Citrus Sinensis ID: 045209

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MKFFLYFPLIFLSFSLSSAAKCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPEKPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTYFYDYIDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNMDSLRIVKTLKVLDLSRNLVFGKLPKAISGLDKLNVSFNNLCGEIPKTKFPASAFVGNECLCGPPLPSSSCKCVCGK
ccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEcccccEEEEEccccccccccccEEEccccccccccccEEccccccccEEcccccccccccccEEEccccEEEccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccHHHHccccccEEEccccccEEcccHHccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccccccccccEEEccccccccccccHHHHccccccEEcccccccEEEcccccccccccccEEEcccccccccccHHHHcccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccEEEEEcccccEEEEccccEEEcccccccccccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccccccccccEEEEccccccccccHHHHcccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHccccccEEEEccccccccccccHcccccccEEEcccccccccccHHHccccEEEccccEEEEEcccccccHHHHcccccccccccccccccccccc
MKFFLYFPLIFLSFslssaakchpddesglsgfksaitqdpsgmlsswkpgtdcctwtgitclsgdrvtslslngqpekpnsflsgtisSSLVKVKNlggiylqdlgnisgnfpdfisglpelkYIYIEnnklsgqipanigkltqlealsfsgnrftgpipssisqLTQLTQLKLGQnfltgaipngisqlknlTYLDLqhnqlsgaiPDIFSSLKKLLFLTLSFNkfsgniptsiaslapQLQYLKLGhnvlsgkvpdflgkfhsldtldlswnqfsgtlpksfsNLTKIFNLNLaynsltdpfpvmnvkgieslDLSYNQFhlqqipswvtsspiifSLKLAKCGIkmnlnnwkpaqtyfydyidlseneisggpvellnRTDYLVEFRAsgsklkfnMDSLRIVKTLKvldlsrnlvfgklpkaisgldkLNVSFNnlcgeipktkfpasafvgneclcgpplpsssckcvcgk
MKFFLYFPLIFLSFSLSSAAKCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPEKPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTYFYDYIDLSENEISGGPVELLNRTDYLVEFRasgsklkfnmdSLRIVKTLKVLDLSRNLVFGKlpkaisgldkLNVSFNNLCGEIPKTKFPASAFVGNEClcgpplpsssckcvcgk
MKfflyfpliflsfslssAAKCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPEKPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISqltqltqlklgqNFLTGAIPNGISQLKNLTYLDLQHNQLSGAIPDIfsslkkllfltlsfnkfsGNIPTSIASLAPQLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTYFYDYIDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNMDSLRIVKTLKVLDLSRNLVFGKLPKAISGLDKLNVSFNNLCGEIPKTKFPASAFVGNECLCGPPLPSSSCKCVCGK
**FFLYFPLIFLSFSLSSA**************************SSWKPGTDCCTWTGITCLSGDRVTSL************LSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTYFYDYIDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNMDSLRIVKTLKVLDLSRNLVFGKLPKAISGLDKLNVSFNNLCGEIPKTKFPASAFVGNECLCGPPLP***CKCV***
MKFFLYFPLIFLSFSLSSAAKCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPEKPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTYFYDYIDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNMDSLRIVKTLKVLDLSRNLVFGKLPKAISGLDKLNVSFNNLCGEIPKTKFPASAFVGNECLCGPPL****C******
MKFFLYFPLIFLSFSLSSA**********LSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPEKPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTYFYDYIDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNMDSLRIVKTLKVLDLSRNLVFGKLPKAISGLDKLNVSFNNLCGEIPKTKFPASAFVGNECLCGPPLP**********
MKFFLYFPLIFLSFSLSSAAKCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPEKPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTYFYDYIDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNMDSLRIVKTLKVLDLSRNLVFGKLPKAISGLDKLNVSFNNLCGEIPKTKFPASAFVGNECLCGPPLPSSSC******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFFLYFPLIFLSFSLSSAAKCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPEKPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTYFYDYIDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNMDSLRIVKTLKVLDLSRNLVFGKLPKAISGLDKLNVSFNNLCGEIPKTKFPASAFVGNECLCGPPLPSSSCKCVCGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query478 2.2.26 [Sep-21-2011]
Q00874372 DNA-damage-repair/tolerat no no 0.644 0.827 0.345 2e-46
Q9C9H7 847 Receptor-like protein 12 no no 0.912 0.514 0.300 5e-43
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.805 0.307 0.311 7e-42
C0LGQ5 1249 LRR receptor-like serine/ no no 0.809 0.309 0.308 3e-41
O82318 960 Probably inactive leucine no no 0.889 0.442 0.329 9e-41
Q42371 976 LRR receptor-like serine/ no no 0.943 0.462 0.298 2e-40
Q9FL28 1173 LRR receptor-like serine/ no no 0.880 0.358 0.319 9e-40
C0LGS2 1136 Probable LRR receptor-lik no no 0.916 0.385 0.309 2e-38
Q9FRS6 1029 Leucine-rich repeat recep no no 0.803 0.373 0.322 4e-37
Q9LHP4 1141 Receptor-like protein kin no no 0.734 0.307 0.333 3e-36
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function desciption
 Score =  187 bits (475), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/321 (34%), Positives = 184/321 (57%), Gaps = 13/321 (4%)

Query: 22  CHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCC-TWTGITCL-SGDRVTSLSLNGQPEK 79
           C P D++ L+ FKS++++   G+ ++W   TDCC  W GI+C     RVT +SL G+ E 
Sbjct: 27  CSPKDQTALNAFKSSLSEPNLGIFNTWSENTDCCKEWYGISCDPDSGRVTDISLRGESED 86

Query: 80  P-------NSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNK 132
                   + ++SG+I  ++  +  L  + L D   I+G  P  I+ L  L+ + +  NK
Sbjct: 87  AIFQKAGRSGYMSGSIDPAVCDLTALTSLVLADWKGITGEIPPCITSLASLRILDLAGNK 146

Query: 133 LSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQL 192
           ++G+IPA IGKL++L  L+ + N+ +G IP+S++ L +L  L+L +N +TG IP     L
Sbjct: 147 ITGEIPAEIGKLSKLAVLNLAENQMSGEIPASLTSLIELKHLELTENGITGVIPADFGSL 206

Query: 193 KNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHN 252
           K L+ + L  N+L+G+IP+  S +++L  L LS N   G IP  + ++   L  L L  N
Sbjct: 207 KMLSRVLLGRNELTGSIPESISGMERLADLDLSKNHIEGPIPEWMGNMK-VLSLLNLDCN 265

Query: 253 VLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFP--VMN 310
            L+G +P  L     LD  +LS N   GT+P  F + T + +L+L++NSL+   P  + +
Sbjct: 266 SLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRIPDSLSS 325

Query: 311 VKGIESLDLSYNQFHLQQIPS 331
            K +  LD+S+N+    +IP+
Sbjct: 326 AKFVGHLDISHNKL-CGRIPT 345
This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
255569060477 serine-threonine protein kinase, plant-t 0.972 0.974 0.710 0.0
224136153478 predicted protein [Populus trichocarpa] 0.951 0.951 0.701 0.0
224136149478 predicted protein [Populus trichocarpa] 0.960 0.960 0.691 0.0
359493576483 PREDICTED: probable LRR receptor-like se 0.951 0.942 0.693 0.0
297846338477 hypothetical protein ARALYDRAFT_890938 [ 0.945 0.947 0.690 0.0
10998936512 hypothetical protein [Arabidopsis thalia 0.983 0.917 0.663 0.0
18398912477 leucine-rich repeat-containing protein [ 0.983 0.985 0.663 0.0
21536600477 putative disease resistance protein [Ara 0.983 0.985 0.661 0.0
312282123482 unnamed protein product [Thellungiella h 0.981 0.973 0.650 1e-178
357455951479 Receptor-like protein kinase [Medicago t 0.939 0.937 0.699 1e-176
>gi|255569060|ref|XP_002525499.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223535178|gb|EEF36857.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/466 (71%), Positives = 397/466 (85%), Gaps = 1/466 (0%)

Query: 3   FFLYFPLIFLSFSLSSAAKCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITC 62
           FFL   L   S +L+SAA CH DDE+GL   KS+IT DPSG+L SWKPGTDCC+W GITC
Sbjct: 8   FFLSVLLALHSLTLTSAA-CHVDDEAGLLALKSSITHDPSGILISWKPGTDCCSWEGITC 66

Query: 63  LSGDRVTSLSLNGQPEKPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPE 122
           L G+RVT++ L+GQ EKPNSFLSGTIS SLVKV+NL GIYL +L NI+G FPD +  LP+
Sbjct: 67  LVGNRVTAIWLSGQLEKPNSFLSGTISPSLVKVQNLDGIYLMNLRNITGKFPDVLFRLPK 126

Query: 123 LKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLT 182
           LK++YIENNKLSGQ+P+NIG+LTQLEA S +GN+FTGPIPSSIS+LT+L+QLKLG NFLT
Sbjct: 127 LKFVYIENNKLSGQLPSNIGRLTQLEAFSLAGNQFTGPIPSSISKLTKLSQLKLGNNFLT 186

Query: 183 GAIPNGISQLKNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAP 242
           G IP GI++LK+LT+L L++NQLSG IPD FSS   L  + LS NK SG IP S++SLAP
Sbjct: 187 GTIPVGINKLKSLTFLSLKNNQLSGPIPDFFSSFTNLRIIELSHNKLSGKIPASLSSLAP 246

Query: 243 QLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSL 302
            L YL+LGHN LSG++P+FLG   +LDTLDLSWN  +GT+PKSF NLTKIFNL+L++NSL
Sbjct: 247 NLAYLELGHNALSGQIPNFLGSLQALDTLDLSWNNLTGTVPKSFGNLTKIFNLDLSHNSL 306

Query: 303 TDPFPVMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTY 362
           TDPFPVMNVKGIESLDLSYN+FHL+QIP+WVTSSPII+SLKLAKCGIKMNLN+WKP +TY
Sbjct: 307 TDPFPVMNVKGIESLDLSYNRFHLKQIPNWVTSSPIIYSLKLAKCGIKMNLNDWKPKETY 366

Query: 363 FYDYIDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNMDSLRIVKTLKVLDLSRNLVF 422
           FYDYIDLSEN ISG P+ LLN+TD+LV F AS +KLKF++  LRIV TLK LDLSRNLV+
Sbjct: 367 FYDYIDLSENNISGSPIWLLNKTDFLVGFWASKNKLKFDLGKLRIVNTLKKLDLSRNLVY 426

Query: 423 GKLPKAISGLDKLNVSFNNLCGEIPKTKFPASAFVGNECLCGPPLP 468
           GK+PK ++GL+ LN+S+N+LCG+IP TKF ASAFVGN+CLCG PLP
Sbjct: 427 GKIPKNVTGLESLNLSYNHLCGQIPATKFSASAFVGNDCLCGSPLP 472

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224136153|ref|XP_002327394.1| predicted protein [Populus trichocarpa] gi|222835764|gb|EEE74199.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224136149|ref|XP_002327393.1| predicted protein [Populus trichocarpa] gi|222835763|gb|EEE74198.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493576|ref|XP_003634629.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297846338|ref|XP_002891050.1| hypothetical protein ARALYDRAFT_890938 [Arabidopsis lyrata subsp. lyrata] gi|297336892|gb|EFH67309.1| hypothetical protein ARALYDRAFT_890938 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|10998936|gb|AAG26075.1|AC069299_1 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18398912|ref|NP_564426.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] gi|332193485|gb|AEE31606.1| leucine-rich repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21536600|gb|AAM60932.1| putative disease resistance protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312282123|dbj|BAJ33927.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|357455951|ref|XP_003598256.1| Receptor-like protein kinase [Medicago truncatula] gi|355487304|gb|AES68507.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query478
TAIR|locus:2197563477 AT1G33590 [Arabidopsis thalian 0.947 0.949 0.639 5.3e-159
TAIR|locus:2197586478 AT1G33600 [Arabidopsis thalian 0.945 0.945 0.561 3e-133
TAIR|locus:2066306480 AT2G26380 [Arabidopsis thalian 0.947 0.943 0.548 6.4e-131
TAIR|locus:2012633455 AT1G33670 [Arabidopsis thalian 0.809 0.850 0.472 6.5e-90
TAIR|locus:2154463589 AT5G23400 [Arabidopsis thalian 0.880 0.714 0.322 1.6e-56
TAIR|locus:2091260372 DRT100 "DNA-DAMAGE REPAIR/TOLE 0.644 0.827 0.314 8.7e-40
TAIR|locus:2182260371 AT5G12940 [Arabidopsis thalian 0.635 0.819 0.336 7.8e-39
TAIR|locus:2043540 960 AT2G25790 [Arabidopsis thalian 0.864 0.430 0.316 2.1e-38
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.836 0.352 0.300 5e-38
TAIR|locus:2091871365 AT3G20820 [Arabidopsis thalian 0.642 0.841 0.327 8.9e-38
TAIR|locus:2197563 AT1G33590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1549 (550.3 bits), Expect = 5.3e-159, P = 5.3e-159
 Identities = 291/455 (63%), Positives = 355/455 (78%)

Query:    19 AAKCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPE 78
             AA CHPDDE+GL  FK+ IT+DPSG+LSSWK GT CC+W G+TCL+ DRV++LS+ GQ +
Sbjct:    24 AATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQAD 83

Query:    79 KPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIP 138
                SFLSGT+S SL K+K+L GIY  DL NI+G+FP F+  LP LKY+YIENN+LSG +P
Sbjct:    84 VAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLP 143

Query:   139 ANIGKLTQLEALSFSGNRFTGPIPSSISXXXXXXXXXXXXNFLTGAIPNGISQLKNLTYL 198
             ANIG L+QLEA S  GNRFTGPIPSSIS            N LTG IP G++ LK ++YL
Sbjct:   144 ANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYL 203

Query:   199 DLQHNQLSGAIPDIXXXXXXXXXXXXXXXXXXGNIPTSIASLAPQLQYLKLGHNVLSGKV 258
             +L  N+L+G IPDI                  GN+P SIASLAP L++L+LGHN LSG +
Sbjct:   204 NLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTI 263

Query:   259 PDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVMNVKGIESLD 318
             P+FL  F +LDTLDLS N+FSG +PKSF+NLTKIFNL+L++N LTDPFPV+NVKGIESLD
Sbjct:   264 PNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLD 323

Query:   319 LSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNNWKPAQTYFYDYIDLSENEISGGP 378
             LSYNQFHL  IP WVTSSPIIFSLKLAKCGIKM+L++WKPAQT++YD+IDLSENEI+G P
Sbjct:   324 LSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSP 383

Query:   379 VELLNRTDYLVEFRASGSKLKFNMDSLRIVKTLKVLDLSRNLVFGKLPKAISGLDKLNVS 438
                LN+T+YLVEF+A+G+KL+F+M  L   KTL  LD+SRNLVFGK+P  ++GL  LNVS
Sbjct:   384 ARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVS 443

Query:   439 FNNLCGEIPKTKFPASAFVGNECLCGPPLPSSSCK 473
              N+LCG++P TKFPASAFVGN+CLCG PL  S CK
Sbjct:   444 HNHLCGKLPVTKFPASAFVGNDCLCGSPL--SPCK 476
GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0080167 "response to karrikin" evidence=IEP
GO:0005829 "cytosol" evidence=RCA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
TAIR|locus:2197586 AT1G33600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066306 AT2G26380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012633 AT1G33670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154463 AT5G23400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091260 DRT100 "DNA-DAMAGE REPAIR/TOLERATION 100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182260 AT5G12940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043540 AT2G25790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091871 AT3G20820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00410224
hypothetical protein (478 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00660138
hypothetical protein (475 aa)
  •     0.425

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-49
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-45
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 8e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  180 bits (458), Expect = 4e-49
 Identities = 136/395 (34%), Positives = 196/395 (49%), Gaps = 31/395 (7%)

Query: 82  SFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANI 141
           + L G I +SL  + +L  + L     + G  P  +  +  LK+IY+  N LSG+IP  I
Sbjct: 174 NVLVGKIPNSLTNLTSLEFLTLAS-NQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEI 232

Query: 142 GKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKNLTYLDLQ 201
           G LT L  L    N  TGPIPSS+  L  L  L L QN L+G IP  I  L+ L  LDL 
Sbjct: 233 GGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLS 292

Query: 202 HNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSGKVPDF 261
            N LSG IP++   L+ L  L L  N F+G IP ++ SL P+LQ L+L  N  SG++P  
Sbjct: 293 DNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSL-PRLQVLQLWSNKFSGEIPKN 351

Query: 262 LGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFP--VMNVKGIESLDL 319
           LGK ++L  LDLS N  +G +P+   +   +F L L  NSL    P  +   + +  + L
Sbjct: 352 LGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRL 411

Query: 320 SYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKMNLNN--WKPAQTYFYDY----------- 366
             N F   ++PS  T  P+++ L ++   ++  +N+  W                     
Sbjct: 412 QDNSFS-GELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPD 470

Query: 367 ---------IDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNM-DSLRIVKTLKVLDL 416
                    +DLS N+ SG     L     L++ + S +KL   + D L   K L  LDL
Sbjct: 471 SFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDL 530

Query: 417 SRNLVFGKLPKAISG---LDKLNVSFNNLCGEIPK 448
           S N + G++P + S    L +L++S N L GEIPK
Sbjct: 531 SHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPK 565

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 478
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PLN03150623 hypothetical protein; Provisional 99.54
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.12
PLN03150623 hypothetical protein; Provisional 99.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.05
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.93
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.93
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.34
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.21
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.17
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.99
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.96
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.79
KOG4341483 consensus F-box protein containing LRR [General fu 97.76
PRK15386426 type III secretion protein GogB; Provisional 97.68
PRK15386 426 type III secretion protein GogB; Provisional 97.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.59
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.45
KOG4341483 consensus F-box protein containing LRR [General fu 97.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.21
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.14
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.91
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.43
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.37
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.71
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.33
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.09
KOG4308478 consensus LRR-containing protein [Function unknown 92.31
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.24
KOG4308478 consensus LRR-containing protein [Function unknown 92.23
smart0037026 LRR Leucine-rich repeats, outliers. 91.57
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.57
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.9
smart0037026 LRR Leucine-rich repeats, outliers. 87.9
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.34
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.12
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.4e-50  Score=445.10  Aligned_cols=414  Identities=33%  Similarity=0.536  Sum_probs=268.3

Q ss_pred             ChhhHHHHHHHHHhCCCCCCCCCCCCCCCCCCCcccceeeCCCCCEEEEEcCCCCCCCCCcceeecccccccCCCCCeee
Q 045209           23 HPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPEKPNSFLSGTISSSLVKVKNLGGIY  102 (478)
Q Consensus        23 ~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~C~~~~~v~~l~l~~~~~~~~~~~~~~~~~~l~~l~~L~~L~  102 (478)
                      +++|+.||++||+++. +|.+.+.+|+.+.+||.|.||+|+..++|+.|++++.      .+.|.+++.+..+++|++|+
T Consensus        27 ~~~~~~~l~~~~~~~~-~~~~~~~~w~~~~~~c~w~gv~c~~~~~v~~L~L~~~------~i~~~~~~~~~~l~~L~~L~   99 (968)
T PLN00113         27 HAEELELLLSFKSSIN-DPLKYLSNWNSSADVCLWQGITCNNSSRVVSIDLSGK------NISGKISSAIFRLPYIQTIN   99 (968)
T ss_pred             CHHHHHHHHHHHHhCC-CCcccCCCCCCCCCCCcCcceecCCCCcEEEEEecCC------CccccCChHHhCCCCCCEEE
Confidence            6789999999999984 6777788998888999999999987789999999974      46777777888888888888


Q ss_pred             cCCCCCcccccCccCC-CCCCCCEEEccCCCCCCCCCcccCCCCCCCEEEeecCcCCCCCchhhcCCCCCCEEEeecccC
Q 045209          103 LQDLGNISGNFPDFIS-GLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFL  181 (478)
Q Consensus       103 l~~~~~~~~~~~~~l~-~l~~L~~L~Ls~n~~~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l  181 (478)
                      ++++ .+.+.+|..+. .+++|++|++++|.+++.+|.  ..+++|++|++++|.+++..|..+..+++|++|++++|.+
T Consensus       100 Ls~n-~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l  176 (968)
T PLN00113        100 LSNN-QLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVL  176 (968)
T ss_pred             CCCC-ccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcc
Confidence            8876 67777776543 777777777777777665554  3456666666666666666666666666666666666666


Q ss_pred             CCCCCccCCCCCCCCEEEccCCCCCCCCchhhhCCCCCcEEEcccCcCccccchHHHhccccCcEEEccCccCCCCCCcc
Q 045209          182 TGAIPNGISQLKNLTYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSGKVPDF  261 (478)
Q Consensus       182 ~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~  261 (478)
                      .+.+|..+.++++|++|++++|.+.+.+|..+..+++|++|++++|.+.+.+|..+..+. +|++|++++|.+++.+|..
T Consensus       177 ~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~-~L~~L~L~~n~l~~~~p~~  255 (968)
T PLN00113        177 VGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLT-SLNHLDLVYNNLTGPIPSS  255 (968)
T ss_pred             cccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCC-CCCEEECcCceeccccChh
Confidence            666666666666666666666666666666666666666666666666666666655553 6666666666666556666


Q ss_pred             cCCCCCCCEEeccCCcCCccchhhhcCCCCCCEEeccCCcCCCCCCc--cCcCCCCEEEccCCCCCCCCCCccccCCCCc
Q 045209          262 LGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPV--MNVKGIESLDLSYNQFHLQQIPSWVTSSPII  339 (478)
Q Consensus       262 l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~--~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L  339 (478)
                      ++.+++|++|++++|.+.+.+|..+..+++|+.|++++|.+.+..+.  ..+++|++|++++|.++ +.+|..+..+++|
T Consensus       256 l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~-~~~~~~~~~l~~L  334 (968)
T PLN00113        256 LGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFT-GKIPVALTSLPRL  334 (968)
T ss_pred             HhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccC-CcCChhHhcCCCC
Confidence            66666666666666666555555566666666666666655543332  24455555555555552 4445555555555


Q ss_pred             cEEEccCCCCcccCCCCccccc-----------------------cCCcEEEccCCcccccCccccccCCCCcEEECcCC
Q 045209          340 FSLKLAKCGIKMNLNNWKPAQT-----------------------YFYDYIDLSENEISGGPVELLNRTDYLVEFRASGS  396 (478)
Q Consensus       340 ~~L~l~~n~l~~~~~~~~~~~~-----------------------~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~ls~n  396 (478)
                      +.|++++|.+.+.+|.......                       ..++.|++++|.+.+.+|..+..+++|+.|++++|
T Consensus       335 ~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n  414 (968)
T PLN00113        335 QVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDN  414 (968)
T ss_pred             CEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCC
Confidence            5555555555544443222111                       12455555555555555555555666666666666


Q ss_pred             cCcccC-CCccCCCCCCEEECCCCcCcccCCcc---CCCCCeeeccCCcccccCCC
Q 045209          397 KLKFNM-DSLRIVKTLKVLDLSRNLVFGKLPKA---ISGLDKLNVSFNNLCGEIPK  448 (478)
Q Consensus       397 ~l~~~~-~~~~~l~~L~~L~Ls~N~l~~~~p~~---l~~L~~L~ls~N~l~~~ip~  448 (478)
                      ++++.. ..+..++.|+.|++++|++++.+|..   +.+|+.|++++|++.|.+|.
T Consensus       415 ~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~  470 (968)
T PLN00113        415 SFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPD  470 (968)
T ss_pred             EeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCc
Confidence            665433 34556666666666666666666643   34566677777777666665

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-27
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-25
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-25
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-04
1otm_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 6e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 6e-04
1otn_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 7e-04
1oto_A236 Calcium-Binding Mutant Of The Internalin B Lrr Doma 7e-04
1d0b_A213 Internalin B Leucine Rich Repeat Domain Length = 21 9e-04
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (296), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 123/251 (49%), Gaps = 38/251 (15%)
Query: 231 GNIPTSIASLAPQLQYLKLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLT 290
           G IP +IA L  QL YL + H  +SG +PDFL +  +L TLD S+N  SGTLP S S+L 
Sbjct: 91  GPIPPAIAKLT-QLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLP 149
Query: 291 KIFNLNLAYNSLTDPFPVMN---VKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKC 347
            +  +    N ++   P       K   S+ +S N+    +IP      P   +L LA  
Sbjct: 150 NLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLT-GKIP------PTFANLNLA-- 200
Query: 348 GIKMNLNNWKPAQTYFYDYIDLSENEISGGPVELLNRTDYLVEFRASGSKLKFNMDSLRI 407
                             ++DLS N + G    L        +   + + L F++  + +
Sbjct: 201 ------------------FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGL 242
Query: 408 VKTLKVLDLSRNLVFGKLPKAISG---LDKLNVSFNNLCGEIPK----TKFPASAFVGNE 460
            K L  LDL  N ++G LP+ ++    L  LNVSFNNLCGEIP+     +F  SA+  N+
Sbjct: 243 SKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNK 302
Query: 461 CLCGPPLPSSS 471
           CLCG PLP+ +
Sbjct: 303 CLCGSPLPACT 313
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|1OTM|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|1OTN|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1OTO|A Chain A, Calcium-Binding Mutant Of The Internalin B Lrr Domain Length = 236 Back     alignment and structure
>pdb|1D0B|A Chain A, Internalin B Leucine Rich Repeat Domain Length = 213 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query478
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-66
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-80
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-72
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-45
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-43
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-50
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-45
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-45
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-43
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-34
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-38
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-35
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-37
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-32
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-24
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-30
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-29
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-28
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-31
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-25
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-30
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-30
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-26
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-27
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-27
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-20
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-24
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-21
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-24
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-23
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-23
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-22
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-21
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-21
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-17
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-20
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-20
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-17
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  266 bits (682), Expect = 3e-86
 Identities = 97/310 (31%), Positives = 150/310 (48%), Gaps = 20/310 (6%)

Query: 22  CHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCC--TWTGITCLS---GDRVTSLSLNGQ 76
           C+P D+  L   K  +    +  LSSW P TDCC  TW G+ C +     RV +L L   
Sbjct: 3   CNPQDKQALLQIKKDLGNPTT--LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDL--- 57

Query: 77  PEKPNSFLSGT--ISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLS 134
                  L     I SSL  +  L  +Y+  + N+ G  P  I+ L +L Y+YI +  +S
Sbjct: 58  ---SGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS 114

Query: 135 GQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKN 194
           G IP  + ++  L  L FS N  +G +P SIS L  L  +    N ++GAIP+       
Sbjct: 115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSK 174

Query: 195 L-TYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNV 253
           L T + +  N+L+G IP  F++L  L F+ LS N   G+      S     Q + L  N 
Sbjct: 175 LFTSMTISRNRLTGKIPPTFANL-NLAFVDLSRNMLEGDASVLFGSD-KNTQKIHLAKNS 232

Query: 254 LSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVM-NVK 312
           L+  +   +G   +L+ LDL  N+  GTLP+  + L  + +LN+++N+L    P   N++
Sbjct: 233 LAFDLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQ 291

Query: 313 GIESLDLSYN 322
             +    + N
Sbjct: 292 RFDVSAYANN 301
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.31
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.1
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.09
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.91
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.9
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.68
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.52
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.97
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.9
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.78
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.1e-57  Score=485.09  Aligned_cols=445  Identities=31%  Similarity=0.499  Sum_probs=273.8

Q ss_pred             CCCCCChhhHHHHHHHHHhCCCCCCCCCCCCCCCCCCCcccceeeCCCCCEEEEEcCCCCC-------------------
Q 045209           18 SAAKCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCCTWTGITCLSGDRVTSLSLNGQPE-------------------   78 (478)
Q Consensus        18 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~C~~~~~v~~l~l~~~~~-------------------   78 (478)
                      +++++.++|+.||++||+++. ||. .+++|..+++||.|.||+|+ .++|++|+|++...                   
T Consensus         5 ~~~~~~~~~~~all~~k~~~~-~~~-~l~~W~~~~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~   81 (768)
T 3rgz_A            5 SPSQSLYREIHQLISFKDVLP-DKN-LLPDWSSNKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLES   81 (768)
T ss_dssp             ---CCHHHHHHHHHHHHTTCS-CTT-SSTTCCTTSCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCE
T ss_pred             ccccCCHHHHHHHHHHHhhCC-Ccc-cccCCCCCCCCcCCcceEEC-CCcEEEEECCCCCcCCccCccChhHhccCcccc
Confidence            344557889999999999996 776 88999988899999999998 78999999987531                   


Q ss_pred             -------------------------CCCCcceeeccc--ccccCCCCCeeecCCCCCcccccCccC--------------
Q 045209           79 -------------------------KPNSFLSGTISS--SLVKVKNLGGIYLQDLGNISGNFPDFI--------------  117 (478)
Q Consensus        79 -------------------------~~~~~~~~~~~~--~l~~l~~L~~L~l~~~~~~~~~~~~~l--------------  117 (478)
                                               .+.+.+.|.+|.  .+.++++|++|+++++ .+.+.+|..+              
T Consensus        82 l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n-~l~~~~~~~~~~~l~~L~~L~Ls~  160 (768)
T 3rgz_A           82 LFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSN-TLDFPGKVSGGLKLNSLEVLDLSA  160 (768)
T ss_dssp             EECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSS-EEECCSSCCSCCCCTTCSEEECCS
T ss_pred             cCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCC-ccCCcCCHHHhccCCCCCEEECCC
Confidence                                     123445566666  6666666666666655 3333333221              


Q ss_pred             ------------------------------------CCCCCCCEEEccCCCCCCCCCcccCCCCCCCEEEeecCcCCCCC
Q 045209          118 ------------------------------------SGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPI  161 (478)
Q Consensus       118 ------------------------------------~~l~~L~~L~Ls~n~~~~~~~~~l~~l~~L~~L~L~~n~i~~~~  161 (478)
                                                          ..+++|++|++++|.+++.+|. +.++++|++|++++|.+++.+
T Consensus       161 n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~  239 (768)
T 3rgz_A          161 NSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDF  239 (768)
T ss_dssp             SCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCH
T ss_pred             CccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcc
Confidence                                                2334444444444444444444 556666666666666666555


Q ss_pred             chhhcCCCCCCEEEeecccCCC----------------------CCCccCCCC-CCCCEEEccCCCCCCCCchh------
Q 045209          162 PSSISQLTQLTQLKLGQNFLTG----------------------AIPNGISQL-KNLTYLDLQHNQLSGAIPDI------  212 (478)
Q Consensus       162 ~~~~~~l~~L~~L~L~~n~l~~----------------------~~~~~l~~l-~~L~~L~l~~n~l~~~~~~~------  212 (478)
                      |..+..+++|++|++++|.+.+                      .+|..+... ++|++|++++|.+.+.+|..      
T Consensus       240 ~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~  319 (768)
T 3rgz_A          240 SRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSL  319 (768)
T ss_dssp             HHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTT
T ss_pred             cHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCC
Confidence            5555555555555555544432                      233333332 44555555544444333333      


Q ss_pred             -------------------hhCCCCCcEEEcccCcCccccchHHHhcc--------------------------ccCcEE
Q 045209          213 -------------------FSSLKKLLFLTLSFNKFSGNIPTSIASLA--------------------------PQLQYL  247 (478)
Q Consensus       213 -------------------l~~l~~L~~L~L~~n~l~~~~~~~~~~~~--------------------------~~L~~L  247 (478)
                                         +..+++|++|++++|.+++.+|..+....                          ++|++|
T Consensus       320 L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L  399 (768)
T 3rgz_A          320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL  399 (768)
T ss_dssp             CCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEE
T ss_pred             ccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEE
Confidence                               34444444444444444434443333221                          123333


Q ss_pred             EccCccCCCCCCcccCCCCCCCEEeccCCcCCc------------------------cchhhhcCCCCCCEEeccCCcCC
Q 045209          248 KLGHNVLSGKVPDFLGKFHSLDTLDLSWNQFSG------------------------TLPKSFSNLTKIFNLNLAYNSLT  303 (478)
Q Consensus       248 ~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~------------------------~~~~~l~~l~~L~~L~L~~n~l~  303 (478)
                      ++++|.+++.+|..+..+++|++|++++|++++                        .+|..+..+++|++|++++|.++
T Consensus       400 ~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~  479 (768)
T 3rgz_A          400 YLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLT  479 (768)
T ss_dssp             ECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCC
T ss_pred             ECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCccc
Confidence            333333333333334444444444444444443                        34444444444444444444444


Q ss_pred             CCCC--ccCcCCCCEEEccCCCCCCCCCCccccCCCCccEEEccCCCCcc------------------------cCCCCc
Q 045209          304 DPFP--VMNVKGIESLDLSYNQFHLQQIPSWVTSSPIIFSLKLAKCGIKM------------------------NLNNWK  357 (478)
Q Consensus       304 ~~~~--~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~~L~~L~l~~n~l~~------------------------~~~~~~  357 (478)
                      +..+  ...+++|++|++++|+++ +.+|.++..+++|++|++++|.+.+                        .+|...
T Consensus       480 ~~~p~~l~~l~~L~~L~L~~N~l~-~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~  558 (768)
T 3rgz_A          480 GEIPSGLSNCTNLNWISLSNNRLT-GEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM  558 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCC-SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGG
T ss_pred             CcCCHHHhcCCCCCEEEccCCccC-CcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHH
Confidence            3322  224455666666666653 4555555555555555555555544                        333211


Q ss_pred             cc---------------------------------------------------------------------cccCCcEEE
Q 045209          358 PA---------------------------------------------------------------------QTYFYDYID  368 (478)
Q Consensus       358 ~~---------------------------------------------------------------------~~~~L~~L~  368 (478)
                      ..                                                                     ....+++||
T Consensus       559 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~Ld  638 (768)
T 3rgz_A          559 FKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLD  638 (768)
T ss_dssp             GTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEE
T ss_pred             hcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEE
Confidence            00                                                                     012367899


Q ss_pred             ccCCcccccCccccccCCCCcEEECcCCcCcccC-CCccCCCCCCEEECCCCcCcccCCccC---CCCCeeeccCCcccc
Q 045209          369 LSENEISGGPVELLNRTDYLVEFRASGSKLKFNM-DSLRIVKTLKVLDLSRNLVFGKLPKAI---SGLDKLNVSFNNLCG  444 (478)
Q Consensus       369 Ls~n~l~~~~~~~l~~l~~L~~L~ls~n~l~~~~-~~~~~l~~L~~L~Ls~N~l~~~~p~~l---~~L~~L~ls~N~l~~  444 (478)
                      +++|++++.+|..+..++.|++|++++|+++|.+ ..+..+++|+.|||++|+++|.+|..+   ..|++||+++|+++|
T Consensus       639 Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g  718 (768)
T 3rgz_A          639 MSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSG  718 (768)
T ss_dssp             CCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEE
T ss_pred             CcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccc
Confidence            9999999999999999999999999999999755 578999999999999999999999876   568899999999999


Q ss_pred             cCCCC----CCCCCcccCCCCCCCCCCC
Q 045209          445 EIPKT----KFPASAFVGNECLCGPPLP  468 (478)
Q Consensus       445 ~ip~~----~~~~~~~~~n~~lc~~~~~  468 (478)
                      .||..    .|+..+|.||+.+||.++.
T Consensus       719 ~iP~~~~~~~~~~~~~~gN~~Lcg~~l~  746 (768)
T 3rgz_A          719 PIPEMGQFETFPPAKFLNNPGLCGYPLP  746 (768)
T ss_dssp             ECCSSSSGGGSCGGGGCSCTEEESTTSC
T ss_pred             cCCCchhhccCCHHHhcCCchhcCCCCc
Confidence            99976    6778899999999998875
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 478
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-27
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-10
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  109 bits (272), Expect = 2e-27
 Identities = 85/309 (27%), Positives = 134/309 (43%), Gaps = 14/309 (4%)

Query: 22  CHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCC--TWTGITCLSGD---RVTSLSLNGQ 76
           C+P D+  L   K  +    +  LSSW P TDCC  TW G+ C +     RV +L L+G 
Sbjct: 3   CNPQDKQALLQIKKDLGNPTT--LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL 60

Query: 77  PEKPNSFLSGTISSSLVKVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQ 136
               N      I SSL  +  L  +Y+  + N+ G  P  I+ L +L Y+YI +  +SG 
Sbjct: 61  ----NLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGA 116

Query: 137 IPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQLKLGQNFLTGAIPNGISQLKNLT 196
           IP  + ++  L  L FS N  +G +P SIS L  L  +    N ++GAIP+       L 
Sbjct: 117 IPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLF 176

Query: 197 YLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHNVLSG 256
                             +   L F+ LS N   G+      S     +     +++   
Sbjct: 177 TSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD 236

Query: 257 KVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPVM-NVKGIE 315
                L K  +    DL  N+  GTLP+  + L  + +LN+++N+L    P   N++  +
Sbjct: 237 LGKVGLSKNLNGL--DLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFD 294

Query: 316 SLDLSYNQF 324
               + N+ 
Sbjct: 295 VSAYANNKC 303
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query478
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.72
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.65
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.03
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.3e-40  Score=317.77  Aligned_cols=293  Identities=33%  Similarity=0.595  Sum_probs=245.1

Q ss_pred             CCChhhHHHHHHHHHhCCCCCCCCCCCCCCCCCCC--cccceeeCCC---CCEEEEEcCCCCCCCCCccee--ecccccc
Q 045209           21 KCHPDDESGLSGFKSAITQDPSGMLSSWKPGTDCC--TWTGITCLSG---DRVTSLSLNGQPEKPNSFLSG--TISSSLV   93 (478)
Q Consensus        21 ~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~c--~w~gv~C~~~---~~v~~l~l~~~~~~~~~~~~~--~~~~~l~   93 (478)
                      -|+|+|++||++||+++. +| ..+++|..++|||  .|.||+|+..   +||++|+|++.      .+.|  .+|+.++
T Consensus         2 ~c~~~e~~aLl~~k~~~~-~~-~~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~------~l~g~~~lp~~l~   73 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLG-NP-TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGL------NLPKPYPIPSSLA   73 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTT-CC-GGGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECC------CCSSCEECCGGGG
T ss_pred             CCCHHHHHHHHHHHHHCC-CC-CcCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCC------CCCCCCCCChHHh
Confidence            489999999999999996 44 3588999889999  4999999843   48999999985      3555  6788999


Q ss_pred             cCCCCCeeecCCCCCcccccCccCCCCCCCCEEEccCCCCCCCCCcccCCCCCCCEEEeecCcCCCCCchhhcCCCCCCE
Q 045209           94 KVKNLGGIYLQDLGNISGNFPDFISGLPELKYIYIENNKLSGQIPANIGKLTQLEALSFSGNRFTGPIPSSISQLTQLTQ  173 (478)
Q Consensus        94 ~l~~L~~L~l~~~~~~~~~~~~~l~~l~~L~~L~Ls~n~~~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~  173 (478)
                      ++++|++|++++++.+.|.+|+.++++++|++|++++|++.+..+..+..+++|+++++++|.+.+.+|..+..++.|++
T Consensus        74 ~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~  153 (313)
T d1ogqa_          74 NLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVG  153 (313)
T ss_dssp             GCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCE
T ss_pred             cCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccce
Confidence            99999999998744788889999999999999999999998888888888999999999999988888888999999999


Q ss_pred             EEeecccCCCCCCccCCCCCCC-CEEEccCCCCCCCCchhhhCCCCCcEEEcccCcCccccchHHHhccccCcEEEccCc
Q 045209          174 LKLGQNFLTGAIPNGISQLKNL-TYLDLQHNQLSGAIPDIFSSLKKLLFLTLSFNKFSGNIPTSIASLAPQLQYLKLGHN  252 (478)
Q Consensus       174 L~L~~n~l~~~~~~~l~~l~~L-~~L~l~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L~L~~n  252 (478)
                      +++++|.+.+.+|..+..+..+ +.+++++|.+++..+..+..+..+ .++++.+...+.+|..+.... +++.+++++|
T Consensus       154 l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~-~l~~l~~~~~  231 (313)
T d1ogqa_         154 ITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDK-NTQKIHLAKN  231 (313)
T ss_dssp             EECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTS-CCSEEECCSS
T ss_pred             eeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccc-cccccccccc
Confidence            9999999888888888887775 788899998888888887776544 688888888877777766664 8899999999


Q ss_pred             cCCCCCCcccCCCCCCCEEeccCCcCCccchhhhcCCCCCCEEeccCCcCCCCCCc-cCcCCCCEEEccCCCC
Q 045209          253 VLSGKVPDFLGKFHSLDTLDLSWNQFSGTLPKSFSNLTKIFNLNLAYNSLTDPFPV-MNVKGIESLDLSYNQF  324 (478)
Q Consensus       253 ~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~-~~~~~L~~L~l~~n~l  324 (478)
                      .+++.++ .+..+++|+.|++++|+++|.+|..++++++|++|+|++|+++|.+|. ..+++|+.+++++|+.
T Consensus       232 ~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~  303 (313)
T d1ogqa_         232 SLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKC  303 (313)
T ss_dssp             EECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSE
T ss_pred             ccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCcc
Confidence            8886554 577888899999999999888888888899999999999988875543 3567777777887764
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure