284 | DNA-binding transcriptional regulator HexR; Provis | 84.2 | |
| cd08189 | 374 | Fe-ADH5 Iron-containing alcohol dehydrogenases-lik | 83.63 | |
| cd06346 | 312 | PBP1_ABC_ligand_binding_like_11 Type I periplasmic | 83.62 | |
| cd06288 | 269 | PBP1_sucrose_transcription_regulator Ligand-bindin | 83.6 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 83.59 | |
| cd08185 | 380 | Fe-ADH1 Iron-containing alcohol dehydrogenases-lik | 83.54 | |
| cd06269 | 298 | PBP1_glutamate_receptors_like Family C G-protein c | 83.46 | |
| cd06375 | 458 | PBP1_mGluR_groupII Ligand binding domain of the gr | 83.28 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 83.21 | |
| cd06287 | 269 | PBP1_LacI_like_8 Ligand-binding domain of uncharac | 83.11 | |
| cd08188 | 377 | Fe-ADH4 Iron-containing alcohol dehydrogenases-lik | 82.72 | |
| cd06350 | 348 | PBP1_GPCR_family_C_like Ligand-binding domain of m | 82.56 | |
| cd06335 | 347 | PBP1_ABC_ligand_binding_like_2 Type I periplasmic | 82.53 | |
| PRK05441 | 299 | murQ N-acetylmuramic acid-6-phosphate etherase; Re | 82.52 | |
| TIGR00274 | 291 | N-acetylmuramic acid 6-phosphate etherase. This pr | 82.46 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 82.33 | |
| PRK09860 | 383 | putative alcohol dehydrogenase; Provisional | 81.97 | |
| cd06333 | 312 | PBP1_ABC-type_HAAT_like Type I periplasmic binding | 81.84 | |
| PF02602 | 231 | HEM4: Uroporphyrinogen-III synthase HemD; InterPro | 81.76 | |
| cd06338 | 345 | PBP1_ABC_ligand_binding_like_5 Type I periplasmic | 81.69 | |
| cd05007 | 257 | SIS_Etherase N-acetylmuramic acid 6-phosphate ethe | 81.37 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 81.1 | |
| cd06340 | 347 | PBP1_ABC_ligand_binding_like_6 Type I periplasmic | 80.93 | |
| cd06363 | 410 | PBP1_Taste_receptor Ligand-binding domain of the T | 80.92 | |
| cd06332 | 333 | PBP1_aromatic_compounds_like Type I periplasmic bi | 80.87 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 80.75 | |
| cd05017 | 119 | SIS_PGI_PMI_1 The members of this protein family c | 80.39 |
| >cd06167 LabA_like LabA_like proteins | Back alignment and domain information |
|---|
Probab=99.50 E-value=1.3e-13 Score=102.71 Aligned_cols=87 Identities=30% Similarity=0.370 Sum_probs=79.3
Q ss_pred CCcHHHHHhhceEEEEec-----CCCccHHHHHHHHHHHHhhccCcceEEEEcCCcchHHHHHHHHHcCCeEEEEcCC--
Q 045172 63 YGFADELKRAWFWVRMVL-----VKPQDADVLLRNYMVAMVDKRRFGCLVVVSDDSDFVEVFQEATLRWLKMVVVGDM-- 135 (157)
Q Consensus 63 ygla~eLrRAGv~V~~V~-----dkpqAAD~AL~~~~~~~~~~r~v~clvLVSDDsDF~~~lr~Arer~l~tVVVGd~-- 135 (157)
-.+..+|++.||.|..++ ..++++|++|..+|++.+..++++++||||.|+||+++++.+|++|.+++|+|-.
T Consensus 55 ~~~~~~L~~~g~~~~~~~~~~~~~~~~~~D~~l~~d~~~~~~~~~~d~ivLvSgD~Df~~~i~~lr~~G~~V~v~~~~~~ 134 (149)
T cd06167 55 RGFLDALRRLGFEPIQKPLRTRGSGKKGVDVALAIDALELAYKRRIDTIVLVSGDSDFVPLVERLRELGKRVIVVGFEAK 134 (149)
T ss_pred HHHHHHHHHCCcEEEEEcceecCCcccCccHHHHHHHHHHhhhcCCCEEEEEECCccHHHHHHHHHHcCCEEEEEccCcc
Confidence 456789999999999998 4568999999999999999889999999999999999999999999999999986
Q ss_pred CchHHHhhhhcccc
Q 045172 136 SDGALKRIANAFFS 149 (157)
Q Consensus 136 ~~~~L~r~AD~~fs 149 (157)
...+|.+.||-+++
T Consensus 135 ~s~~L~~~~d~f~~ 148 (149)
T cd06167 135 TSRELRKAADRFID 148 (149)
T ss_pred ChHHHHHhCCcccc
Confidence 66899999996654
|
A well conserved group of bacterial proteins with no defined function. LabA, a member from Synechococcus elongatus PCC 7942, has been shown to play a role in cyanobacterial circadian timing. It is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system. In particular, LabA seems necessary for KaiC-dependent repression of gene expression. |
| >TIGR00288 conserved hypothetical protein TIGR00288 | Back alignment and domain information |
|---|
| >PF01936 NYN: NYN domain; InterPro: IPR021139 This highly conserved domain has no known function | Back alignment and domain information |
|---|
| >COG1432 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd05013 SIS_RpiR RpiR-like protein | Back alignment and domain information |
|---|
| >cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd05014 SIS_Kpsf KpsF-like protein | Back alignment and domain information |
|---|
| >cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein | Back alignment and domain information |
|---|
| >cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A | Back alignment and domain information |
|---|
| >cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PRK15482 transcriptional regulator MurR; Provisional | Back alignment and domain information |
|---|
| >cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs | Back alignment and domain information |
|---|
| >cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism | Back alignment and domain information |
|---|
| >cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PRK15408 autoinducer 2-binding protein lsrB; Provisional | Back alignment and domain information |
|---|
| >cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria | Back alignment and domain information |
|---|
| >cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs | Back alignment and domain information |
|---|
| >cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors | Back alignment and domain information |
|---|
| >PF01380 SIS: SIS domain SIS domain web page | Back alignment and domain information |
|---|
| >cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species | Back alignment and domain information |
|---|
| >cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily | Back alignment and domain information |
|---|
| >cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia | Back alignment and domain information |
|---|
| >PRK10653 D-ribose transporter subunit RbsB; Provisional | Back alignment and domain information |
|---|
| >PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators | Back alignment and domain information |
|---|
| >cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs | Back alignment and domain information |
|---|
| >cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis | Back alignment and domain information |
|---|
| >cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >TIGR02637 RhaS rhamnose ABC transporter, rhamnose-binding protein | Back alignment and domain information |
|---|
| >cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria | Back alignment and domain information |
|---|
| >cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs | Back alignment and domain information |
|---|
| >PRK10014 DNA-binding transcriptional repressor MalI; Provisional | Back alignment and domain information |
|---|
| >cd05008 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) | Back alignment and domain information |
|---|
| >cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems | Back alignment and domain information |
|---|
| >cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines | Back alignment and domain information |
|---|
| >cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation | Back alignment and domain information |
|---|
| >cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI) | Back alignment and domain information |
|---|
| >cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation | Back alignment and domain information |
|---|
| >cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK10355 xylF D-xylose transporter subunit XylF; Provisional | Back alignment and domain information |
|---|
| >PRK09701 D-allose transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems | Back alignment and domain information |
|---|
| >cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PRK11557 putative DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG | Back alignment and domain information |
|---|
| >cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR | Back alignment and domain information |
|---|
| >PRK10936 TMAO reductase system periplasmic protein TorT; Provisional | Back alignment and domain information |
|---|
| >PRK14987 gluconate operon transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs | Back alignment and domain information |
|---|
| >cd05710 SIS_1 A subgroup of the SIS domain | Back alignment and domain information |
|---|
| >TIGR00441 gmhA phosphoheptose isomerase | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase | Back alignment and domain information |
|---|
| >PRK11303 DNA-binding transcriptional regulator FruR; Provisional | Back alignment and domain information |
|---|
| >cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily | Back alignment and domain information |
|---|
| >cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PRK12342 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06307 PBP1_uncharacterized_sugar_binding Periplasmic sugar-binding domain of uncharacterized transport systems | Back alignment and domain information |
|---|
| >cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs | Back alignment and domain information |
|---|
| >cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >PRK11337 DNA-binding transcriptional repressor RpiR; Provisional | Back alignment and domain information |
|---|
| >cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily | Back alignment and domain information |
|---|
| >TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT | Back alignment and domain information |
|---|
| >PRK13937 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems | Back alignment and domain information |
|---|
| >PRK15395 methyl-galactoside ABC transporter galactose-binding periplasmic protein MglB; Provisional | Back alignment and domain information |
|---|
| >COG1609 PurR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01481 ccpA catabolite control protein A | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >PRK13936 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene | Back alignment and domain information |
|---|
| >cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor | Back alignment and domain information |
|---|
| >cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >COG1737 RpiR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli | Back alignment and domain information |
|---|
| >cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PRK00414 gmhA phosphoheptose isomerase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >PRK10423 transcriptional repressor RbsR; Provisional | Back alignment and domain information |
|---|
| >cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) | Back alignment and domain information |
|---|
| >cd06304 PBP1_BmpA_like Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria | Back alignment and domain information |
|---|
| >PRK10703 DNA-binding transcriptional repressor PurR; Provisional | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species | Back alignment and domain information |
|---|
| >TIGR00147 lipid kinase, YegS/Rv2252/BmrU family | Back alignment and domain information |
|---|
| >cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PF04123 DUF373: Domain of unknown function (DUF373); InterPro: IPR007254 This archaeal family of unknown function is predicted to be an integral membrane protein with six transmembrane regions | Back alignment and domain information |
|---|
| >PRK07239 bifunctional uroporphyrinogen-III synthetase/response regulator domain protein; Validated | Back alignment and domain information |
|---|
| >cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems | Back alignment and domain information |
|---|
| >PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) | Back alignment and domain information |
|---|
| >cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily | Back alignment and domain information |
|---|
| >COG1879 RbsB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK13938 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd06276 PBP1_FucR_like Ligand-binding domain of a transcription repressor, FucR, which functions as a molecular sensor of L-fucose availability | Back alignment and domain information |
|---|
| >PRK02947 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF15608 PELOTA_1: PELOTA RNA binding domain | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06354 PBP1_BmpA_PnrA_like Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea | Back alignment and domain information |
|---|
| >PRK11302 DNA-binding transcriptional regulator HexR; Provisional | Back alignment and domain information |
|---|
| >cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) | Back alignment and domain information |
|---|
| >cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >PRK05441 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00274 N-acetylmuramic acid 6-phosphate etherase | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK09860 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids | Back alignment and domain information |
|---|
| >PF02602 HEM4: Uroporphyrinogen-III synthase HemD; InterPro: IPR003754 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] | Back alignment and domain information |
|---|
| >cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd05007 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor | Back alignment and domain information |
|---|
| >cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >cd05017 SIS_PGI_PMI_1 The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| 2qip_A | 165 | Protein of unknown function VPA0982; APC85975, vib | 99.46 | |
| 3jy6_A | 276 | Transcriptional regulator, LACI family; NYSGXRC, P | 95.76 | |
| 3gbv_A | 304 | Putative LACI-family transcriptional regulator; NY | 95.43 | |
| 3o74_A | 272 | Fructose transport system repressor FRUR; dual tra | 95.33 | |
| 3l6u_A | 293 | ABC-type sugar transport system periplasmic compo; | 95.31 | |
| 3sho_A | 187 | Transcriptional regulator, RPIR family; structural | 95.2 | |
| 3m9w_A | 313 | D-xylose-binding periplasmic protein; xylose bindi | 95.13 | |
| 3tb6_A | 298 | Arabinose metabolism transcriptional repressor; tr | 95.09 | |
| 3g1w_A | 305 | Sugar ABC transporter; sugar-binding protein, baci | 95.07 | |
| 3l49_A | 291 | ABC sugar (ribose) transporter, periplasmic substr | 95.04 | |
| 3h75_A | 350 | Periplasmic sugar-binding domain protein; protein | 95.0 | |
| 1gud_A | 288 | ALBP, D-allose-binding periplasmic protein; peripl | 94.99 | |
| 8abp_A | 306 | L-arabinose-binding protein; binding proteins; HET | 94.91 | |
| 3ksm_A | 276 | ABC-type sugar transport system, periplasmic COMP; | 94.84 | |
| 2fn9_A | 290 | Ribose ABC transporter, periplasmic ribose-bindin; | 94.81 | |
| 1tjy_A | 316 | Sugar transport protein; protein-ligand complex, s | 94.75 | |
| 2dri_A | 271 | D-ribose-binding protein; sugar transport; HET: RI | 94.7 | |
| 3huu_A | 305 | Transcription regulator like protein; PSI-II, NYSG | 94.7 | |
| 3dbi_A | 338 | Sugar-binding transcriptional regulator, LACI FAM; | 94.68 | |
| 3k4h_A | 292 | Putative transcriptional regulator; structural gen | 94.63 | |
| 3uug_A | 330 | Multiple sugar-binding periplasmic receptor CHVE; | 94.56 | |
| 2fep_A | 289 | Catabolite control protein A; CCPA, transcriptiona | 94.49 | |
| 2h3h_A | 313 | Sugar ABC transporter, periplasmic sugar-binding p | 94.42 | |
| 3e3m_A | 355 | Transcriptional regulator, LACI family; structural | 94.38 | |
| 2vk2_A | 306 | YTFQ, ABC transporter periplasmic-binding protein | 94.37 | |
| 3hcw_A | 295 | Maltose operon transcriptional repressor; RNA-bind | 94.37 | |
| 3d8u_A | 275 | PURR transcriptional regulator; APC91343.1, vibrio | 94.22 | |
| 2ioy_A | 283 | Periplasmic sugar-binding protein; ribose binding | 94.2 | |
| 2rgy_A | 290 | Transcriptional regulator, LACI family; 11011J, NY | 94.03 | |
| 3egc_A | 291 | Putative ribose operon repressor; structural genom | 93.96 | |
| 3kjx_A | 344 | Transcriptional regulator, LACI family; LACL famil | 93.87 | |
| 2fvy_A | 309 | D-galactose-binding periplasmic protein; periplasm | 93.85 | |
| 3h5o_A | 339 | Transcriptional regulator GNTR; transcription regu | 93.78 | |
| 3brq_A | 296 | HTH-type transcriptional regulator ASCG; transcrip | 93.76 | |
| 3rot_A | 297 | ABC sugar transporter, periplasmic sugar binding; | 93.73 | |
| 1jx6_A | 342 | LUXP protein; protein-ligand complex, signaling pr | 93.68 | |
| 3kke_A | 303 | LACI family transcriptional regulator; structural | 93.59 | |
| 2rjo_A | 332 | Twin-arginine translocation pathway signal protei; | 93.32 | |
| 3d02_A | 303 | Putative LACI-type transcriptional regulator; peri | 93.11 | |
| 2o20_A | 332 | Catabolite control protein A; CCPA, transcriptiona | 93.1 | |
| 2l82_A | 162 | Designed protein OR32; structural genomics, northe | 92.95 | |
| 3c3k_A | 285 | Alanine racemase; structural genomics, protein str | 92.89 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 92.88 | |
| 3gv0_A | 288 | Transcriptional regulator, LACI family; transcript | 92.85 | |
| 3e61_A | 277 | Putative transcriptional repressor of ribose OPER; | 92.76 | |
| 2iks_A | 293 | DNA-binding transcriptional dual regulator; escher | 92.7 | |
| 3bil_A | 348 | Probable LACI-family transcriptional regulator; st | 92.67 | |
| 3qk7_A | 294 | Transcriptional regulators; structural genomics, N | 92.65 | |
| 1tk9_A | 188 | Phosphoheptose isomerase 1; lipopolysaccharide bio | 92.38 | |
| 2hsg_A | 332 | Glucose-resistance amylase regulator; CCPA, transc | 92.37 | |
| 3o1i_D | 304 | Periplasmic protein TORT; ligand free, two compone | 92.27 | |
| 3bbl_A | 287 | Regulatory protein of LACI family; protein structu | 92.26 | |
| 3k9c_A | 289 | Transcriptional regulator, LACI family protein; PS | 92.26 | |
| 2xbl_A | 198 | Phosphoheptose isomerase; capsule; HET: M7P PGE PG | 92.16 | |
| 2x7x_A | 325 | Sensor protein; transferase, sensor histidine kina | 92.01 | |
| 3clk_A | 290 | Transcription regulator; 11017J, PSI-II, NYSGXRC, | 91.87 | |
| 1dbq_A | 289 | Purine repressor; transcription regulation, DNA-bi | 91.85 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 91.1 | |
| 3brs_A | 289 | Periplasmic binding protein/LACI transcriptional; | 91.59 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 91.44 | |
| 1m3s_A | 186 | Hypothetical protein YCKF; structural genomics, PS | 91.05 | |
| 1x92_A | 199 | APC5045, phosphoheptose isomerase; midwest centre | 90.97 | |
| 1jeo_A | 180 | MJ1247, hypothetical protein MJ1247; RUMP pathway, | 90.74 | |
| 2i2w_A | 212 | Phosphoheptose isomerase; lipopolysaccharide biosy | 90.63 | |
| 1vim_A | 200 | Hypothetical protein AF1796; structural genomics, | 90.62 | |
| 3fxa_A | 201 | SIS domain protein; structural genomics, joint cen | 90.18 | |
| 2xhz_A | 183 | KDSD, YRBH, arabinose 5-phosphate isomerase; lipop | 89.96 | |
| 2yva_A | 196 | DNAA initiator-associating protein DIAA; intermole | 89.81 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 89.81 | |
| 3miz_A | 301 | Putative transcriptional regulator protein, LACI f | 89.78 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 89.68 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 89.66 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 89.64 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 89.38 | |
| 3etn_A | 220 | Putative phosphosugar isomerase involved in capsu | 89.23 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 89.16 | |
| 3trj_A | 201 | Phosphoheptose isomerase; lipopolysaccharide biosy | 88.84 | |
| 3hs3_A | 277 | Ribose operon repressor; PSI-II, NYSGXRC, periplas | 88.74 | |
| 1qpz_A | 340 | PURA, protein (purine nucleotide synthesis repress | 88.48 | |
| 2h0a_A | 276 | TTHA0807, transcriptional regulator; repressor, st | 88.2 | |
| 1pea_A | 385 | Amidase operon; gene regulator, receptor, binding | 87.74 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 87.49 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 87.35 | |
| 1jye_A | 349 | Lactose operon repressor; gene regulation, protein | 86.35 | |
| 2l69_A | 134 | Rossmann 2X3 fold protein; structural genomics, no | 85.96 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 85.9 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 85.57 | |
| 1usg_A | 346 | Leucine-specific binding protein; leucine-binding | 84.73 | |
| 4evq_A | 375 | Putative ABC transporter subunit, substrate-bindi | 84.58 | |
| 2qu7_A | 288 | Putative transcriptional regulator; structural gen | 84.26 | |
| 3cvj_A | 243 | Putative phosphoheptose isomerase; rossman fold, 3 | 84.24 | |
| 3h5t_A | 366 | Transcriptional regulator, LACI family; DNA-depend | 84.0 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 83.99 | |
| 1nri_A | 306 | Hypothetical protein HI0754; structural genomics, | 83.77 | |
| 2zj3_A | 375 | Glucosamine--fructose-6-phosphate aminotransferase | 83.28 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 82.7 | |
| 1j5x_A | 342 | Glucosamine-6-phosphate deaminase; structural geno | 82.63 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 82.52 | |
| 2hqb_A | 296 | Transcriptional activator of COMK gene; berkeley s | 82.47 | |
| 3td9_A | 366 | Branched chain amino acid ABC transporter, peripl | 82.37 | |
| 3gyb_A | 280 | Transcriptional regulators (LACI-family transcript | 82.37 | |
| 3i09_A | 375 | Periplasmic branched-chain amino acid-binding Pro; | 82.31 | |
| 3ipc_A | 356 | ABC transporter, substrate binding protein (amino; | 82.22 | |
| 2a3n_A | 355 | Putative glucosamine-fructose-6-phosphate aminotr; | 81.89 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 81.81 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 81.52 | |
| 1byk_A | 255 | Protein (trehalose operon repressor); LACI family, | 81.41 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 81.23 | |
| 3lkb_A | 392 | Probable branched-chain amino acid ABC transporter | 80.99 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 80.73 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 80.3 | |
| 2fqx_A | 318 | Membrane lipoprotein TMPC; ABC transport system, l | 80.08 |
| >2qip_A Protein of unknown function VPA0982; APC85975, vibrio parahaemolyticus RIMD 2210633, STR genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
Probab=99.46 E-value=2e-13 Score=104.46 Aligned_cols=88 Identities=23% Similarity=0.228 Sum_probs=77.1
Q ss_pred cHHHHHhhceEEEEecC-------CCccHHHHHHHHHHHHhhccCcceEEEEcCCcchHHHHHHHHHc-CCeEEEEcCC-
Q 045172 65 FADELKRAWFWVRMVLV-------KPQDADVLLRNYMVAMVDKRRFGCLVVVSDDSDFVEVFQEATLR-WLKMVVVGDM- 135 (157)
Q Consensus 65 la~eLrRAGv~V~~V~d-------kpqAAD~AL~~~~~~~~~~r~v~clvLVSDDsDF~~~lr~Arer-~l~tVVVGd~- 135 (157)
+..+|++.||.|.+.|- ..++.|++|.-+|++.. ..+|++||||.|+||+++++.+|++ |.+++|+|-.
T Consensus 66 ~~~~L~~~g~~v~~~p~~~~~~~~~k~~~Dv~laiD~~~~a--~~~d~~vLvSgD~DF~plv~~lr~~~G~~V~v~g~~~ 143 (165)
T 2qip_A 66 FHHILRGVGFEVMLKPYIQRRDGSAKGDWDVGITLDAIEIA--PDVDRVILVSGDGDFSLLVERIQQRYNKKVTVYGVPR 143 (165)
T ss_dssp HHHHHHHHTCEEEECCCCCCSSCCCSCCCHHHHHHHHHHHG--GGCSEEEEECCCGGGHHHHHHHHHHHCCEEEEEECGG
T ss_pred HHHHHHHCCcEEEEEeeeeccCCccCCCccHHHHHHHHHhh--ccCCEEEEEECChhHHHHHHHHHHHcCcEEEEEeCCC
Confidence 34688899999987653 34699999999999986 6899999999999999999999998 9999999964
Q ss_pred -CchHHHhhhhcccchhhhh
Q 045172 136 -SDGALKRIANAFFSWSDLL 154 (157)
Q Consensus 136 -~~~~L~r~AD~~fsW~ev~ 154 (157)
++.+|.+.||-|++++++.
T Consensus 144 ~~s~~L~~~ad~fi~l~~~~ 163 (165)
T 2qip_A 144 LTSQTLIDCADNFVAIDDDF 163 (165)
T ss_dssp GSCHHHHHHSSEEEECSGGG
T ss_pred cChHHHHHhCCEEEecchhh
Confidence 5689999999999998764
|
| >3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* | Back alignment and structure |
|---|
| >3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3sho_A Transcriptional regulator, RPIR family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.80A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* | Back alignment and structure |
|---|
| >3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* | Back alignment and structure |
|---|
| >8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A | Back alignment and structure |
|---|
| >3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} | Back alignment and structure |
|---|
| >2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* | Back alignment and structure |
|---|
| >1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* | Back alignment and structure |
|---|
| >2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* | Back alignment and structure |
|---|
| >3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} | Back alignment and structure |
|---|
| >3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* | Back alignment and structure |
|---|
| >2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* | Back alignment and structure |
|---|
| >2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* | Back alignment and structure |
|---|
| >3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* | Back alignment and structure |
|---|
| >3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* | Back alignment and structure |
|---|
| >3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} | Back alignment and structure |
|---|
| >2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} | Back alignment and structure |
|---|
| >3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} | Back alignment and structure |
|---|
| >1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* | Back alignment and structure |
|---|
| >3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C | Back alignment and structure |
|---|
| >3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} | Back alignment and structure |
|---|
| >3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2xbl_A Phosphoheptose isomerase; capsule; HET: M7P PGE PG4; 1.62A {Burkholderia pseudomallei} PDB: 2x3y_A | Back alignment and structure |
|---|
| >2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1m3s_A Hypothetical protein YCKF; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} SCOP: c.80.1.3 PDB: 1viv_A | Back alignment and structure |
|---|
| >1x92_A APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} SCOP: c.80.1.3 PDB: 3bjz_A | Back alignment and structure |
|---|
| >1jeo_A MJ1247, hypothetical protein MJ1247; RUMP pathway, phosphosugar, 3-hexulose-6-phosphate isomerase structural genomics; HET: CME CIT; 2.00A {Methanocaldococcus jannaschii} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >2i2w_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A | Back alignment and structure |
|---|
| >1vim_A Hypothetical protein AF1796; structural genomics, unknown function; 1.36A {Archaeoglobus fulgidus} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >3fxa_A SIS domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2xhz_A KDSD, YRBH, arabinose 5-phosphate isomerase; lipopolysaccharide biogenesis; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2yva_A DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar BIND protein, DNAA binding protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3etn_A Putative phosphosugar isomerase involved in capsu formation; YP_209877.1; HET: MSE CMK; 1.70A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3trj_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 2.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} | Back alignment and structure |
|---|
| >1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... | Back alignment and structure |
|---|
| >2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... | Back alignment and structure |
|---|
| >2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A | Back alignment and structure |
|---|
| >4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A | Back alignment and structure |
|---|
| >2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3cvj_A Putative phosphoheptose isomerase; rossman fold, 3-layer (ABA) sandwich, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.00A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >1nri_A Hypothetical protein HI0754; structural genomics, haemophilus influ PSI, protein structure initiative, midwest center for struc genomics; 1.90A {Haemophilus influenzae} SCOP: c.80.1.3 | Back alignment and structure |
|---|
| >2zj3_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; glucosamine-6-phosphate synthase, aldose/ketose isomerase, rossmann-like fold; HET: G6P; 1.90A {Homo sapiens} PDB: 2zj4_A* 2v4m_A* | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1j5x_A Glucosamine-6-phosphate deaminase; structural genomics, TM0813, glucosamine-6-phosphate deamina PSI, protein structure initiative; 1.80A {Thermotoga maritima} SCOP: c.80.1.1 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A | Back alignment and structure |
|---|
| >2a3n_A Putative glucosamine-fructose-6-phosphate aminotr; structural genomics, joint center for structural genomics; HET: MSE; 1.23A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| d1dbqa_ | 282 | Purine repressor (PurR), C-terminal domain {Escher | 95.86 | |
| d2dria_ | 271 | D-ribose-binding protein {Escherichia coli, strain | 95.27 | |
| d1jyea_ | 271 | Lac-repressor (lacR) core (C-terminal domain) {Esc | 94.64 | |
| d8abpa_ | 305 | L-arabinose-binding protein {Escherichia coli [Tax | 94.45 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 93.94 | |
| d1tjya_ | 316 | AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 | 93.77 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 93.24 | |
| d1guda_ | 288 | D-allose-binding protein {Escherichia coli [TaxId: | 92.82 | |
| d2fvya1 | 305 | Galactose/glucose-binding protein {Escherichia col | 91.28 | |
| d1vima_ | 192 | Hypothetical protein AF1796 {Archaeon Archaeoglobu | 90.49 | |
| d1m3sa_ | 186 | Hypothetical protein YckF {Bacillus subtilis [TaxI | 90.07 | |
| d1jx6a_ | 338 | Quorum-sensing signal (autoinducer-2) binding prot | 88.9 | |
| d2nzug1 | 275 | Glucose-resistance amylase regulator CcpA, C-termi | 88.69 | |
| d1r8ja2 | 135 | N-terminal domain of the circadian clock protein K | 88.63 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 88.05 | |
| d2bona1 | 295 | Lipid kinase YegS {Escherichia coli [TaxId: 562]} | 87.82 | |
| d1byka_ | 255 | Trehalose repressor, C-terminal domain {Escherichi | 85.55 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 81.68 |
| >d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Periplasmic binding protein-like I superfamily: Periplasmic binding protein-like I family: L-arabinose binding protein-like domain: Purine repressor (PurR), C-terminal domain species: Escherichia coli [TaxId: 562]
Probab=95.86 E-value=0.019 Score=41.68 Aligned_cols=70 Identities=11% Similarity=0.032 Sum_probs=54.3
Q ss_pred CCcHHHHHhhceEEEEecCCCccHHHHHHHHHHHHhhccCcceEEEEcCCcchHHHHHHHHHcCCeEEEEcCC
Q 045172 63 YGFADELKRAWFWVRMVLVKPQDADVLLRNYMVAMVDKRRFGCLVVVSDDSDFVEVFQEATLRWLKMVVVGDM 135 (157)
Q Consensus 63 ygla~eLrRAGv~V~~V~dkpqAAD~AL~~~~~~~~~~r~v~clvLVSDDsDF~~~lr~Arer~l~tVVVGd~ 135 (157)
-|+..++++.|+.+.+.+...+ ......+.+.+..++++.+++++.+.+-..+...+...++..|++|..
T Consensus 20 ~gi~~~~~~~gy~~~~~~~~~d---~~~~~~~~~~l~~~~vdgiIi~~~~~~~~~~~~~~~~~~iPvV~~~~~ 89 (282)
T d1dbqa_ 20 EAVEKNCFQKGYTLILGNAWNN---LEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWG 89 (282)
T ss_dssp HHHHHHHHHHTCEEEEEECTTC---HHHHHHHHHHHHHTTCSEEEEECSCCCHHHHHHHHHTTTSCEEEEECS
T ss_pred HHHHHHHHHcCCEEEEEeCCCC---HHHHHHHHHHHHhcCCCEEeeecccccchhhhhHHhhcCCCceEEEec
Confidence 4778899999999988765544 555667777777899999999887776555556666689999999865
|
| >d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vima_ c.80.1.3 (A:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1r8ja2 c.23.1.5 (A:1-135) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|