Citrus Sinensis ID: 045177

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
SLLANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFPQLGNKKMTNLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFTDGSAESSCQKRSVNLFASFSKGNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKAIVKPFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAISLNP
ccccccccccccHHHHccccccEEccccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEEEccccEEccccccccccccccEEccccccEEcccccccccccccccccccEEEEEccccccccccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccEEEccccccccccccHHHccccccHHEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccEEEEcccEEEccccccEEEcccccccHHHHccccccccEEEEEEEEEEEEcccccccccccEEEEEEEcccEEcccccccHHcccccccEEEEEEEEEEccEEEEEEEEcccccccccccccccccEEEEEEcc
ccccccccccccHHHcccccccEEEcccccccccccHHHccHHHHHEEEEccccccccccHHHHccccccEEEEccccccccccHHHcccHcccEEEEccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHHHccEEEcccccccccccHHHcccccEEEEEEEccccccccccccccccccccccEEEEccccccccccccccEEEccccccccccHHccccccEEEEEccccccccccccccEEcccEEEEcccccccccccccHcccHHcEEEEccccEEEEEcHHHEEEcccccccccccccccEEEccccEEccccHHHHcccccccEEEEEEEEEEccEEEEEEEEccccccccccccccccEEEEEEEcc
sllanrltgpipkyLANISTLVNLTVQYNQFSGELPEELGSLLNLEklhlssnnftgelpKTFAKLtnmkdfrigdnqftgqiPSFIQNWTKLEKLfiqpsglvgpipsgifslEKFNGLVCMVFLFLRisdlngpeatfpqlgnkkmtNLILRncnitgelppylgkmttLKVLDLSFNklsghipsnfddlyeVDYIYFTGnlltgaippwmlekgdkidlsynnftdgsaesscqkRSVNLFAsfskgnnstgivsclrsfqcpktyyYSLHincggsevtangdtafeedtyeagpstftlsrtnwglsstghfldnsiktdtyiqtntsrllmsdsqLYTNARLSAISLTYYGFclgngnytvKLHFAEILftddknfssfgkRIFDVYIQGnlvlkdlnieneaggvgkAIVKPFSAAVTNGTMEIRLYWagkgtteipfkgdygplisaislnp
sllanrltgpipkyLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFPQLGNKKMTNLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFTDGSAESSCQKRSVNLFASfskgnnstgiVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKaivkpfsaavtnGTMEIRLYWAGKGTteipfkgdygplisaislnp
SLLANRLTGPIPKYLANISTLVNLTVQYNQFsgelpeelgsllnleKLHLSSNNFTGELPKTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFPQLGNKKMTNLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFTDGSAESSCQKRSVNLFASFSKGNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKAIVKPFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAISLNP
******LTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFPQLGNKKMTNLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFT***********SVNLFASFSKGNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKAIVKPFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAI****
SLLANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATF***GNKKMTNLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFTDGSAESSCQKRSVNLFASFSKGNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKAIVKPFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAISLNP
SLLANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFPQLGNKKMTNLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFT********QKRSVNLFASFSKGNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKAIVKPFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAISLNP
***ANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFPQLGNKKMTNLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFTDGSAESSCQKRSVNLFASFSKGNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKAIVKPFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAISLNP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLLANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFPQLGNKKMTNLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFTDGSAESSCQKRSVNLFASFSKGNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKAIVKPFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAISLNP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query461 2.2.26 [Sep-21-2011]
C0LGN2 1020 Probable leucine-rich rep yes no 0.969 0.438 0.552 1e-138
C0LGG7 953 Probable LRR receptor-lik no no 0.939 0.454 0.550 1e-138
C0LGE0 1014 Probable LRR receptor-lik no no 0.982 0.446 0.496 1e-119
Q9FXF2 1021 Probable LRR receptor-lik no no 0.960 0.433 0.467 1e-107
C0LGG9 1035 Probable LRR receptor-lik no no 0.971 0.432 0.432 1e-101
Q9ASQ6 1019 Probable LRR receptor-lik no no 0.941 0.425 0.479 1e-100
C0LGG8 1038 Probable LRR receptor-lik no no 0.969 0.430 0.440 1e-100
C0LGH3 1033 Probable LRR receptor-lik no no 0.969 0.432 0.367 1e-77
C0LGH2 1032 Probable LRR receptor-lik no no 0.967 0.432 0.364 9e-75
Q8VZG8 1045 Probable LRR receptor-lik no no 0.440 0.194 0.330 5e-28
>sp|C0LGN2|Y3148_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 OS=Arabidopsis thaliana GN=LRR-RLK PE=1 SV=1 Back     alignment and function desciption
 Score =  493 bits (1268), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 259/469 (55%), Positives = 333/469 (71%), Gaps = 22/469 (4%)

Query: 1   SLLANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELP 60
           SLL NR++G IPK L N++TL  L ++YNQ SG++P ELG+L NL++L LSSNN +GE+P
Sbjct: 140 SLLGNRISGSIPKELGNLTTLSGLVLEYNQLSGKIPPELGNLPNLKRLLLSSNNLSGEIP 199

Query: 61  KTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGL 120
            TFAKLT + D RI DNQFTG IP FIQNW  LEKL IQ SGLVGPIPS I  L     L
Sbjct: 200 STFAKLTTLTDLRISDNQFTGAIPDFIQNWKGLEKLVIQASGLVGPIPSAIGLLGTLTDL 259

Query: 121 VCMVFLFLRISDLNGPEATFPQLGN-KKMTNLILRNCNITGELPPYLGKMTTLKVLDLSF 179
                   RI+DL+GPE+ FP L N   M  LILRNCN+TG+LP YLG+   LK LDLSF
Sbjct: 260 --------RITDLSGPESPFPPLRNMTSMKYLILRNCNLTGDLPAYLGQNRKLKNLDLSF 311

Query: 180 NKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFTDGSAESSCQK 239
           NKLSG IP+ +  L +VD+IYFT N+L G +P WM+++GD ID++YNNF+    E  CQ+
Sbjct: 312 NKLSGPIPATYSGLSDVDFIYFTSNMLNGQVPSWMVDQGDTIDITYNNFSKDKTEE-CQQ 370

Query: 240 RSVNLFASFSK--GNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYE 297
           +SVN F+S S    NNS+  VSCL  + CPKT+Y  LHINCGG+E+T+N +T ++ DT++
Sbjct: 371 KSVNTFSSTSPLVANNSSN-VSCLSKYTCPKTFY-GLHINCGGNEITSN-ETKYDADTWD 427

Query: 298 AGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQ-TNTSRLLMSDS----QLYTNARLSAI 352
             P  +  S+  W  S+TG+FLD+    +   + +N+S L +++S    +LYT ARLSAI
Sbjct: 428 T-PGYYD-SKNGWVSSNTGNFLDDDRTNNGKSKWSNSSELKITNSSIDFRLYTQARLSAI 485

Query: 353 SLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGG 412
           SLTY   CLG GNYTV LHFAEI+F +   +S+ G+R FD+Y+QG   +KD NI +EA G
Sbjct: 486 SLTYQALCLGKGNYTVNLHFAEIMFNEKNMYSNLGRRYFDIYVQGKREVKDFNIVDEAKG 545

Query: 413 VGKAIVKPFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAISLNP 461
           VGKA+VK F   VTNG +EIRL WAGKGT  IP +G YGPLISA+S++P
Sbjct: 546 VGKAVVKKFPVMVTNGKLEIRLQWAGKGTQAIPVRGVYGPLISAVSVDP 594

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGG7|Y1534_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53420 OS=Arabidopsis thaliana GN=At1g53420 PE=2 SV=2 Back     alignment and function description
>sp|C0LGE0|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1 Back     alignment and function description
>sp|Q9FXF2|RKF1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGG9|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440 OS=Arabidopsis thaliana GN=At1g53440 PE=1 SV=2 Back     alignment and function description
>sp|Q9ASQ6|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720 OS=Arabidopsis thaliana GN=RFK1 PE=2 SV=3 Back     alignment and function description
>sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 Back     alignment and function description
>sp|C0LGH3|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2 Back     alignment and function description
>sp|C0LGH2|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
302142829 1036 unnamed protein product [Vitis vinifera] 0.976 0.434 0.666 1e-173
359493983 1007 PREDICTED: probable leucine-rich repeat 0.976 0.446 0.666 1e-173
359493981 1007 PREDICTED: probable leucine-rich repeat 0.976 0.446 0.666 1e-169
302142826 869 unnamed protein product [Vitis vinifera] 0.976 0.517 0.666 1e-169
359493985 1011 PREDICTED: probable leucine-rich repeat 0.976 0.445 0.664 1e-168
302142832 906 unnamed protein product [Vitis vinifera] 0.976 0.496 0.664 1e-167
255567064 1007 ATP binding protein, putative [Ricinus c 0.969 0.443 0.617 1e-159
357492929 996 Cysteine-rich receptor-like protein kina 0.967 0.447 0.597 1e-151
351723187 999 receptor-like protein kinase 2-like prec 0.971 0.448 0.592 1e-143
449456685 984 PREDICTED: probable leucine-rich repeat 0.967 0.453 0.569 1e-140
>gi|302142829|emb|CBI20124.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  615 bits (1586), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 308/462 (66%), Positives = 362/462 (78%), Gaps = 12/462 (2%)

Query: 1   SLLANRLTGPIPKYLANISTLVNLTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELP 60
           SL+ NRLTG IPK L NISTL NLTV++NQ SG LP+ELG+L ++E++ L+SNNFTGELP
Sbjct: 166 SLIGNRLTGSIPKELGNISTLANLTVEFNQLSGVLPQELGNLPSIERILLTSNNFTGELP 225

Query: 61  KTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGL 120
           +TFA LT +KDFR+GDNQFTG+IP+FIQNWTKLEKL IQ SG  GPIPSGI  L K   L
Sbjct: 226 QTFAGLTTLKDFRVGDNQFTGKIPNFIQNWTKLEKLVIQGSGFSGPIPSGIALLTKITDL 285

Query: 121 VCMVFLFLRISDLNGPEATFPQLGN-KKMTNLILRNCNITGELPPYLGKMTTLKVLDLSF 179
                   RISDLNG EATFP L + + +  LILR+CNI G LP YLG+MT LK LDLSF
Sbjct: 286 --------RISDLNGTEATFPPLSDMRNLKTLILRSCNIVGPLPDYLGEMTKLKTLDLSF 337

Query: 180 NKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFTDGSAESSCQK 239
           NKL+G IPS+F  L   DY+YFTGN+LTGA+P WML++GD  DLSYNNFT  S+   CQ+
Sbjct: 338 NKLTGEIPSSFVGLSNADYMYFTGNMLTGAVPDWMLKRGDNYDLSYNNFTSESSRG-CQE 396

Query: 240 RSVNLFASFSKGNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTAFEEDTYEAG 299
           RSVNLF S S GNN  GIVSCLRSF CPK +Y S+HINCGG EV  +G+T +E+DT   G
Sbjct: 397 RSVNLFGSSSGGNN-FGIVSCLRSFNCPKKFY-SMHINCGGKEVIVDGNTTYEDDTDSGG 454

Query: 300 PSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSAISLTYYGF 359
           PS F  SRTNW  SSTGHF+D+   TD++I TN SRL M +S LYT ARLSA+SLTYYGF
Sbjct: 455 PSKFYQSRTNWAFSSTGHFMDDDRPTDSFIGTNVSRLTMENSGLYTTARLSALSLTYYGF 514

Query: 360 CLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKAIVK 419
           CL NGNYTVKLHFAEI FTDDK +SS G+R+FDVY+Q  LVLKD +IE++AGGV K I+K
Sbjct: 515 CLENGNYTVKLHFAEITFTDDKTYSSLGRRLFDVYVQDELVLKDFDIEDDAGGVSKEIIK 574

Query: 420 PFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAISLNP 461
            F+A VTN T+EIR YWAGKGTT IP +G YGPLISAIS++P
Sbjct: 575 YFTAVVTNNTLEIRFYWAGKGTTGIPVRGVYGPLISAISVDP 616

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359493983|ref|XP_002283596.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493981|ref|XP_003634703.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142826|emb|CBI20121.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493985|ref|XP_002283578.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142832|emb|CBI20127.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255567064|ref|XP_002524514.1| ATP binding protein, putative [Ricinus communis] gi|223536188|gb|EEF37841.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357492929|ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355518088|gb|AES99711.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|351723187|ref|NP_001237014.1| receptor-like protein kinase 2-like precursor [Glycine max] gi|51847838|gb|AAU10526.1| putative receptor-like protein kinase 2 [Glycine max] Back     alignment and taxonomy information
>gi|449456685|ref|XP_004146079.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query461
TAIR|locus:2203847 1021 RKF1 "receptor-like kinase in 0.965 0.435 0.460 2.3e-94
TAIR|locus:2203718 1035 AT1G53440 [Arabidopsis thalian 0.969 0.431 0.423 1.3e-91
TAIR|locus:2019367 1078 AT1G29740 [Arabidopsis thalian 0.967 0.413 0.420 2e-88
TAIR|locus:2019317 969 AT1G29730 [Arabidopsis thalian 0.967 0.460 0.414 2e-86
TAIR|locus:2205250 1032 AT1G56130 [Arabidopsis thalian 0.967 0.432 0.358 1.6e-68
TAIR|locus:2009630 953 AT1G53420 [Arabidopsis thalian 0.937 0.453 0.367 2.9e-65
TAIR|locus:2205260 1047 AT1G56120 [Arabidopsis thalian 0.952 0.419 0.309 3e-50
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.585 0.258 0.304 2.4e-22
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.466 0.172 0.309 2.7e-21
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.503 0.207 0.314 3e-21
TAIR|locus:2203847 RKF1 "receptor-like kinase in flowers 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 939 (335.6 bits), Expect = 2.3e-94, P = 2.3e-94
 Identities = 216/469 (46%), Positives = 282/469 (60%)

Query:     1 SLLANRLTGPIPKYLANISTLVNLTVQYNQFXXXXXXXXXXXXXXXKLHLSSNNFTGELP 60
             SLL NRL+G IPK   N S+L  L ++ N F               KL LSSN  TG LP
Sbjct:   152 SLLVNRLSGEIPKEFGN-SSLTYLDLESNAFSGTIPQELGNLVHLKKLLLSSNKLTGTLP 210

Query:    61 KTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGL 120
              + A+L NM DFRI D Q +G IPS+IQNW +LE+L +  SGL GPIPS I  L   + L
Sbjct:   211 ASLARLQNMTDFRINDLQLSGTIPSYIQNWKQLERLEMIASGLTGPIPSVISVL---SNL 267

Query:   121 VCMVFLFLRISDLNGPEATFPQLGNKK-MTNLILRNCNITGELPPYLGKMTTLKVLDLSF 179
             V      LRISD+ GP   FP L N   +T +IL+NCNI+G++P YL  +  L+ LDLSF
Sbjct:   268 VN-----LRISDIRGPVQPFPSLKNVTGLTKIILKNCNISGQIPTYLSHLKELETLDLSF 322

Query:   180 NKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWMLEKGDKIDLSYNNFTDGSAES-SCQ 238
             NKL G IPS F     + +I   GN+L G  P  +L  G  +DLSYNN    S ES +C+
Sbjct:   323 NKLVGGIPS-FAQAENLRFIILAGNMLEGDAPDELLRDGITVDLSYNNLKWQSPESRACR 381

Query:   239 KR---SVNLFASFSKGNNSTGIVSCLRSFQCPKTYYYSLHINCGGSEVTANGDTA---FE 292
                  ++NLF S S    S+  + C++ F+CP+ Y   LH+NCGGS++          +E
Sbjct:   382 PNMNLNLNLFQSTST-KKSSKFLPCIKDFKCPR-YSSCLHVNCGGSDMYVKEKKTKELYE 439

Query:   293 ED-TYEAGPSTFTLSR-TNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLS 350
              D   E G + + L    NWG SSTG F+D++   +T           SD  LY +AR++
Sbjct:   440 GDGNVEGGAAKYFLKPDANWGFSSTGDFMDDNNFQNTRFTMFVPASNQSD--LYKSARIA 497

Query:   351 AISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEA 410
              +SLTY+  CL NGNYT+ L FAEI FT+D+N++  G+R+FD+YIQ  LV KD NI +EA
Sbjct:   498 PVSLTYFHACLENGNYTINLDFAEIRFTNDENYNRLGRRLFDIYIQEKLVAKDFNIMDEA 557

Query:   411 GGVGKAIVKPFSAAVTNGTMEIRLYWAGKGTTEIPFKGDYGPLISAISL 459
              G    I+KP +A VTN  + IRL WAGKGTT IP +G YGP+ISAIS+
Sbjct:   558 KGAQTPIIKPLTAYVTNHFLTIRLSWAGKGTTRIPTRGVYGPIISAISI 606
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS;IDA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0004702 "receptor signaling protein serine/threonine kinase activity" evidence=ISS
TAIR|locus:2203718 AT1G53440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019367 AT1G29740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019317 AT1G29730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205250 AT1G56130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009630 AT1G53420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205260 AT1G56120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
pfam11721164 pfam11721, Malectin, Di-glucose binding within end 5e-60
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-29
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-23
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam12819335 pfam12819, Malectin_like, Carbohydrate-binding pro 0.001
>gnl|CDD|221187 pfam11721, Malectin, Di-glucose binding within endoplasmic reticulum Back     alignment and domain information 
 Score =  193 bits (492), Expect = 5e-60
 Identities = 86/188 (45%), Positives = 104/188 (55%), Gaps = 26/188 (13%)

Query: 272 YSLHINCGGSEVTANGDTAFEEDTYEAGPSTFTLSRTNWGLSSTGHFLDNSIKTDTYIQT 331
             L INCGG E T +    +E DTY  G S        + +S T                
Sbjct: 1   VVLAINCGGPEHTDSDGITYEADTYFTGGSAD------YYVSDTNG-------------- 40

Query: 332 NTSRLLMSDSQLYTNARLSAISLTYYGFCLGNGNYTVKLHFAEILFTDDKNFSSFGKRIF 391
           ++S    +D +LY   R S  S +YY  CL NGNYTV LHFAEI F +D      G+R+F
Sbjct: 41  SSSIAGTTDPELYQTERYSPSSFSYYIPCLENGNYTVILHFAEIYFGEDGL----GRRVF 96

Query: 392 DVYIQGNLVLKDLNIENEAGGVGKAIVKPFSAA-VTNGTMEIRLYWAGKGTTEIPFKGDY 450
           DVY+QG LVLKD +I  EAGG GK   K +    VT+GT+EI  YWAGKGT  IPF+G Y
Sbjct: 97  DVYVQGKLVLKDFDIVAEAGGKGKTAHKEYIPVTVTDGTLEIHFYWAGKGTLLIPFRGVY 156

Query: 451 G-PLISAI 457
           G P ISAI
Sbjct: 157 GNPKISAI 164

Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan. It carries a signal peptide from residues 1-26, a C-terminal transmembrane helix from residues 255-274, and a highly conserved central part of approximately 190 residues followed by an acidic, glutamate-rich region. Carbohydrate-binding is mediated by the four aromatic residues, Y67, Y89, Y116, and F117 and the aspartate at D186. NMR-based ligand-screening studies has shown binding of the protein to maltose and related oligosaccharides, on the basis of which the protein has been designated "malectin", and its endogenous ligand is found to be Glc2-high-mannose N-glycan. Length = 164
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|221790 pfam12819, Malectin_like, Carbohydrate-binding protein of the ER Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 461
PF11721174 Malectin: Di-glucose binding within endoplasmic re 99.98
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
PLN03150 623 hypothetical protein; Provisional 99.77
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.75
KOG4237498 consensus Extracellular matrix protein slit, conta 99.72
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
PLN032101153 Resistant to P. syringae 6; Provisional 99.62
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.62
PLN032101153 Resistant to P. syringae 6; Provisional 99.6
KOG4237498 consensus Extracellular matrix protein slit, conta 99.6
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.6
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.53
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
PF12819347 Malectin_like: Carbohydrate-binding protein of the 99.49
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.48
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.43
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.32
KOG3593 355 consensus Predicted receptor-like serine/threonine 99.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.24
PLN03150623 hypothetical protein; Provisional 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
PF12819 347 Malectin_like: Carbohydrate-binding protein of the 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.92
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.9
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.85
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.69
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.67
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.67
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.52
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.33
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.17
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.08
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.98
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.97
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
PRK15386426 type III secretion protein GogB; Provisional 97.96
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.94
PRK15386426 type III secretion protein GogB; Provisional 97.79
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.72
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.43
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.11
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.97
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.9
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.72
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.53
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.5
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.39
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.19
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.12
KOG4308478 consensus LRR-containing protein [Function unknown 94.0
KOG4308478 consensus LRR-containing protein [Function unknown 92.84
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.44
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.91
smart0037026 LRR Leucine-rich repeats, outliers. 90.27
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.27
KOG1947482 consensus Leucine rich repeat proteins, some prote 89.7
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.37
smart0037026 LRR Leucine-rich repeats, outliers. 88.37
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.08
>PF11721 Malectin: Di-glucose binding within endoplasmic reticulum; InterPro: IPR021720 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan Back     alignment and domain information 
Probab=99.98  E-value=3.8e-33  Score=246.32  Aligned_cols=169  Identities=44%  Similarity=0.727  Sum_probs=111.2

Q ss_pred             ceecccCCCeeeecCCeeeecCCCCCCCce-eeecCCceEEeeeeeccCCCCCCCceeEeccccccCCchhhhhhhccCC
Q 045177          273 SLHINCGGSEVTANGDTAFEEDTYEAGPST-FTLSRTNWGLSSTGHFLDNSIKTDTYIQTNTSRLLMSDSQLYTNARLSA  351 (461)
Q Consensus       273 ~~~i~~gg~~~~~~~~~~~~~d~~~~g~~~-~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~ly~t~r~~~  351 (461)
                      .+||||||+..+...+..|..|....+... |..+              ... .............+.+++||||+|++.
T Consensus         2 ~~~IN~Gg~~~~~~~g~~w~~D~~~~~g~~~y~~~--------------~~~-~~~~~~~~~~i~~t~d~~Lyqt~R~g~   66 (174)
T PF11721_consen    2 VLRINAGGPAYTDSSGIVWEADQYYTGGSWGYYVS--------------SDN-NGSTSSTNSSIPGTTDDPLYQTERYGP   66 (174)
T ss_dssp             EEEEEETSSSEEETTTEEE-SSSSSTTSS--------------------------SSTTS--TTS-HHHHHTTT-----S
T ss_pred             EEEEECCCCcccCCCCCEEcCCCCCCCCCcccccc--------------ccc-ccccccccccccCCCchhhhHhhcCCC
Confidence            589999999996666666888865544332 1111              000 000111233444577789999999997


Q ss_pred             Ccccccccc-ccCccEEEEEEeEeeeecCCCCccCCCcceeEEEECCEEEeecCccccccCCcceEEEEEE-EEEEeCCe
Q 045177          352 ISLTYYGFC-LGNGNYTVKLHFAEILFTDDKNFSSFGKRIFDVYIQGNLVLKDLNIENEAGGVGKAIVKPF-SAAVTNGT  429 (461)
Q Consensus       352 ~~~~~~~~~-~~~G~y~v~L~F~e~~~~~~~~~~~~~~r~F~v~~~~~~~~~~fdi~~~~~~~~~~~~~~~-~v~v~~~~  429 (461)
                      ..+.| .+| +++|.|+|+|||||+++..++.+..+|+|||||+|||++|+++|||++++|+..+|+++.| .|.|+||.
T Consensus        67 ~~f~Y-~ip~~~~G~Y~V~L~FaE~~~~~~~~~~~~G~RvFdV~v~g~~vl~~~Di~~~~G~~~~~~~~~~~~v~v~dg~  145 (174)
T PF11721_consen   67 SSFSY-DIPVVPNGTYTVRLHFAELYFGASGGASGPGQRVFDVYVNGETVLKNFDIYAEAGGFNKAAVRRFFNVTVTDGT  145 (174)
T ss_dssp             SSEEE-EEE--S-EEEEEEEEEE-SSS--------SSSS-EEEEETTEEEEEEE-HHHHHSSSS---EEEEEEEEEETTE
T ss_pred             CceEE-EEecCCCcEEEEEEEeccccccccccccCCCceEEEEEecceEEEeccCHHHHcCCCceEEEEEEEEEEEeCCc
Confidence            77776 556 9999999999999999976555677999999999999999999999999988776777777 89999999


Q ss_pred             EEEEEEEcCCcceeccCCCccc-CeeeeE
Q 045177          430 MEIRLYWAGKGTTEIPFKGDYG-PLISAI  457 (461)
Q Consensus       430 l~i~f~~~~~g~~~~p~~~~~~-~~i~ai  457 (461)
                      |+|+|.|++||++++|..+.++ |+||||
T Consensus       146 L~i~f~~~~~~~~~i~~~~~~~~p~IsaI  174 (174)
T PF11721_consen  146 LNIQFVWAGKGTLCIPFIGSYGNPLISAI  174 (174)
T ss_dssp             EETTEEEE--SEEEEEEESSSSSSSEEEE
T ss_pred             EEEEEEecCCCcEEeeccccCCCcEEeeC
Confidence            9999999999999999988886 999998

It carries a signal peptide from residues 1-26, a C-terminal transmembrane helix from residues 255-274, and a highly conserved central part of approximately 190 residues followed by an acidic, glutamate-rich region. Carbohydrate-binding is mediated by the four aromatic residues, Y67, Y89, Y116, and F117 and the aspartate at D186. NMR-based ligand-screening studies has shown binding of the protein to maltose and related oligosaccharides, on the basis of which the protein has been designated "malectin", and its endogenous ligand is found to be Glc2-high-mannose N-glycan [. This entry represents a malectin domain, and can also be found in probable receptor-like serine/threonine-protein kinases from plants [] and in proteins described as glycoside hydrolases. ; PDB: 2KR2_A 2JWP_A 2K46_A.
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3593 consensus Predicted receptor-like serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12819 Malectin_like: Carbohydrate-binding protein of the ER; InterPro: IPR024788 Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan [] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-16
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-07
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-16
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-07
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-07
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 122/262 (46%), Gaps = 42/262 (16%)
Query: 1   SLLANRLTGPIPKYLAN-ISTLVNLTVQYNQFXXXXXXXXXXXXXXXKLHLSSNNFTGEL 59
           SL  N+ TG IP +L+    TL  L +  N F                L LSSNNF+GEL
Sbjct: 275 SLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL 334
Query: 60  P-KTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTK-------------------------- 92
           P  T  K+  +K   +  N+F+G++P  + N +                           
Sbjct: 335 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKN 394
Query: 93  -LEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFP-QLGN-KKMT 149
            L++L++Q +G  G IP  + +  +      +V L L  + L+G   T P  LG+  K+ 
Sbjct: 395 TLQELYLQNNGFTGKIPPTLSNCSE------LVSLHLSFNYLSG---TIPSSLGSLSKLR 445
Query: 150 NLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGA 209
           +L L    + GE+P  L  + TL+ L L FN L+G IPS   +   +++I  + N LTG 
Sbjct: 446 DLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGE 505
Query: 210 IPPWM--LEKGDKIDLSYNNFT 229
           IP W+  LE    + LS N+F+
Sbjct: 506 IPKWIGRLENLAILKLSNNSFS 527
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query461
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-29
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-45
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-43
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-39
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-28
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 1e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-25
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  161 bits (411), Expect = 2e-46
 Identities = 47/236 (19%), Positives = 89/236 (37%), Gaps = 17/236 (7%)

Query: 1   SLLANRLTG--PIPKYLANISTLVNLTVQ-YNQFSGELPEELGSLLNLEKLHLSSNNFTG 57
            L    L    PIP  LAN+  L  L +   N   G +P  +  L  L  L+++  N +G
Sbjct: 56  DLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSG 115

Query: 58  ELPKTFAKLTNMKDFRIGDNQFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKF 117
            +P   +++  +       N  +G +P  I +   L  +    + + G IP    S  K 
Sbjct: 116 AIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKL 175

Query: 118 NGLVCMVFLFLRISDLNG--PEATFPQLGNKKMTNLILRNCNITGELPPYLGKMTTLKVL 175
                   + +  + L G  P    P   N  +  + L    + G+     G     + +
Sbjct: 176 -----FTSMTISRNRLTGKIP----PTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKI 226

Query: 176 DLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWM--LEKGDKIDLSYNNFT 229
            L+ N L+  +         ++ +    N + G +P  +  L+    +++S+NN  
Sbjct: 227 HLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC 281
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Length = 174 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2jwp_A174 Malectin, MGC80075; sugar binding, sugar binding p 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.88
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.88
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.82
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.46
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.42
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.31
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.28
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.21
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.68
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.52
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.35
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.25
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.1
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.01
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.52
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.46
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.41
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.15
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.61
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.58
2o14_A 375 Hypothetical protein YXIM; NESG, X-RAY, SR595, str 93.43
2w3j_A145 Carbohydrate binding module; sugar-binding protein 91.58
2vzp_A127 Aocbm35, EXO-beta-D-glucosaminidase; family 35, CS 91.01
2wz8_A156 Cellulosome protein dockerin type I; sugar binding 90.57
2w47_A144 Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1. 90.19
2w87_A139 Esterase D, XYL-CBM35; plant cell WALL degradation 88.31
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.97  E-value=8.7e-31  Score=254.30  Aligned_cols=234  Identities=20%  Similarity=0.333  Sum_probs=203.8

Q ss_pred             CCCCCcCCC--CCchhhhcCCCCcEEeecc-ccCCCCCchhhcCCCCCCEEEccCCcCCCCchhhhhCCCCcCEEEeeCC
Q 045177            1 SLLANRLTG--PIPKYLANISTLVNLTVQY-NQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDN   77 (461)
Q Consensus         1 ~Ls~N~l~~--~~p~~~~~l~~L~~L~Ls~-n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N   77 (461)
                      +|++|++.+  .+|..|.++++|++|++++ |.+.+.+|..|.++++|++|+|++|.+++.+|..|.++++|++|+|++|
T Consensus        56 ~L~~~~l~~~~~~~~~l~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N  135 (313)
T 1ogq_A           56 DLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYN  135 (313)
T ss_dssp             EEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSS
T ss_pred             ECCCCCccCCcccChhHhCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCC
Confidence            467899999  8999999999999999995 9999999999999999999999999999899999999999999999999


Q ss_pred             cCCCCCchhhccCCCCcEEEccCCCCccCCCCcccccc-cccccccceeeeecccCCCCCCCCCc-ccCCccccEEEccc
Q 045177           78 QFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLE-KFNGLVCMVFLFLRISDLNGPEATFP-QLGNKKMTNLILRN  155 (461)
Q Consensus        78 ~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~-~L~~L~~l~~~~l~~~~l~~~~~~~~-~l~~~~L~~L~L~~  155 (461)
                      ++++.+|..+..+++|++|++++|.+.+.+|..+..+. .|+.        +.++. +.+....| .+...+|++|+|++
T Consensus       136 ~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~--------L~L~~-N~l~~~~~~~~~~l~L~~L~Ls~  206 (313)
T 1ogq_A          136 ALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTS--------MTISR-NRLTGKIPPTFANLNLAFVDLSR  206 (313)
T ss_dssp             EEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCE--------EECCS-SEEEEECCGGGGGCCCSEEECCS
T ss_pred             ccCCcCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcE--------EECcC-CeeeccCChHHhCCcccEEECcC
Confidence            99999999999999999999999999999999888876 6666        44444 22222222 24445599999999


Q ss_pred             CcccccCCccccCCCcccEEeccCCcccCCCCccccCCCCCCEEEccCCcCCCCCCccc--cccCCccccccCcccCCCC
Q 045177          156 CNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWM--LEKGDKIDLSYNNFTDGSA  233 (461)
Q Consensus       156 n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~--~~~l~~LdLs~N~l~~~~p  233 (461)
                      |.+++.+|..+..+++|+.|+|++|++++.+|. +..+++|++|+|++|++++.+|.++  +++|+.|+|++|++++.+|
T Consensus       207 N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip  285 (313)
T 1ogq_A          207 NMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP  285 (313)
T ss_dssp             SEEEECCGGGCCTTSCCSEEECCSSEECCBGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECC
T ss_pred             CcccCcCCHHHhcCCCCCEEECCCCceeeecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCC
Confidence            999999999999999999999999999976665 7889999999999999999999887  6789999999999999998


Q ss_pred             ccccccccccee
Q 045177          234 ESSCQKRSVNLF  245 (461)
Q Consensus       234 ~~~c~~~~l~~~  245 (461)
                      .. ..+..+..+
T Consensus       286 ~~-~~l~~L~~l  296 (313)
T 1ogq_A          286 QG-GNLQRFDVS  296 (313)
T ss_dssp             CS-TTGGGSCGG
T ss_pred             CC-ccccccChH
Confidence            85 445444443
>2jwp_A Malectin, MGC80075; sugar binding, sugar binding protein; NMR {Xenopus laevis} PDB: 2k46_A* 2kr2_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2o14_A Hypothetical protein YXIM; NESG, X-RAY, SR595, structural genomics, PSI-2, protein structure initiative; 2.10A {Bacillus subtilis} SCOP: b.18.1.32 c.23.10.8 Back     alignment and structure
>2w3j_A Carbohydrate binding module; sugar-binding protein, family 35, uronic acid sugars; 1.70A {Uncultured bacterium} Back     alignment and structure
>2vzp_A Aocbm35, EXO-beta-D-glucosaminidase; family 35, CSXA, glucuronic acid, hydrolase; 1.05A {Amycolatopsis orientalis} PDB: 2vzq_A* 2vzr_A* Back     alignment and structure
>2wz8_A Cellulosome protein dockerin type I; sugar binding protein; 1.50A {Clostridium thermocellum} Back     alignment and structure
>2w47_A Lipolytic enzyme, G-D-S-L; hydrolase; HET: UNF; 1.40A {Clostridium thermocellum} PDB: 2w1w_A Back     alignment and structure
>2w87_A Esterase D, XYL-CBM35; plant cell WALL degradation, carbohydrate protein binding, xylan, CMB35, glucuronic acid, hydrolase; HET: GCU; 1.60A {Cellvibrio japonicus} PDB: 2w46_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 461
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d2o14a1146 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Ba 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 78.5 bits (192), Expect = 2e-16
 Identities = 47/203 (23%), Positives = 81/203 (39%), Gaps = 21/203 (10%)

Query: 24  LTVQYNQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDNQFTGQI 83
           L    NQ S   P  + +  NL++L L+ N        T A LTN+ D  + +NQ +   
Sbjct: 202 LIATNNQISDITPLGILT--NLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNLA 257

Query: 84  PSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFPQL 143
           P  +   TKL +L +  + +    P    +      L             N  E   P  
Sbjct: 258 P--LSGLTKLTELKLGANQISNISPLAGLTALTNLELNE-----------NQLEDISPIS 304

Query: 144 GNKKMTNLILRNCNITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTG 203
             K +T L L   NI+   P  +  +T L+ L  + NK+S    S+  +L  ++++    
Sbjct: 305 NLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGH 360

Query: 204 NLLTGAIPPWMLEKGDKIDLSYN 226
           N ++   P   L +  ++ L+  
Sbjct: 361 NQISDLTPLANLTRITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Length = 146 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query461
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.44
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.31
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.2
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.16
d2o14a1146 Hypothetical protein YxiM {Bacillus subtilis [TaxI 98.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.57
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.94  E-value=1.1e-27  Score=230.09  Aligned_cols=235  Identities=20%  Similarity=0.323  Sum_probs=195.2

Q ss_pred             CCCCCcCCC--CCchhhhcCCCCcEEeecc-ccCCCCCchhhcCCCCCCEEEccCCcCCCCchhhhhCCCCcCEEEeeCC
Q 045177            1 SLLANRLTG--PIPKYLANISTLVNLTVQY-NQFSGELPEELGSLLNLEKLHLSSNNFTGELPKTFAKLTNMKDFRIGDN   77 (461)
Q Consensus         1 ~Ls~N~l~~--~~p~~~~~l~~L~~L~Ls~-n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N   77 (461)
                      ||++|++.+  .+|+.++++++|++|+|++ |+++|.+|..|+++++|++|+|++|++.+..+..+..+++|+.+++++|
T Consensus        56 ~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N  135 (313)
T d1ogqa_          56 DLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYN  135 (313)
T ss_dssp             EEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSS
T ss_pred             ECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccc
Confidence            477888988  4789999999999999996 8999999999999999999999999999888888999999999999999


Q ss_pred             cCCCCCchhhccCCCCcEEEccCCCCccCCCCcccccccccccccceeeeecccCCCCCCCCCc-ccCCccccEEEcccC
Q 045177           78 QFTGQIPSFIQNWTKLEKLFIQPSGLVGPIPSGIFSLEKFNGLVCMVFLFLRISDLNGPEATFP-QLGNKKMTNLILRNC  156 (461)
Q Consensus        78 ~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~~l~~~~l~~~~l~~~~~~~~-~l~~~~L~~L~L~~n  156 (461)
                      ++.+.+|..+.++++|+.+++++|.+.+.+|..+..+..+...       +.+.. +......+ .+....+..++++++
T Consensus       136 ~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~-------l~~~~-n~l~~~~~~~~~~l~~~~l~l~~~  207 (313)
T d1ogqa_         136 ALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTS-------MTISR-NRLTGKIPPTFANLNLAFVDLSRN  207 (313)
T ss_dssp             EEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCE-------EECCS-SEEEEECCGGGGGCCCSEEECCSS
T ss_pred             cccccCchhhccCcccceeeccccccccccccccccccccccc-------ccccc-cccccccccccccccccccccccc
Confidence            9999999999999999999999999999999988877665331       22221 11111222 244455667999999


Q ss_pred             cccccCCccccCCCcccEEeccCCcccCCCCccccCCCCCCEEEccCCcCCCCCCccc--cccCCccccccCcccCCCCc
Q 045177          157 NITGELPPYLGKMTTLKVLDLSFNKLSGHIPSNFDDLYEVDYIYFTGNLLTGAIPPWM--LEKGDKIDLSYNNFTDGSAE  234 (461)
Q Consensus       157 ~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~--~~~l~~LdLs~N~l~~~~p~  234 (461)
                      ...+.+|..+..+++|+.|++++|.+++.+| .+..+++|+.|+|++|++++.+|.++  +++|++|||++|+|+|.+|.
T Consensus       208 ~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~  286 (313)
T d1ogqa_         208 MLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ  286 (313)
T ss_dssp             EEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC
T ss_pred             ccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC
Confidence            9998899988999999999999999986655 67888999999999999999999887  67889999999999998886


Q ss_pred             cccccccccee
Q 045177          235 SSCQKRSVNLF  245 (461)
Q Consensus       235 ~~c~~~~l~~~  245 (461)
                      . .++..|..+
T Consensus       287 ~-~~L~~L~~l  296 (313)
T d1ogqa_         287 G-GNLQRFDVS  296 (313)
T ss_dssp             S-TTGGGSCGG
T ss_pred             c-ccCCCCCHH
Confidence            3 444444433
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure