Citrus Sinensis ID: 045226


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MSPQLLKLAGQEGVRAKLKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKKHEASSSTFRSLIQGFSSGASSIMAGISTRSKMEEISSRLEELCERRTDLGLEKIAGGSAHTAAVRQRPPTTCLTSEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKRVEDFKPKAWVCVSDDFDVLRISKAILESITLSSCDLKDLNSVQLKLKEALLKKKFFDCLG
ccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccEEEEEEEccccccHHHHHHHHHccccccccccEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEc
ccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEcccccccccccccccccccccccccEEccccHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHHHcccccccccEEEEEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEEEEc
MSPQLLKLAGQEGVRAKLKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKKHEASSSTFRSLIQGFSSGASSIMAGISTRSKMEEISSRLEELCERRTDLglekiaggsahtaavrqrppttcltsepavygrdtekARVLDMVlkndpcdaanFRVIALVGMGGIGKTTLAQEVYndkrvedfkpkawvcvsddfdVLRISKAILESItlsscdlkdLNSVQLKLKEALLKKKFFDCLG
mspqllklagqegvRAKLKKWEETLKTIEAVLidaeekqlSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKKHEASSSTFRSLIQGFSSGASSIMAGISTRSKMEEISSRLEELCERRTDLGLEkiaggsahtaavrqrppttcltsepavygrdTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKRVEDFKPKAWVCVSDDFDVLRISKAILEsitlsscdlkdLNSVQLKLKEAllkkkffdclg
MSPQLLKLAGQEGVRAKLKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKKHEASSSTFRSLIQGFssgassimagisTRSKMEEISSRLEELCERRTDLGLEKIAGGSAHTAAVRQRPPTTCLTSEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKRVEDFKPKAWVCVSDDFDVLRISKAILESITLSSCDLKDLNSVQlklkeallkkkFFDCLG
*************VRAKLKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLK************************************************************************CLTSEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKRVEDFKPKAWVCVSDDFDVLRISKAILESITLSSCDLKDLNSVQLKLKEALLKKKFFDC**
MSPQLLKLAGQEGVRAKLKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEA*********************FSSGASSIMAGISTRSKMEEISSRLEELCERRTDLGL*********************LTSEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKRVEDFKPKAWVCVSDDFDVLRISKAILES*************VQLKLKEALLKKKFFDCLG
MSPQLLKLAGQEGVRAKLKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKKHEASSSTFRSLIQGFSSGASSIMAGISTRSKMEEISSRLEELCERRTDLGLEKIAG**************TCLTSEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKRVEDFKPKAWVCVSDDFDVLRISKAILESITLSSCDLKDLNSVQLKLKEALLKKKFFDCLG
MSPQLLKLAGQEGVRAKLKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKKHEASSSTFRSLIQGFSSGASSIMAGISTRSKMEEISSRLEELCERRTDLGLEKI*******************TS*PAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKRVEDFKPKAWVCVSDDFDVLRISKAILESITLSSCDLKDLNSVQLKLKEALLKKKFFDCLG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPQLLKLAGQEGVRAKxxxxxxxxxxxxxxxxxxxxxQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKKHEASSSTFRSLIQGFSSGASSIMAGISTRSKMEEISSRLEELCERRTDLGLEKIAGGSAHTAAVRQRPPTTCLTSEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKRVEDFKPKAWVCVSDDFDVLRISKAILESITLSSCDLKDLNSVQLKLKEALLKKKFFDCLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query266 2.2.26 [Sep-21-2011]
Q9LRR4 1054 Putative disease resistan yes no 0.864 0.218 0.415 8e-40
Q7XA39 988 Putative disease resistan N/A no 0.872 0.234 0.400 3e-35
Q7XA42 979 Putative disease resistan N/A no 0.849 0.230 0.371 1e-34
Q7XA40 992 Putative disease resistan N/A no 0.864 0.231 0.380 9e-33
Q7XBQ9 970 Disease resistance protei N/A no 0.853 0.234 0.359 4e-32
Q9LRR5 1424 Putative disease resistan no no 0.951 0.177 0.329 3e-27
Q9C646 899 Probable disease resistan no no 0.879 0.260 0.269 1e-16
Q8W4J9 908 Disease resistance protei no no 0.872 0.255 0.272 1e-16
P0C8S1 906 Probable disease resistan no no 0.868 0.254 0.267 3e-16
Q9SX38 857 Putative disease resistan no no 0.744 0.231 0.287 4e-16
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  164 bits (414), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 101/243 (41%), Positives = 152/243 (62%), Gaps = 13/243 (5%)

Query: 18  LKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKK 77
           L++    L TI AVLIDAEEKQ+++  V+ W+++LRD+ Y AED LD+ A EA LRL   
Sbjct: 39  LERLSTALLTITAVLIDAEEKQITNPVVEKWVNELRDVVYHAEDALDDIATEA-LRLNIG 97

Query: 78  HEASSSTFRSLIQGFSSGASSIMAGISTR--SKMEEISSRLEELCERRTDLGLEKIAGGS 135
            E+SSS     ++G  S     + G S    +++E+++ RLE L  +R  LGL+++    
Sbjct: 98  AESSSSNRLRQLRGRMS-LGDFLDGNSEHLETRLEKVTIRLERLASQRNILGLKEL---- 152

Query: 136 AHTAAV-RQRPPTTCLTSEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGK 194
             TA + +QR PTT L  E  V+GRD +K  ++  ++  +  D     V+A+VG+GG+GK
Sbjct: 153 --TAMIPKQRLPTTSLVDESEVFGRDDDKDEIMRFLIPENGKDNG-ITVVAIVGIGGVGK 209

Query: 195 TTLAQEVYNDKRVED-FKPKAWVCVSDDFDVLRISKAILESITLSSCDLKDLNSVQLKLK 253
           TTL+Q +YND+ V   F  K W  VS++FDV +I+K + ES+T   C+  DL+ +Q+KLK
Sbjct: 210 TTLSQLLYNDQHVRSYFGTKVWAHVSEEFDVFKITKKVYESVTSRPCEFTDLDVLQVKLK 269

Query: 254 EAL 256
           E L
Sbjct: 270 ERL 272




Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q9C646|RX24L_ARATH Probable disease resistance protein RXW24L OS=Arabidopsis thaliana GN=RXW24L PE=2 SV=1 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SX38|DRL4_ARATH Putative disease resistance protein At1g50180 OS=Arabidopsis thaliana GN=At1g50180 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
224132258 880 cc-nbs-lrr resistance protein [Populus t 0.981 0.296 0.518 1e-68
147862409 1466 hypothetical protein VITISV_042289 [Viti 0.969 0.175 0.528 1e-63
359487182 2283 PREDICTED: putative disease resistance p 0.969 0.113 0.524 5e-63
225449649 1418 PREDICTED: putative disease resistance p 0.947 0.177 0.479 2e-60
359487188 1292 PREDICTED: putative disease resistance R 0.973 0.200 0.496 5e-58
359487180 1629 PREDICTED: putative disease resistance R 0.969 0.158 0.492 2e-57
147787628 1420 hypothetical protein VITISV_019639 [Viti 0.969 0.181 0.492 3e-57
359495028 1385 PREDICTED: putative disease resistance p 0.966 0.185 0.490 2e-55
296090360 1191 unnamed protein product [Vitis vinifera] 0.973 0.217 0.462 2e-55
297736335 2534 unnamed protein product [Vitis vinifera] 0.973 0.102 0.471 2e-54
>gi|224132258|ref|XP_002328224.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222837739|gb|EEE76104.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 139/268 (51%), Positives = 187/268 (69%), Gaps = 7/268 (2%)

Query: 2   SPQLLKLAGQEGVRAKLKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAED 61
           SP+ LK A +EG+  K  KW   L  ++ VL DAEEKQL+++AVK+WLDDLRDLAYD ED
Sbjct: 21  SPEFLKFARREGIWKKADKWRGMLLKVQEVLDDAEEKQLTEKAVKIWLDDLRDLAYDVED 80

Query: 62  ILDEFAAEAGLR-LLKKHEASSSTFRSLIQGFSS----GASSIMAGISTRSKMEEISSRL 116
           +LDEFA E+  R L+   EAS+S  R ++    S     AS+I      RSKM+E+SSRL
Sbjct: 81  LLDEFATESLRRELMAAEEASTSKVRRIVSTTLSFTKISASAIKFNPKMRSKMKEVSSRL 140

Query: 117 EELCERRTDLGLEKIAGGSAHTAAVRQRPPTTCLTSEPAVYGRDTEKARVLDMVLKNDPC 176
           + + ++R +LGLEK++GG   +  V Q+PP+  + +EP +YGRD +K +V+D++L  +  
Sbjct: 141 DGMAKQRIELGLEKMSGGRRTSTDVWQKPPSASVPNEPVIYGRDGDKKKVIDLLLTEEAN 200

Query: 177 DA-ANFRVIALVGMGGIGKTTLAQEVYNDKRVED-FKPKAWVCVSDDFDVLRISKAILES 234
               NF V+ +VGMGGIGKTTLAQ V+ D+ V++ F  KAW CVSDDFDV+RISKAILES
Sbjct: 201 HGDTNFHVVPIVGMGGIGKTTLAQHVFQDELVKEWFSTKAWACVSDDFDVMRISKAILES 260

Query: 235 ITLSSCDLKDLNSVQLKLKEALLKKKFF 262
           +T   CD K+ N VQ+KL+EAL  KKF 
Sbjct: 261 VTPHPCDFKEYNQVQVKLREALAGKKFL 288




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147862409|emb|CAN81911.1| hypothetical protein VITISV_042289 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487182|ref|XP_003633528.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487188|ref|XP_003633529.1| PREDICTED: putative disease resistance RPP13-like protein 1-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487180|ref|XP_002268806.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147787628|emb|CAN62744.1| hypothetical protein VITISV_019639 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495028|ref|XP_002268016.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090360|emb|CBI40179.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736335|emb|CBI24973.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.842 0.212 0.4 2.2e-36
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.894 0.167 0.324 5.2e-24
TAIR|locus:2011982 857 AT1G50180 [Arabidopsis thalian 0.744 0.231 0.278 2.6e-16
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.511 0.075 0.324 7.5e-16
TAIR|locus:2037623 899 AT1G58410 [Arabidopsis thalian 0.812 0.240 0.267 9.7e-16
TAIR|locus:2176486 908 RPP8 "RECOGNITION OF PERONOSPO 0.827 0.242 0.264 2.6e-15
TAIR|locus:2152536 908 AT5G48620 [Arabidopsis thalian 0.785 0.230 0.259 1.9e-14
TAIR|locus:2078012 852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.781 0.244 0.269 3.6e-14
TAIR|locus:2075170 835 RPP13 "RECOGNITION OF PERONOSP 0.800 0.255 0.259 1.5e-13
TAIR|locus:2037639 907 AT1G58390 "AT1G58390" [Arabido 0.819 0.240 0.258 2.2e-13
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 403 (146.9 bits), Expect = 2.2e-36, P = 2.2e-36
 Identities = 94/235 (40%), Positives = 141/235 (60%)

Query:    18 LKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKK 77
             L++    L TI AVLIDAEEKQ+++  V+ W+++LRD+ Y AED LD+ A EA LRL   
Sbjct:    39 LERLSTALLTITAVLIDAEEKQITNPVVEKWVNELRDVVYHAEDALDDIATEA-LRLNIG 97

Query:    78 HEASSST-FRSLIQGFXXXXXXXXXXXXTRSKMEEISSRLEELCERRTDLGLEKIAGGSA 136
              E+SSS   R L                  +++E+++ RLE L  +R  LGL+++     
Sbjct:    98 AESSSSNRLRQLRGRMSLGDFLDGNSEHLETRLEKVTIRLERLASQRNILGLKEL----- 152

Query:   137 HTAAV-RQRPPTTCLTSEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKT 195
              TA + +QR PTT L  E  V+GRD +K  ++  ++  +  D     V+A+VG+GG+GKT
Sbjct:   153 -TAMIPKQRLPTTSLVDESEVFGRDDDKDEIMRFLIPENGKDNG-ITVVAIVGIGGVGKT 210

Query:   196 TLAQEVYNDKRVED-FKPKAWVCVSDDFDVLRISKAILESITLSSCDLKDLNSVQ 249
             TL+Q +YND+ V   F  K W  VS++FDV +I+K + ES+T   C+  DL+ +Q
Sbjct:   211 TLSQLLYNDQHVRSYFGTKVWAHVSEEFDVFKITKKVYESVTSRPCEFTDLDVLQ 265




GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075170 RPP13 "RECOGNITION OF PERONOSPORA PARASITICA 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_scaffold_66000039
cc-nbs-lrr resistance protein (880 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
pfam00931 285 pfam00931, NB-ARC, NB-ARC domain 9e-19
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 0.004
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 83.1 bits (206), Expect = 9e-19
 Identities = 40/106 (37%), Positives = 63/106 (59%), Gaps = 7/106 (6%)

Query: 159 RDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKRVED-FKPKAWVC 217
           R+     +++ +L+       N  V+ +VGMGG+GKTTLA+++YND  V   F   AWV 
Sbjct: 1   REDMIEALIEKLLEMSD----NLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVV 56

Query: 218 VSDDFDVLRISKAILESITLSSCDL--KDLNSVQLKLKEALLKKKF 261
           VS  +   R+ K IL+ + L   D   K+ + + +K+KEALL+K+F
Sbjct: 57  VSKTYTEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLRKRF 102


Length = 285

>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 266
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.97
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.79
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.42
PRK00411 394 cdc6 cell division control protein 6; Reviewed 99.01
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.98
cd01128 249 rho_factor Transcription termination factor rho is 98.91
PRK09376 416 rho transcription termination factor Rho; Provisio 98.81
PTZ00202 550 tuzin; Provisional 98.76
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.68
TIGR00767 415 rho transcription termination factor Rho. Members 98.64
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.54
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.52
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.51
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.4
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 98.36
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.33
PRK08118167 topology modulation protein; Reviewed 98.23
PF05729166 NACHT: NACHT domain 98.22
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.21
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 98.17
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.13
PRK07261171 topology modulation protein; Provisional 98.0
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.99
KOG2227 529 consensus Pre-initiation complex, subunit CDC6, AA 97.96
PF05621 302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.96
PRK04841 903 transcriptional regulator MalT; Provisional 97.95
PRK13342 413 recombination factor protein RarA; Reviewed 97.92
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.91
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.9
KOG2028 554 consensus ATPase related to the helicase subunit o 97.81
PRK04195 482 replication factor C large subunit; Provisional 97.78
smart00382148 AAA ATPases associated with a variety of cellular 97.76
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.72
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.62
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 97.62
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.61
CHL00095 821 clpC Clp protease ATP binding subunit 97.6
PRK12608 380 transcription termination factor Rho; Provisional 97.59
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.58
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.56
TIGR02237 209 recomb_radB DNA repair and recombination protein R 97.53
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.49
PRK06696 223 uridine kinase; Validated 97.49
PF13173128 AAA_14: AAA domain 97.47
cd01393 226 recA_like RecA is a bacterial enzyme which has rol 97.41
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.41
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 97.41
PRK05541176 adenylylsulfate kinase; Provisional 97.41
PRK13341 725 recombination factor protein RarA/unknown domain f 97.41
PF00448 196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.34
cd02025 220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.34
PRK05564 313 DNA polymerase III subunit delta'; Validated 97.31
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 97.28
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 97.27
PLN03025 319 replication factor C subunit; Provisional 97.27
TIGR00959 428 ffh signal recognition particle protein. This mode 97.26
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.26
PRK10867 433 signal recognition particle protein; Provisional 97.26
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.25
COG0572 218 Udk Uridine kinase [Nucleotide transport and metab 97.24
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 97.24
cd01394 218 radB RadB. The archaeal protein radB shares simila 97.23
PRK07667193 uridine kinase; Provisional 97.23
PRK09270 229 nucleoside triphosphate hydrolase domain-containin 97.22
PRK15455 644 PrkA family serine protein kinase; Provisional 97.22
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 97.22
PF00485 194 PRK: Phosphoribulokinase / Uridine kinase family; 97.21
PRK04301 317 radA DNA repair and recombination protein RadA; Va 97.21
PRK05480 209 uridine/cytidine kinase; Provisional 97.2
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.19
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 97.19
TIGR00235 207 udk uridine kinase. Model contains a number of lon 97.17
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 97.16
cd03115173 SRP The signal recognition particle (SRP) mediates 97.15
PTZ00301 210 uridine kinase; Provisional 97.13
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.12
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 97.12
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.11
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.1
PHA02544 316 44 clamp loader, small subunit; Provisional 97.1
PRK08233182 hypothetical protein; Provisional 97.1
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 97.09
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 97.08
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.08
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.08
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.07
PRK12402 337 replication factor C small subunit 2; Reviewed 97.07
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.07
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.07
cd00983 325 recA RecA is a bacterial enzyme which has roles in 97.06
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 97.06
PTZ00088 229 adenylate kinase 1; Provisional 97.04
cd01133 274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 97.03
PRK05439 311 pantothenate kinase; Provisional 97.0
PRK00440 319 rfc replication factor C small subunit; Reviewed 96.99
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.99
PLN03186 342 DNA repair protein RAD51 homolog; Provisional 96.98
PRK09354 349 recA recombinase A; Provisional 96.98
PRK06547172 hypothetical protein; Provisional 96.98
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 96.96
PRK10865 857 protein disaggregation chaperone; Provisional 96.95
KOG1532 366 consensus GTPase XAB1, interacts with DNA repair p 96.95
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.94
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.94
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 96.94
TIGR02236 310 recomb_radA DNA repair and recombination protein R 96.94
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 96.94
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.94
PRK05642 234 DNA replication initiation factor; Validated 96.92
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.92
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 96.91
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.91
PRK08084 235 DNA replication initiation factor; Provisional 96.91
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 96.9
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 96.9
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.88
PRK08116268 hypothetical protein; Validated 96.88
PRK06762166 hypothetical protein; Provisional 96.88
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.87
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 96.86
COG1428 216 Deoxynucleoside kinases [Nucleotide transport and 96.85
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 96.85
cd02023 198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.84
COG0468 279 RecA RecA/RadA recombinase [DNA replication, recom 96.84
TIGR02239 316 recomb_RAD51 DNA repair protein RAD51. This eukary 96.84
PF08423 256 Rad51: Rad51; InterPro: IPR013632 This domain is f 96.83
PRK12377248 putative replication protein; Provisional 96.83
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.82
COG1102 179 Cmk Cytidylate kinase [Nucleotide transport and me 96.82
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 96.81
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 96.81
PRK06217183 hypothetical protein; Validated 96.81
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 96.8
PHA00729 226 NTP-binding motif containing protein 96.8
TIGR02238 313 recomb_DMC1 meiotic recombinase Dmc1. This model d 96.8
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 96.8
PRK06893 229 DNA replication initiation factor; Validated 96.8
PTZ00035 337 Rad51 protein; Provisional 96.8
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 96.76
COG0194 191 Gmk Guanylate kinase [Nucleotide transport and met 96.75
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.74
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 96.73
PLN03187 344 meiotic recombination protein DMC1 homolog; Provis 96.73
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.73
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 96.73
PRK14527191 adenylate kinase; Provisional 96.72
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.69
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.68
PRK03839180 putative kinase; Provisional 96.68
PF00004132 AAA: ATPase family associated with various cellula 96.68
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 96.66
PRK03992 389 proteasome-activating nucleotidase; Provisional 96.66
PRK04040 188 adenylate kinase; Provisional 96.66
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 96.65
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 96.65
cd02024 187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 96.63
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 96.61
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 96.61
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 96.59
TIGR00064 272 ftsY signal recognition particle-docking protein F 96.59
PRK00889175 adenylylsulfate kinase; Provisional 96.58
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 96.57
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.56
PRK00300 205 gmk guanylate kinase; Provisional 96.56
PRK14738 206 gmk guanylate kinase; Provisional 96.54
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.54
PRK14974 336 cell division protein FtsY; Provisional 96.53
PRK06067 234 flagellar accessory protein FlaH; Validated 96.52
PRK08727 233 hypothetical protein; Validated 96.52
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 96.51
PRK14088 440 dnaA chromosomal replication initiation protein; P 96.5
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.49
PRK03846198 adenylylsulfate kinase; Provisional 96.48
PRK00131175 aroK shikimate kinase; Reviewed 96.48
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.47
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.47
cd01428 194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.47
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 96.46
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 96.44
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 96.44
COG3640 255 CooC CO dehydrogenase maturation factor [Cell divi 96.44
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.43
PRK00625173 shikimate kinase; Provisional 96.43
PF00154 322 RecA: recA bacterial DNA recombination protein; In 96.43
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 96.43
CHL00181 287 cbbX CbbX; Provisional 96.42
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 96.42
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 96.4
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 96.4
PRK10536 262 hypothetical protein; Provisional 96.38
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 96.37
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 96.37
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.37
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.37
KOG1969 877 consensus DNA replication checkpoint protein CHL12 96.36
PRK07952244 DNA replication protein DnaC; Validated 96.36
PRK13531 498 regulatory ATPase RavA; Provisional 96.36
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.35
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 96.33
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.32
PRK13975 196 thymidylate kinase; Provisional 96.31
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 96.3
PRK13765 637 ATP-dependent protease Lon; Provisional 96.3
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 96.3
KOG0727 408 consensus 26S proteasome regulatory complex, ATPas 96.3
TIGR00041 195 DTMP_kinase thymidylate kinase. Function: phosphor 96.29
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 96.28
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 96.28
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.27
PRK15453 290 phosphoribulokinase; Provisional 96.27
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 96.27
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.25
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.25
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.25
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 96.23
PRK00279 215 adk adenylate kinase; Reviewed 96.23
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 96.23
PRK13949169 shikimate kinase; Provisional 96.22
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 96.22
PF00005137 ABC_tran: ABC transporter This structure is on hol 96.21
PRK13947171 shikimate kinase; Provisional 96.2
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.2
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.19
PRK14737186 gmk guanylate kinase; Provisional 96.19
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 96.18
PRK04296 190 thymidine kinase; Provisional 96.17
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.17
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.17
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 96.17
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.16
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.16
COG1100 219 GTPase SAR1 and related small G proteins [General 96.15
PRK12678 672 transcription termination factor Rho; Provisional 96.15
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 96.14
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 96.14
PRK09519 790 recA DNA recombination protein RecA; Reviewed 96.13
PRK14528186 adenylate kinase; Provisional 96.12
PRK10865 857 protein disaggregation chaperone; Provisional 96.12
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 96.12
TIGR01351 210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 96.12
PF14516 331 AAA_35: AAA-like domain 96.1
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.1
PRK14530 215 adenylate kinase; Provisional 96.09
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.08
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 96.08
TIGR03881 229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 96.07
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 96.07
PRK13695174 putative NTPase; Provisional 96.07
PRK06620214 hypothetical protein; Validated 96.06
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 96.05
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 96.05
COG4240 300 Predicted kinase [General function prediction only 96.04
PRK04328 249 hypothetical protein; Provisional 96.04
PRK12339 197 2-phosphoglycerate kinase; Provisional 96.04
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.04
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 96.04
PRK05057172 aroK shikimate kinase I; Reviewed 96.03
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 96.03
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 96.03
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.02
cd02029 277 PRK_like Phosphoribulokinase-like (PRK-like) is a 96.02
PLN02318 656 phosphoribulokinase/uridine kinase 96.02
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.01
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.0
PRK08533 230 flagellar accessory protein FlaH; Reviewed 96.0
cd01672 200 TMPK Thymidine monophosphate kinase (TMPK), also k 95.99
PLN02348 395 phosphoribulokinase 95.99
PRK08181269 transposase; Validated 95.99
CHL00176 638 ftsH cell division protein; Validated 95.99
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 95.98
PRK08939306 primosomal protein DnaI; Reviewed 95.97
PF07726131 AAA_3: ATPase family associated with various cellu 95.97
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 95.96
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 95.96
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.96
PLN02796 347 D-glycerate 3-kinase 95.96
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 95.96
PRK09825176 idnK D-gluconate kinase; Provisional 95.95
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 95.94
PRK14529 223 adenylate kinase; Provisional 95.93
PRK00149 450 dnaA chromosomal replication initiation protein; R 95.93
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.92
PRK08356 195 hypothetical protein; Provisional 95.92
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.92
TIGR00017 217 cmk cytidylate kinase. This family consists of cyt 95.91
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 95.91
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 95.91
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 95.91
PRK09087226 hypothetical protein; Validated 95.91
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 95.91
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 95.9
TIGR01287 275 nifH nitrogenase iron protein. This model describe 95.9
PLN02200 234 adenylate kinase family protein 95.9
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 95.9
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 95.9
PRK10416 318 signal recognition particle-docking protein FtsY; 95.9
cd01122 271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.89
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 95.88
cd03116159 MobB Molybdenum is an essential trace element in t 95.88
PRK04182180 cytidylate kinase; Provisional 95.87
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 95.86
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 95.86
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.85
PRK14493 274 putative bifunctional molybdopterin-guanine dinucl 95.85
PF00006 215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 95.85
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 95.84
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 95.84
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 95.84
PRK08149 428 ATP synthase SpaL; Validated 95.84
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 95.84
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 95.83
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 95.83
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 95.83
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 95.82
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 95.82
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 95.82
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.81
PRK13230 279 nitrogenase reductase-like protein; Reviewed 95.8
PRK14526 211 adenylate kinase; Provisional 95.79
PRK06761 282 hypothetical protein; Provisional 95.79
PRK09112 351 DNA polymerase III subunit delta'; Validated 95.78
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 95.78
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 95.77
cd03297 214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 95.77
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 95.76
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.76
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 95.76
PRK13768 253 GTPase; Provisional 95.76
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 95.76
PRK13232 273 nifH nitrogenase reductase; Reviewed 95.75
cd01135 276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 95.74
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 95.74
PRK06835329 DNA replication protein DnaC; Validated 95.74
PRK06936 439 type III secretion system ATPase; Provisional 95.74
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 95.73
PRK13946184 shikimate kinase; Provisional 95.73
COG0237 201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 95.73
PRK07594 433 type III secretion system ATPase SsaN; Validated 95.73
PRK05922 434 type III secretion system ATPase; Validated 95.73
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 95.72
PLN02165 334 adenylate isopentenyltransferase 95.72
PLN02924 220 thymidylate kinase 95.71
PRK00023 225 cmk cytidylate kinase; Provisional 95.71
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 95.71
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 95.7
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 95.7
TIGR00231161 small_GTP small GTP-binding protein domain. This m 95.7
PTZ00185 574 ATPase alpha subunit; Provisional 95.7
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 95.69
cd03269210 ABC_putative_ATPase This subfamily is involved in 95.69
PRK00698 205 tmk thymidylate kinase; Validated 95.69
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 95.69
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 95.69
PRK07940 394 DNA polymerase III subunit delta'; Validated 95.68
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 95.68
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 95.68
cd03114148 ArgK-like The function of this protein family is u 95.68
cd02040 270 NifH NifH gene encodes component II (iron protein) 95.67
cd01125 239 repA Hexameric Replicative Helicase RepA. RepA is 95.67
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 95.67
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 95.67
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 95.66
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 95.66
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 95.66
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 95.66
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is 95.65
COG3899 849 Predicted ATPase [General function prediction only 95.65
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involve 95.64
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 95.64
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 95.63
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 95.63
PRK13948182 shikimate kinase; Provisional 95.63
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.63
PRK09280 463 F0F1 ATP synthase subunit beta; Validated 95.63
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 95.63
cd02117 212 NifH_like This family contains the NifH (iron prot 95.62
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 95.62
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 95.62
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 95.62
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 95.62
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 95.62
TIGR03878 259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.61
cd00876160 Ras Ras family. The Ras family of the Ras superfam 95.61
PRK08099399 bifunctional DNA-binding transcriptional repressor 95.61
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 95.6
cd00154159 Rab Rab family. Rab GTPases form the largest famil 95.6
PF03029 238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.59
cd01132 274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 95.59
PRK09099 441 type III secretion system ATPase; Provisional 95.58
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 95.58
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 95.58
PRK09435 332 membrane ATPase/protein kinase; Provisional 95.58
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 95.58
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.58
TIGR03574 249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.57
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 95.57
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 95.56
PRK01184184 hypothetical protein; Provisional 95.56
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 95.56
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 95.56
PRK03731171 aroL shikimate kinase II; Reviewed 95.55
PRK10463 290 hydrogenase nickel incorporation protein HypB; Pro 95.55
PRK09183259 transposase/IS protein; Provisional 95.55
cd00984 242 DnaB_C DnaB helicase C terminal domain. The hexame 95.54
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 95.54
PLN03046 460 D-glycerate 3-kinase; Provisional 95.54
PRK13236 296 nitrogenase reductase; Reviewed 95.54
PRK13233 275 nifH nitrogenase reductase; Reviewed 95.53
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.53
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 95.53
COG4987 573 CydC ABC-type transport system involved in cytochr 95.52
COG3903 414 Predicted ATPase [General function prediction only 95.52
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 95.52
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 95.52
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 95.52
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 95.52
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 95.52
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 95.51
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 95.51
CHL00095 821 clpC Clp protease ATP binding subunit 95.51
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 95.51
cd01878204 HflX HflX subfamily. A distinct conserved domain w 95.51
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 95.49
cd04123162 Rab21 Rab21 subfamily. The localization and functi 95.49
COG0714 329 MoxR-like ATPases [General function prediction onl 95.49
KOG2859 293 consensus DNA repair protein, member of the recA/R 95.49
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 95.49
PRK13235 274 nifH nitrogenase reductase; Reviewed 95.49
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 95.48
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 95.48
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 95.48
PRK12422 445 chromosomal replication initiation protein; Provis 95.48
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 95.46
KOG3308 225 consensus Uncharacterized protein of the uridine k 95.46
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 95.46
PRK11823 446 DNA repair protein RadA; Provisional 95.45
cd04171164 SelB SelB subfamily. SelB is an elongation factor 95.44
PF06564 243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 95.44
cd01673 193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 95.44
PRK06526254 transposase; Provisional 95.43
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 95.42
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 95.42
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 95.42
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 95.41
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.41
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 95.4
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 95.4
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.4
PF1324576 AAA_19: Part of AAA domain 95.39
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 95.39
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 95.39
PRK10908 222 cell division protein FtsE; Provisional 95.38
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 95.38
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 95.38
PF07693 325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 95.37
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 95.36
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 95.36
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 95.36
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 95.36
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 95.36
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 95.35
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 95.35
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 95.35
PRK13231 264 nitrogenase reductase-like protein; Reviewed 95.35
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 95.35
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 95.34
cd03246173 ABCC_Protease_Secretion This family represents the 95.34
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 95.34
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 95.33
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 95.33
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 95.33
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 95.33
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 95.32
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 95.32
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 95.32
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.32
PRK14532 188 adenylate kinase; Provisional 95.32
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 95.32
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 95.31
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.31
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 95.31
PHA02530 300 pseT polynucleotide kinase; Provisional 95.29
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 95.28
PF02374 305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 95.28
PRK07471 365 DNA polymerase III subunit delta'; Validated 95.28
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 95.28
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 95.28
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 95.26
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 95.26
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.26
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 95.25
TIGR00101 199 ureG urease accessory protein UreG. This model rep 95.25
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 95.24
PRK14245 250 phosphate ABC transporter ATP-binding protein; Pro 95.24
PRK07429 327 phosphoribulokinase; Provisional 95.24
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 95.24
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 95.24
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 95.24
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 95.23
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.23
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.97  E-value=6.3e-30  Score=242.61  Aligned_cols=249  Identities=25%  Similarity=0.322  Sum_probs=186.5

Q ss_pred             HHHHHHhhhChHHHHHHHHHHHHHHHHHHHHHHhcccCcHHHHHHHHHHHHHhhhHHhHHHHHHHHHHHHHHhhccCCcc
Q 045226            4 QLLKLAGQEGVRAKLKKWEETLKTIEAVLIDAEEKQLSDRAVKLWLDDLRDLAYDAEDILDEFAAEAGLRLLKKHEASSS   83 (266)
Q Consensus         4 ~~~e~~~~~~v~~~~~~L~~~L~~i~~~l~~ae~~~~~~~~~~~Wl~~lr~~aydaeD~lD~~~~~~~~~~~~~~~~~~~   83 (266)
                      +-+++..+.+.++.+..|+++|..++.++++++.++.....+..|.+.+++++|++||+++.|.......+....-...+
T Consensus        16 l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~~l~~~~   95 (889)
T KOG4658|consen   16 LNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKANDLLSTRS   95 (889)
T ss_pred             HHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhhH
Confidence            34577888899999999999999999999999999999999999999999999999999999998876554222111111


Q ss_pred             cccccccccCCCCccchhcchhHHHHHHHHHHHHHHHHhhhhcCcccccCCCcccccccCCCCCCCCCCCCccccchhhH
Q 045226           84 TFRSLIQGFSSGASSIMAGISTRSKMEEISSRLEELCERRTDLGLEKIAGGSAHTAAVRQRPPTTCLTSEPAVYGRDTEK  163 (266)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~i~~i~~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vGr~~~~  163 (266)
                      ...+..|.       ..+.+..+..+..+..++..+.+....++..................++.+..+... ||.+..+
T Consensus        96 ~~~~~~c~-------~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~-VG~e~~~  167 (889)
T KOG4658|consen   96 VERQRLCL-------CGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESD-VGLETML  167 (889)
T ss_pred             HHHHHHhh-------hhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCcccc-ccHHHHH
Confidence            12222221       123445555556666666666666655543321111110000111122333333444 9999999


Q ss_pred             HHHHHHHhcCCCCCCCCcEEEEEEecCCCcHHHHHHHHHcccc-ccC-CCceEEEEecCCCCHHHHHHHHHHHhcCCCCC
Q 045226          164 ARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKR-VED-FKPKAWVCVSDDFDVLRISKAILESITLSSCD  241 (266)
Q Consensus       164 ~~l~~~L~~~~~~~~~~~~vi~IvG~gGvGKTtLA~~v~~~~~-~~~-F~~~~wv~vs~~~~~~~i~~~il~~l~~~~~~  241 (266)
                      ++++++|+.++      ..++||+||||+||||||+.+||+.. ++. ||.++||+||+.|+...++.+|+..++.....
T Consensus       168 ~kl~~~L~~d~------~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~  241 (889)
T KOG4658|consen  168 EKLWNRLMEDD------VGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEE  241 (889)
T ss_pred             HHHHHHhccCC------CCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcc
Confidence            99999999876      38999999999999999999999998 889 99999999999999999999999999875442


Q ss_pred             --CCChHHHHHHHHHHcCCceEEEEeC
Q 045226          242 --LKDLNSVQLKLKEALLKKKFFDCLG  266 (266)
Q Consensus       242 --~~~~~~~~~~l~~~L~~kr~LiVLD  266 (266)
                        ..+.++++..|.++|.+||||||||
T Consensus       242 ~~~~~~~~~~~~i~~~L~~krfllvLD  268 (889)
T KOG4658|consen  242 WEDKEEDELASKLLNLLEGKRFLLVLD  268 (889)
T ss_pred             cchhhHHHHHHHHHHHhccCceEEEEe
Confidence              2334789999999999999999998



>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>KOG2859 consensus DNA repair protein, member of the recA/RAD51 family [Replication, recombination and repair] Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 2e-39
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-34
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-21
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 6e-11
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  143 bits (362), Expect = 2e-39
 Identities = 34/238 (14%), Positives = 74/238 (31%), Gaps = 28/238 (11%)

Query: 45  VKLWLDDLRDLAYDAEDILDEFAAEAGLR-----LLKKHEASSSTFRSLIQGFSSGASS- 98
           ++      +D+      I+D   ++  L       ++           LI+      +  
Sbjct: 10  LQHREALEKDI--KTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMILKKDNDS 67

Query: 99  --IMAGISTRSKMEEISSRLEELCERRTDLGLEKIAGGSAHTAAVRQRPPTTCLTSEPAV 156
                        +++++ L +     +    +    G   T+ VR       +   P V
Sbjct: 68  YVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGI--TSYVRTVLCEGGVPQRPVV 125

Query: 157 Y-GRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKR-VEDFKP-- 212
           +  R      +   + K           + + GM G GK+ LA E   D   +E   P  
Sbjct: 126 FVTRKKLVNAIQQKLSKLKG----EPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPGG 181

Query: 213 KAWVCVSDDFDVLRISK------AILESITLSSCDLKDLNSVQLKLKEALLKK--KFF 262
             WV V        + K       + +  + S     ++   + +L+  +L+K  +  
Sbjct: 182 VHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSL 239


>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.84
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.71
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.67
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.66
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 99.56
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 99.06
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.92
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.89
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.87
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.86
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.81
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 98.64
2fna_A 357 Conserved hypothetical protein; structural genomic 98.59
2chg_A 226 Replication factor C small subunit; DNA-binding pr 98.31
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 98.23
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.05
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.03
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.94
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.7
2cvh_A 220 DNA repair and recombination protein RADB; filamen 97.69
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.67
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 97.61
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.59
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.46
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.45
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.44
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.43
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.42
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.38
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.36
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 97.35
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.32
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.32
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.31
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 97.29
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.25
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.23
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.22
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.21
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 97.21
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.2
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 97.2
3bos_A 242 Putative DNA replication factor; P-loop containing 97.18
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 97.17
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.14
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.13
2xxa_A 433 Signal recognition particle protein; protein trans 97.11
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.11
3co5_A143 Putative two-component system transcriptional RES 97.08
1xp8_A 366 RECA protein, recombinase A; recombination, radior 97.08
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 97.05
3pvs_A 447 Replication-associated recombination protein A; ma 97.04
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.03
2z43_A 324 DNA repair and recombination protein RADA; archaea 97.03
1u94_A 356 RECA protein, recombinase A; homologous recombinat 97.01
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.99
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 96.97
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.97
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 96.97
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.96
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.96
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.95
3io5_A 333 Recombination and repair protein; storage dimer, i 96.94
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.93
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.93
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.91
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.89
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 96.86
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.85
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.85
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 96.82
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.82
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.82
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 96.81
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.81
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 96.79
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.77
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.77
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 96.76
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.75
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 96.75
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 96.73
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.73
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.72
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.71
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.71
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.7
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 96.69
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.68
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 96.67
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 96.67
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 96.66
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.66
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 96.65
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.64
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.64
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 96.64
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 96.63
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 96.62
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.62
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 96.61
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.61
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.61
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 96.6
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 96.59
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 96.58
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 96.57
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.57
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 96.56
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 96.55
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 96.55
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.54
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.54
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.54
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.53
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 96.53
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 96.53
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.52
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 96.51
2r44_A 331 Uncharacterized protein; putative ATPase, structur 96.5
2hf9_A 226 Probable hydrogenase nickel incorporation protein 96.49
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 96.48
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.48
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.47
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 96.47
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.47
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 96.46
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.46
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.44
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.43
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.43
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.42
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 96.42
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 96.42
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.42
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 96.4
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.4
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 96.4
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.39
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.39
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 96.38
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.38
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.37
3ice_A 422 Transcription termination factor RHO; transcriptio 96.35
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.34
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.34
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.34
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.33
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.31
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.31
3fwy_A 314 Light-independent protochlorophyllide reductase I 96.3
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.3
2og2_A 359 Putative signal recognition particle receptor; nuc 96.29
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.29
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.28
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.28
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.28
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.27
1via_A175 Shikimate kinase; structural genomics, transferase 96.26
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 96.26
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 96.26
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.24
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 96.24
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 96.22
4a74_A 231 DNA repair and recombination protein RADA; hydrola 96.21
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.2
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 96.19
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.19
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.19
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.18
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 96.17
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 96.16
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.15
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 96.15
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 96.15
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 96.15
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 96.14
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.14
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.14
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.12
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.12
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.12
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.11
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 96.11
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.1
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.09
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 96.09
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 96.09
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.07
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 96.06
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 96.06
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.05
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 96.05
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 96.05
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 96.05
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 96.04
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.04
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.03
1b0u_A 262 Histidine permease; ABC transporter, transport pro 96.02
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.01
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 95.99
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 95.98
1ji0_A 240 ABC transporter; ATP binding protein, structural g 95.98
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 95.98
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 95.97
2ged_A193 SR-beta, signal recognition particle receptor beta 95.96
1g6h_A 257 High-affinity branched-chain amino acid transport 95.96
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 95.93
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.93
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 95.93
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.93
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.93
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 95.93
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 95.92
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 95.92
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 95.91
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.91
3end_A 307 Light-independent protochlorophyllide reductase ir 95.9
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 95.9
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 95.89
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 95.89
1sgw_A214 Putative ABC transporter; structural genomics, P p 95.89
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 95.89
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 95.89
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 95.87
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.87
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 95.86
2ghi_A 260 Transport protein; multidrug resistance protein, M 95.86
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 95.85
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 95.85
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 95.83
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.82
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 95.81
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 95.81
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 95.81
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 95.8
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.8
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.8
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 95.78
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 95.78
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 95.78
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 95.77
2wji_A165 Ferrous iron transport protein B homolog; membrane 95.77
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.77
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 95.75
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 95.75
2f9l_A 199 RAB11B, member RAS oncogene family; RAB11B GTPase, 95.72
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 95.72
2eyu_A 261 Twitching motility protein PILT; pilus retraction 95.71
2qgz_A308 Helicase loader, putative primosome component; str 95.7
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 95.7
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.69
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 95.68
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 95.67
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 95.67
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 95.67
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 95.64
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 95.59
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 95.59
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 95.58
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 95.57
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.57
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 95.57
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 95.56
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 95.54
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 95.53
1tue_A212 Replication protein E1; helicase, replication, E1E 95.52
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.52
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 95.52
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.51
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 95.49
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.48
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 95.46
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 95.46
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 95.45
2r6a_A 454 DNAB helicase, replicative helicase; replication, 95.43
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 95.43
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.41
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 95.41
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.4
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 95.37
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.34
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 95.33
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.33
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 95.32
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 95.32
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.32
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.32
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 95.31
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.31
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.3
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.3
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 95.29
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 95.28
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 95.28
3kta_A182 Chromosome segregation protein SMC; structural mai 95.28
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 95.28
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 95.27
1cp2_A 269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 95.25
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 95.25
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.24
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 95.24
3t1o_A198 Gliding protein MGLA; G domain containing protein, 95.23
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 95.23
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 95.22
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 95.21
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 95.2
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 95.2
2afh_E 289 Nitrogenase iron protein 1; nitrogen fixation, iro 95.19
2cxx_A 190 Probable GTP-binding protein ENGB; structural geno 95.19
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.19
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 95.19
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 95.19
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.18
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.18
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 95.15
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 95.15
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 95.14
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 95.14
4tmk_A 213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.14
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 95.13
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 95.13
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.13
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 95.12
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 95.12
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.1
3hjn_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.1
3llu_A196 RAS-related GTP-binding protein C; structural geno 95.09
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.09
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 95.08
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 95.08
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.07
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 95.06
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 95.06
1nrj_B 218 SR-beta, signal recognition particle receptor beta 95.05
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 95.05
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 95.04
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 95.04
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 95.03
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 95.03
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 95.03
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.02
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.02
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 95.01
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 95.0
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 95.0
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 94.98
1p9r_A 418 General secretion pathway protein E; bacterial typ 94.97
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 94.96
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 94.96
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 94.96
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.96
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 94.96
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 94.95
3ld9_A 223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.93
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 94.93
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 94.93
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 94.93
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 94.92
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 94.91
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 94.91
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 94.9
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.9
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 94.89
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.89
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 94.88
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 94.88
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 94.88
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.88
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 94.87
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 94.87
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 94.87
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 94.86
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 94.86
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 94.86
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 94.83
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 94.83
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 94.83
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 94.83
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 94.82
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 94.82
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 94.82
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 94.81
2ewv_A 372 Twitching motility protein PILT; pilus retraction 94.81
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 94.81
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 94.8
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 94.79
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.77
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 94.77
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 94.77
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 94.76
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 94.75
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 94.75
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 94.75
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 94.71
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 94.71
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 94.71
2fh5_B 214 SR-beta, signal recognition particle receptor beta 94.7
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 94.7
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 94.69
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 94.69
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 94.67
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 94.66
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 94.66
2cjw_A 192 GTP-binding protein GEM; nucleotide-binding, small 94.66
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 94.65
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 94.65
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 94.65
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.65
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 94.64
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 94.61
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 94.59
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.58
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 94.57
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 94.55
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 94.55
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 94.55
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 94.55
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 94.54
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 94.54
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 94.52
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 94.52
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.52
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 94.52
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 94.48
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 94.48
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 94.47
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 94.47
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 94.45
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 94.43
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 94.42
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 94.42
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 94.42
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 94.41
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 94.37
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.36
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 94.35
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 94.34
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 94.34
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 94.33
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 94.3
3ea0_A 245 ATPase, para family; alpha-beta-alpha sandwich, st 94.3
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 94.29
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 94.28
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.24
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 94.23
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 94.22
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 94.21
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 94.21
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 94.21
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 94.2
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 94.19
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 94.18
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 94.18
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 94.15
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 94.15
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 94.13
4dkx_A 216 RAS-related protein RAB-6A; GTP binding fold, memb 94.12
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 94.1
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 94.09
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 94.09
3ch4_B 202 Pmkase, phosphomevalonate kinase; parallel beta-sh 94.08
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 94.08
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 94.08
3k9g_A 267 PF-32 protein; ssgcid, SBRI, decode biostructures, 94.07
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 94.05
4dzz_A 206 Plasmid partitioning protein PARF; deviant walker 94.03
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 93.99
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 93.98
3kjh_A 254 CO dehydrogenase/acetyl-COA synthase complex, acce 93.95
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 93.95
3fdi_A 201 Uncharacterized protein; cytidylate kinase like pr 93.93
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 93.93
3fkq_A 373 NTRC-like two-domain protein; RER070207001320, str 93.9
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 93.89
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 93.87
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 93.86
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 93.84
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 93.83
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 93.83
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 93.82
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 93.79
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.74
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 93.72
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 93.67
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 93.6
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 93.58
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 93.55
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 93.52
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 93.51
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 93.5
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 93.49
3cwq_A 209 Para family chromosome partitioning protein; alpha 93.45
3q9l_A 260 Septum site-determining protein MIND; ATPase, bact 93.44
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 93.4
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 93.39
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 93.38
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.32
4hlc_A 205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 93.32
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.31
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.84  E-value=1.1e-20  Score=173.29  Aligned_cols=107  Identities=16%  Similarity=0.200  Sum_probs=92.7

Q ss_pred             ccchhhHHHHHHHHhcCCCCCCCCcEEEEEEecCCCcHHHHHHHHHc--cccccC-CCceEEEEecCCC--CHHHHHHHH
Q 045226          157 YGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYN--DKRVED-FKPKAWVCVSDDF--DVLRISKAI  231 (266)
Q Consensus       157 vGr~~~~~~l~~~L~~~~~~~~~~~~vi~IvG~gGvGKTtLA~~v~~--~~~~~~-F~~~~wv~vs~~~--~~~~i~~~i  231 (266)
                      +||+.++++|.++|....   ....++|+||||||+||||||+.+|+  +.+++. |++++||++++.+  +...+++.|
T Consensus       131 ~GR~~~~~~l~~~L~~~~---~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~i  207 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMC---DLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDI  207 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHT---TSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhccc---CCCceEEEEEcCCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHH
Confidence            699999999999997642   23579999999999999999999998  677888 9999999999985  899999999


Q ss_pred             HHHhcCCCC-------CCCChHHHHHHHHHHcCCc-eEEEEeC
Q 045226          232 LESITLSSC-------DLKDLNSVQLKLKEALLKK-KFFDCLG  266 (266)
Q Consensus       232 l~~l~~~~~-------~~~~~~~~~~~l~~~L~~k-r~LiVLD  266 (266)
                      +.+++....       +..+.+.++..|++.|.+| |||||||
T Consensus       208 l~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~~kr~LlVLD  250 (549)
T 2a5y_B          208 LLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFD  250 (549)
T ss_dssp             HHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEE
T ss_pred             HHHHhcCcccccccccccccHHHHHHHHHHHHcCCCcEEEEEE
Confidence            999986521       2335677899999999996 9999998



>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 266
d2a5yb3 277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-18
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 81.0 bits (199), Expect = 1e-18
 Identities = 16/138 (11%), Positives = 41/138 (29%), Gaps = 16/138 (11%)

Query: 141 VRQRPPTTCLTSEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQE 200
           + ++     +  +   Y R+    RV+  + +    D+     + L G  G GK+ +A +
Sbjct: 7   LDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDS---FFLFLHGRAGSGKSVIASQ 63

Query: 201 VYNDKRVE---DFKPKAWVCVSDDFDVLRISKAILESITLSSCD----------LKDLNS 247
             +        ++    W+  S               + L S D          +  +  
Sbjct: 64  ALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVL 123

Query: 248 VQLKLKEALLKKKFFDCL 265
            ++     + +       
Sbjct: 124 KRMICNALIDRPNTLFVF 141


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.84
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.7
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 98.5
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.4
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 98.04
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.99
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 97.98
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 97.95
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 97.95
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.92
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.9
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 97.8
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 97.77
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 97.7
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 97.54
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.54
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.52
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.51
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.48
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.47
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.39
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.39
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.38
d2qy9a2 211 GTPase domain of the signal recognition particle r 97.29
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.26
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 97.24
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.22
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.21
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.2
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.2
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 97.19
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 97.18
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.17
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.17
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.14
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.14
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.14
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.14
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.13
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.12
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.1
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.09
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.05
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.04
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.02
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.0
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 97.0
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.98
d1okkd2 207 GTPase domain of the signal recognition particle r 96.98
d1j8yf2 211 GTPase domain of the signal sequence recognition p 96.87
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.87
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.85
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.82
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 96.81
d1ls1a2 207 GTPase domain of the signal sequence recognition p 96.76
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.74
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.73
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.71
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.69
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.67
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 96.67
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.65
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 96.62
d1vmaa2 213 GTPase domain of the signal recognition particle r 96.6
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 96.6
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.58
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.49
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.47
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.47
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.44
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.4
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.38
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.36
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.25
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.25
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.23
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 96.23
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.23
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.22
d1g2912 240 Maltose transport protein MalK, N-terminal domain 96.22
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 96.22
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.19
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.19
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 96.19
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.17
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 96.15
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.15
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 96.14
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.14
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 96.13
d2awna2 232 Maltose transport protein MalK, N-terminal domain 96.13
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.13
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 96.13
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 96.08
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.07
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 96.07
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 96.06
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.05
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.05
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 96.05
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 96.04
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 96.04
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.03
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 95.99
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.98
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 95.95
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.94
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.94
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.9
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.87
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.84
d1xpua3 289 Transcription termination factor Rho, ATPase domai 95.84
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 95.75
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.74
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 95.74
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.71
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.69
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 95.67
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.67
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.67
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.66
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.63
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.62
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.61
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 95.6
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.6
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.59
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.59
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.59
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 95.56
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 95.56
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.54
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 95.53
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 95.52
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.51
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.51
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.5
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.49
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.49
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 95.49
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.48
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.45
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 95.44
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 95.43
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.4
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 95.38
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.38
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 95.37
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.35
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 95.35
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.34
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.34
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.31
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.31
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.31
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.29
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 95.28
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 95.28
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.28
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 95.24
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 95.24
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.23
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.23
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.2
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 95.19
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.17
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 95.14
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.07
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 95.03
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 95.03
d2fh5b1 207 Signal recognition particle receptor beta-subunit 95.02
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 94.97
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 94.96
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 94.95
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 94.93
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 94.91
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 94.87
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.85
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.83
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 94.77
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 94.76
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 94.76
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 94.75
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.75
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.75
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.73
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.69
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.67
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 94.67
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.66
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.66
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.64
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 94.64
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 94.6
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 94.58
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 94.57
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 94.55
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.48
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.48
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 94.46
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 94.38
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.37
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.34
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.18
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 93.89
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 93.83
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 93.75
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 93.72
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 93.59
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.47
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 93.4
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 93.36
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 93.3
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.2
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 93.09
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 92.95
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 92.72
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.67
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 92.61
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 92.44
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 92.42
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.34
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.26
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.19
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 92.15
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 92.04
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 92.0
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.5
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 91.13
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.05
d1tuea_205 Replication protein E1 helicase domain {Human papi 90.86
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.61
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 90.52
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 90.39
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 90.39
d2c78a3 204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 89.98
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 89.72
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 89.69
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 89.08
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 89.0
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 88.91
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 88.2
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 87.6
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 87.25
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 87.11
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 86.14
d1d2ea3 196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 84.37
d1kk1a3 195 Initiation factor eIF2 gamma subunit, N-terminal ( 83.42
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 83.35
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 83.01
d2qn6a3 205 Initiation factor eIF2 gamma subunit, N-terminal ( 81.55
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 81.33
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.84  E-value=3e-21  Score=160.10  Aligned_cols=112  Identities=11%  Similarity=0.100  Sum_probs=86.6

Q ss_pred             CCCccccchhhHHHHHHHHhcCCCCCCCCcEEEEEEecCCCcHHHHHHHHHcccc--ccC-CCceEEEEecCCCCHHHHH
Q 045226          152 SEPAVYGRDTEKARVLDMVLKNDPCDAANFRVIALVGMGGIGKTTLAQEVYNDKR--VED-FKPKAWVCVSDDFDVLRIS  228 (266)
Q Consensus       152 ~~~~~vGr~~~~~~l~~~L~~~~~~~~~~~~vi~IvG~gGvGKTtLA~~v~~~~~--~~~-F~~~~wv~vs~~~~~~~i~  228 (266)
                      .++.++||+.++++|+++|....   +....+|+|+||||+||||||+.+|++..  .+. |++++||++++.++...+.
T Consensus        18 ~~~~~~gR~~~~~~i~~~L~~~~---~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~   94 (277)
T d2a5yb3          18 KQMTCYIREYHVDRVIKKLDEMC---DLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFD   94 (277)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHT---TSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHH
T ss_pred             CCCceeCcHHHHHHHHHHHHhcc---CCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHH
Confidence            44568999999999999997632   23478999999999999999999998754  566 9999999999999988776


Q ss_pred             HHHHHHh---cCCCC-------CCCChHHHHHHHHHHcCCceEEEEeC
Q 045226          229 KAILESI---TLSSC-------DLKDLNSVQLKLKEALLKKKFFDCLG  266 (266)
Q Consensus       229 ~~il~~l---~~~~~-------~~~~~~~~~~~l~~~L~~kr~LiVLD  266 (266)
                      ..+...+   .....       ...+.......+.+.|.+||||||||
T Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLD  142 (277)
T d2a5yb3          95 LFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFD  142 (277)
T ss_dssp             HHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEE
T ss_pred             HHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecc
Confidence            6665433   22211       11223345567889999999999998



>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure