Citrus Sinensis ID: 045234

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MARSKRLKKEEISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKDVNYDGFDRSDAGERNRFYFKGYWQKIKEKESLTPENVISAYYLLKKGEMHKLVSNTFASYEEEHNLSLCWNKKRKRSNRKTSGKKEKSSRSYYMRVRWYLEMQKMLKLHARTLQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLRNHHLQGLLNTMEFLPTCHQNDHCYQMRFQK
ccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccEEEcccccccccccccEEEEccccccccccccccEEEEEcccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEcHHHHHHHHHHHHHHHHHHHHcccccccccccEEEccccc
cccccccccccccccEEEEEccccEEEEEccccccccHcHHHcccccccccccccEEccccEccccccccHHHHccccHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHcccccHEHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcc
marskrlkkeEISEIWCfkckhggelrlcdntrclkvyhpecvdkdeSFLAAKTKWIcnwhfcgvcrkaskfycfccpsavcktCLYDIQFALVKENKGFCNSCLELAWLIEtkkdvnydgfdrsdagernrfyFKGYWQKIKekesltpenVISAYYLLKKGEMHKLVSNTFASYEeehnlslcwnkkrkrsnrktsgkkekssRSYYMRVRWYLEMQKMLKLHARTLQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLRNHHLQGLLntmeflptchqndhcyqmrfqk
marskrlkkeeiseiwcfkckhggelrLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLietkkdvnydgfdrsdagernrFYFKGYWQKikekesltpenVISAYYLLKKGEMHKLVSNTFASYEEehnlslcwnkkrkrsnrktsgkkekssrsyyMRVRWYLEMQKMLKLHARTLQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLRNHHLQGLLNTMEFLPTCHQNDHCYQMRFQK
MARSKRLKKEEISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKDVNYDGFDRSDAGERNRFYFKGYWQKIKEKESLTPENVISAYYLLKKGEMHKLVSNTFASYEEEHNLSLCWnkkrkrsnrktsgkkEKSSRSYYMRVRWYLEMQKMLKLHARTLQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLRNHHLQGLLNTMEFLPTCHQNDHCYQMRFQK
***********ISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKDVNYDGFDRSDAGERNRFYFKGYWQKIKEKESLTPENVISAYYLLKKGEMHKLVSNTFASYEEEHNLSLCWN********************YYMRVRWYLEMQKMLKLHARTLQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLRNHHLQGLLNTMEFLPTCHQNDHCYQM****
***************WCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETK******GFDRSDAGERNRFYFKGYWQKIKEKESLTPENVI************************************************************YLEMQKML******LQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLRNHHLQGLLNTMEFLPTCHQNDHCYQMRFQ*
**********EISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKDVNYDGFDRSDAGERNRFYFKGYWQKIKEKESLTPENVISAYYLLKKGEMHKLVSNTFASYEEEHNLSLCWNKK*****************SYYMRVRWYLEMQKMLKLHARTLQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLRNHHLQGLLNTMEFLPTCHQNDHCYQMRFQK
************SEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKDVNYDGFDRSDAGERNRFYFKGYWQKIKEKESLTPENVISAYYLL*********************************************RSYYMRVRWYLEMQKMLKLHARTLQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLRNHHLQGLLNTMEFLPTCHQNDHCYQMRFQK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSKRLKKEEISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKDVNYDGFDRSDAGERNRFYFKGYWQKIKEKESLTPENVISAYYLLKKGEMHKLVSNTFASYEEEHNLSLCWNKKRKRSNRKTSGKKEKSSRSYYMRVRWYLEMQKMLKLHARTLQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLRNHHLQGLLNTMEFLPTCHQNDHCYQMRFQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query299 2.2.26 [Sep-21-2011]
Q9SIV5 1773 Zinc finger CCCH domain-c yes no 0.612 0.103 0.371 7e-32
Q9SD34 1292 Zinc finger CCCH domain-c no no 0.454 0.105 0.406 2e-28
O960281365 Histone-lysine N-methyltr yes no 0.287 0.063 0.370 8e-11
Q8BVE81365 Histone-lysine N-methyltr yes no 0.287 0.063 0.370 2e-10
O88491 2588 Histone-lysine N-methyltr no no 0.254 0.029 0.378 2e-09
Q96L73 2696 Histone-lysine N-methyltr no no 0.214 0.023 0.388 6e-09
Q9BZ951437 Histone-lysine N-methyltr no no 0.260 0.054 0.358 1e-08
Q6P2L61439 Histone-lysine N-methyltr no no 0.264 0.054 0.353 4e-08
>sp|Q9SIV5|C3H19_ARATH Zinc finger CCCH domain-containing protein 19 OS=Arabidopsis thaliana GN=NERD PE=1 SV=3 Back     alignment and function desciption
 Score =  137 bits (346), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 72/194 (37%), Positives = 98/194 (50%), Gaps = 11/194 (5%)

Query: 17  CFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKASKFYCFC 76
           CF C  GG+L LCD   C K YHP CVD+DE+F   K KW C WH C  C K + + C+ 
Sbjct: 602 CFMCFDGGDLVLCDRRGCTKAYHPSCVDRDEAFFQTKGKWNCGWHLCSKCEKTATYLCYT 661

Query: 77  CPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKD----VNYDGFDRSDAGERNR 132
           C  ++CK C  D  F  ++ NKG C +C+E   LIE K+        D  D++       
Sbjct: 662 CMFSLCKGCAKDAVFFCIRGNKGLCETCMETVKLIERKQQEKEPAQLDFNDKTSW----E 717

Query: 133 FYFKGYWQKIKEKESLTPENVISAYYLLKKGEMHKLVSNTFASYE---EEHNLSLCWNKK 189
           + FK YW  +K + SL+PE +  A   LK  E +     T +  +   +  + S    KK
Sbjct: 718 YLFKDYWIDLKTQLSLSPEELDQAKRPLKGHETNASKQGTASETDYVTDGGSDSDSSPKK 777

Query: 190 RKRSNRKTSGKKEK 203
           RK  +R  SG  EK
Sbjct: 778 RKTRSRSKSGSAEK 791

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SD34|C3H44_ARATH Zinc finger CCCH domain-containing protein 44 OS=Arabidopsis thaliana GN=At3g51120 PE=2 SV=3 Back     alignment and function description
>sp|O96028|NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens GN=WHSC1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BVE8|NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus GN=Whsc1 PE=1 SV=2 Back     alignment and function description
>sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 Back     alignment and function description
>sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1 Back     alignment and function description
>sp|Q9BZ95|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens GN=WHSC1L1 PE=1 SV=1 Back     alignment and function description
>sp|Q6P2L6|NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
297739485 819 unnamed protein product [Vitis vinifera] 0.665 0.242 0.457 8e-40
255575932 517 conserved hypothetical protein [Ricinus 0.602 0.348 0.480 5e-39
449431880 746 PREDICTED: zinc finger CCCH domain-conta 0.541 0.217 0.490 4e-38
449520998 471 PREDICTED: zinc finger CCCH domain-conta 0.541 0.343 0.490 5e-38
48475176 620 unknown protein [Oryza sativa Japonica G 0.842 0.406 0.356 2e-36
357460667 814 hypothetical protein MTR_3g064280 [Medic 0.505 0.185 0.493 2e-35
357460665 964 Zinc finger CCCH domain-containing prote 0.518 0.160 0.474 6e-35
357460661 862 Zinc finger CCCH domain-containing prote 0.501 0.174 0.477 6e-35
356537823 520 PREDICTED: uncharacterized protein At5g0 0.501 0.288 0.477 3e-34
357460663 814 Zinc finger CCCH domain-containing prote 0.505 0.185 0.474 3e-32
>gi|297739485|emb|CBI29667.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  170 bits (430), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 96/210 (45%), Positives = 132/210 (62%), Gaps = 11/210 (5%)

Query: 6   RLKKEEISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGV 65
           ++KKEEI+E +CF CK GG L +CD   CLK YHP+CV K++SFL +   W C+WH C  
Sbjct: 8   KIKKEEIAEDYCFVCKDGGLLMVCDYKDCLKAYHPQCVGKEDSFLESDESWSCSWHSCFN 67

Query: 66  CRKASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKDVNYDGFDRS 125
           C+KASKF C+ CP AVC +CL   +FA V+  KGFC+ CL+LA LIE + DV+ DG  + 
Sbjct: 68  CQKASKFQCYVCPKAVCGSCLSVSEFAQVRGKKGFCSHCLKLALLIEDEMDVDSDG-GKV 126

Query: 126 DAGERN--RFYFKGYWQKIKEKESLTPENVISAYYLLKKGEMHKLVSNTFASY----EEE 179
           D  +R    F F  Y++ IK+KE +T ENV SA  LLKKG+ +   S++   Y    E++
Sbjct: 127 DFKDRETYEFLFMEYYEIIKDKEGITAENVHSADALLKKGKNYGSSSDSDELYKGHEEDQ 186

Query: 180 HNLSLCWN----KKRKRSNRKTSGKKEKSS 205
             LS C +    +  KR  R+ S  K K++
Sbjct: 187 LELSDCDDMDDSEGHKRVVRRKSSVKGKAT 216

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255575932|ref|XP_002528863.1| conserved hypothetical protein [Ricinus communis] gi|223531714|gb|EEF33537.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449431880|ref|XP_004133728.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449520998|ref|XP_004167519.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|48475176|gb|AAT44245.1| unknown protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357460667|ref|XP_003600615.1| hypothetical protein MTR_3g064280 [Medicago truncatula] gi|355489663|gb|AES70866.1| hypothetical protein MTR_3g064280 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357460665|ref|XP_003600614.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489662|gb|AES70865.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357460661|ref|XP_003600612.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489660|gb|AES70863.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356537823|ref|XP_003537424.1| PREDICTED: uncharacterized protein At5g08430-like [Glycine max] Back     alignment and taxonomy information
>gi|357460663|ref|XP_003600613.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489661|gb|AES70864.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
TAIR|locus:2060949 824 AT2G18090 "AT2G18090" [Arabido 0.491 0.178 0.397 2e-29
TAIR|locus:2827287 1773 NERD "Needed for RDR2-independ 0.511 0.086 0.411 1.2e-28
TAIR|locus:2080863 1292 AT3G51120 [Arabidopsis thalian 0.484 0.112 0.409 1.2e-28
UNIPROTKB|E1C7651372 WHSC1 "Uncharacterized protein 0.260 0.056 0.451 4.7e-12
UNIPROTKB|F1S8S01361 WHSC1 "Uncharacterized protein 0.317 0.069 0.383 6.2e-12
UNIPROTKB|F1MMY41368 WHSC1 "Uncharacterized protein 0.327 0.071 0.368 6.2e-12
UNIPROTKB|J9NUG71359 WHSC1 "Uncharacterized protein 0.297 0.065 0.382 8.5e-12
UNIPROTKB|F1PK461362 WHSC1 "Uncharacterized protein 0.297 0.065 0.382 8.5e-12
UNIPROTKB|O960281365 WHSC1 "Histone-lysine N-methyl 0.321 0.070 0.366 1.5e-11
ZFIN|ZDB-GENE-030131-25811461 whsc1 "Wolf-Hirschhorn syndrom 0.260 0.053 0.414 2.2e-11
TAIR|locus:2060949 AT2G18090 "AT2G18090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 336 (123.3 bits), Expect = 2.0e-29, P = 2.0e-29
 Identities = 60/151 (39%), Positives = 87/151 (57%)

Query:     8 KKEEISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCR 67
             K+ E  ++ CF C  GG L LCD   C K YHP CV + E+F  +++KW C WH C  C+
Sbjct:    74 KRREDEDV-CFVCFDGGSLVLCDRRGCPKAYHPACVKRTEAFFRSRSKWNCGWHICTTCQ 132

Query:    68 KASKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKDVNYDGF--DRS 125
             K S + C+ CP +VCK C+   ++ +V+ENKGFC  C++   LIE   + N +    D  
Sbjct:   133 KDSFYMCYTCPYSVCKRCVRSSEYVVVRENKGFCGICMKTIMLIENAAEANKEKVQVDFD 192

Query:   126 DAGERNRFYFKGYWQKIKEKESLTPENVISA 156
             D G    + FK YW  +KEK  L+ +++  A
Sbjct:   193 DQGSWE-YLFKIYWVSLKEKLGLSLDDLTKA 222
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2827287 NERD "Needed for RDR2-independent DNA methylation" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080863 AT3G51120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C765 WHSC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8S0 WHSC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMY4 WHSC1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NUG7 WHSC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK46 WHSC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O96028 WHSC1 "Histone-lysine N-methyltransferase NSD2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2581 whsc1 "Wolf-Hirschhorn syndrome candidate 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035317001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (431 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 299
KOG1946240 consensus RNA polymerase I transcription factor UA 99.95
PF0220176 SWIB: SWIB/MDM2 domain; InterPro: IPR003121 The SW 99.73
smart0015177 SWIB SWI complex, BAF60b domains. 99.68
COG5531237 SWIB-domain-containing proteins implicated in chro 99.55
PRK14724987 DNA topoisomerase III; Provisional 99.47
PRK06319860 DNA topoisomerase I/SWI domain fusion protein; Val 98.77
KOG2570 420 consensus SWI/SNF transcription activation complex 98.33
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.22
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.05
KOG4299613 consensus PHD Zn-finger protein [General function 97.95
KOG1973274 consensus Chromatin remodeling protein, contains P 97.87
KOG0383 696 consensus Predicted helicase [General function pre 97.79
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 97.74
KOG1244336 consensus Predicted transcription factor Requiem/N 97.68
KOG1081463 consensus Transcription factor NSD1 and related SE 97.66
KOG0383 696 consensus Predicted helicase [General function pre 97.65
KOG4299 613 consensus PHD Zn-finger protein [General function 97.58
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 97.53
KOG1512381 consensus PHD Zn-finger protein [General function 97.38
KOG0956 900 consensus PHD finger protein AF10 [General functio 96.76
KOG0954 893 consensus PHD finger protein [General function pre 96.76
KOG1244336 consensus Predicted transcription factor Requiem/N 96.57
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 96.54
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 96.48
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 96.37
KOG1512381 consensus PHD Zn-finger protein [General function 96.23
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.14
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 96.13
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.38
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 95.3
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 94.34
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 93.26
KOG0825 1134 consensus PHD Zn-finger protein [General function 93.19
COG5141 669 PHD zinc finger-containing protein [General functi 93.15
KOG3362156 consensus Predicted BBOX Zn-finger protein [Genera 89.38
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 89.38
KOG0957 707 consensus PHD finger protein [General function pre 88.22
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 85.9
KOG0957707 consensus PHD finger protein [General function pre 85.05
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 84.78
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 82.88
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 81.69
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 81.67
>KOG1946 consensus RNA polymerase I transcription factor UAF [Transcription] Back     alignment and domain information 
Probab=99.95  E-value=1e-28  Score=227.56  Aligned_cols=157  Identities=15%  Similarity=0.164  Sum_probs=113.9

Q ss_pred             CcccccchhhHHhhhccccCCChhhHHHHHHhhhcCCccc--c-ccccccCcccccccccccccccc-ccccc-------
Q 045234          128 GERNRFYFKGYWQKIKEKESLTPENVISAYYLLKKGEMHK--L-VSNTFASYEEEHNLSLCWNKKRK-RSNRK-------  196 (299)
Q Consensus       128 ~~~~e~lfk~yw~~ik~k~~lt~~~l~~a~~~~~~~~~~~--~-~~~~~~~~d~~~~~~~~~~~~~k-~~~~~-------  196 (299)
                      ..+|+++|.+||...+.++.||.++|.+|.+.+.+-...+  . ........++..+....++.+++ +..+.       
T Consensus         3 ~~~~~~~~~~~~l~~~~~~~lt~~~vr~~~~~~~~v~~~~~k~~~~~~~~~~~~~~~~~~~k~~~~k~~~~~~~~~~~~~   82 (240)
T KOG1946|consen    3 SLSWEYLFKDYILSLKDQETLTPDDVRRAMAPRSGVDGTAQKSLLAKAIDESSDEDSALPVKGSKKKKRGSKTRSRKPKS   82 (240)
T ss_pred             chhhhhhhhHHHhcccccccCCHHHHHHHhccccCCCCcchhhhhhhhhhcccccccccccccccccccccccccccCcc
Confidence            4589999999999999999999999999999998865531  1 11111222223333334443333 11111       


Q ss_pred             ccCccccccccccchhhhH-HHHHHHHHHhhhh-----hhhhhhHHHHHHHHhhhcccCCcCCCCeeecchhhHHHHHH-
Q 045234          197 TSGKKEKSSRSYYMRVRWY-LEMQKMLKLHART-----LQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLR-  269 (299)
Q Consensus       197 ~~~k~~k~~~~~~~~~gw~-~eL~~fl~~~g~~-----lsr~~~v~k~lw~YIk~n~LqdP~~Kr~I~CD~kL~~lF~~-  269 (299)
                      ...+..+..+...  ++|| ..|+.|+..+++.     |||+ +|+++||+|||+||||||.||+.|+||++|+.||++ 
T Consensus        83 ~~~~~~~~~~~~~--~~~g~~kl~~ls~~L~~~~G~~~lsR~-~vvk~iw~YIke~nLqDP~nkr~IlCDekL~~iF~~k  159 (240)
T KOG1946|consen   83 LESSGEKNKKKKK--ASWGSTKLIPLSPSLARFVGTSELSRT-DVVKKIWAYIKEHNLQDPKNKREILCDEKLKSIFGKK  159 (240)
T ss_pred             cccccccchhccc--cCcCcccccccCHHHHhhcccccccHH-HHHHHHHHHHHHhccCCccccCeeeeHHHHHHHhccC
Confidence            0001111112222  6699 8888888888654     9999 999999999999999999999999999999999997 


Q ss_pred             ---HhhhHHHHhcccCCCCCC
Q 045234          270 ---NHHLQGLLNTMEFLPTCH  287 (299)
Q Consensus       270 ---~f~m~klL~~H~~~p~~~  287 (299)
                         ||+|++||++||+.+.=.
T Consensus       160 ~v~~fem~KLL~~H~~~~~d~  180 (240)
T KOG1946|consen  160 RVGMFEMLKLLTKHFLKNQDM  180 (240)
T ss_pred             ccceeeHHHHHHHhccCcccc
Confidence               999999999999876543

>PF02201 SWIB: SWIB/MDM2 domain; InterPro: IPR003121 The SWI/SNF family of complexes, which are conserved from yeast to humans, are ATP-dependent chromatin-remodelling proteins that facilitate transcription activation [] Back     alignment and domain information
>smart00151 SWIB SWI complex, BAF60b domains Back     alignment and domain information
>COG5531 SWIB-domain-containing proteins implicated in chromatin remodeling [Chromatin structure and dynamics] Back     alignment and domain information
>PRK14724 DNA topoisomerase III; Provisional Back     alignment and domain information
>PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>KOG2570 consensus SWI/SNF transcription activation complex subunit [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG1081 consensus Transcription factor NSD1 and related SET domain proteins [Transcription] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
4gnd_A107 Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains 6e-09
>pdb|4GND|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains Length = 107 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 3/82 (3%)
Query: 2  ARSKRLKKEEISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWH 61
          AR  + + +++ E +CF+C  GGEL +CD   C K YH  C++  +       KW C WH
Sbjct: 3  ARKIKTEPKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYG---KWECPWH 59
Query: 62 FCGVCRKASKFYCFCCPSAVCK 83
           C  C  A+  +C  CP + CK
Sbjct: 60 QCDECSSAAVSFCEFCPHSFCK 81

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 2e-07
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 1e-04
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 1e-04
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 1e-04
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 2e-04
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 6e-04
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 9e-04
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
 Score = 50.7 bits (120), Expect = 2e-07
 Identities = 19/107 (17%), Positives = 33/107 (30%), Gaps = 11/107 (10%)

Query: 10  EEISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCRKA 69
           ++  + +C  C  G  L +C N  C + Y  ECVD            +      G     
Sbjct: 89  DDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDS-----------LVGPGTSGKVHAM 137

Query: 70  SKFYCFCCPSAVCKTCLYDIQFALVKENKGFCNSCLELAWLIETKKD 116
           S + C+ C  +     L   +    +    +         + ET   
Sbjct: 138 SNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPV 184
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
1v32_A101 AT5G08430, hypothetical protein RAFL09-47-K03; SWI 99.93
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.88
1v31_A93 Hypothetical protein RAFL11-05-P19; SWI/SNF comple 99.81
1uhr_A93 SWI/SNF related, matrix associated, actin dependen 99.8
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.69
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.6
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.55
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.44
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.4
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.22
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.17
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.16
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.14
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.11
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.1
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.06
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 99.05
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.95
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.92
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.92
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.9
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.89
2yt5_A66 Metal-response element-binding transcription facto 98.79
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.78
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.72
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.7
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.65
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.48
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.46
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.41
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.4
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.4
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.39
1weu_A91 Inhibitor of growth family, member 4; structural g 98.39
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.32
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.31
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.3
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.28
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.28
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 98.26
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.26
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.2
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.14
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.02
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 97.91
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 97.76
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.71
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 97.7
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 97.68
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 97.66
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 97.66
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 97.65
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 97.64
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 97.6
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 97.54
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 97.52
1we9_A64 PHD finger family protein; structural genomics, PH 97.46
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.4
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 97.32
2yt5_A66 Metal-response element-binding transcription facto 97.31
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 97.26
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 97.26
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 97.25
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 97.24
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 97.23
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 96.9
1wew_A78 DNA-binding family protein; structural genomics, P 96.79
3o70_A68 PHD finger protein 13; PHF13, structural genomics 96.62
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 96.61
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 96.6
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 96.38
1wem_A76 Death associated transcription factor 1; structura 96.37
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 96.3
1wee_A72 PHD finger family protein; structural genomics, PH 96.22
2k16_A75 Transcription initiation factor TFIID subunit 3; p 96.1
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 96.01
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 95.72
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 95.69
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 95.57
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 95.46
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 95.03
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 94.24
3dac_M130 MDM4 protein; MDMX, MDM4, HDMX, HDM4, MDM-4, MDM-X 94.17
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 94.16
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 94.13
3kv5_D 488 JMJC domain-containing histone demethylation prote 93.83
3fea_A100 MDM4 protein; HDMX, HDM4,human MDM4, human MDMX, p 93.7
2z5s_M140 MDM4 protein, zebrafish MDMX; MDMX, MDM4, acetylat 93.21
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 92.93
1ycq_A107 MDM2, MDM2; anti-oncogene, DNA-binding, transcript 92.84
1z1m_A119 Ubiquitin-protein ligase E3 MDM2; peptide-binding 92.33
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 92.08
1weu_A91 Inhibitor of growth family, member 4; structural g 91.91
2axi_A115 Ubiquitin-protein ligase E3 MDM2; drug design, pro 91.26
1wil_A89 KIAA1045 protein; ring finger domain, structural g 91.2
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 91.15
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 90.97
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 90.93
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 90.67
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 89.99
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 89.51
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 89.45
1we9_A64 PHD finger family protein; structural genomics, PH 89.05
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 88.69
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 86.99
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 83.86
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 82.92
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 81.46
1x4i_A70 Inhibitor of growth protein 3; structural genomics 81.04
>1v32_A AT5G08430, hypothetical protein RAFL09-47-K03; SWI/SNF complex subunit, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.42.1.1 Back     alignment and structure
Probab=99.93  E-value=1.2e-26  Score=187.63  Aligned_cols=80  Identities=14%  Similarity=0.151  Sum_probs=75.1

Q ss_pred             cccccccchhhhH-HHHHHHHHHhhhh----hhhhhhHHHHHHHHhhhcccCCcCCCCeeecchhhHHHHHH----Hhhh
Q 045234          203 KSSRSYYMRVRWY-LEMQKMLKLHART----LQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLR----NHHL  273 (299)
Q Consensus       203 k~~~~~~~~~gw~-~eL~~fl~~~g~~----lsr~~~v~k~lw~YIk~n~LqdP~~Kr~I~CD~kL~~lF~~----~f~m  273 (299)
                      .+++.+|  +||+ ++|++||++||.+    ++|+ +|++.||+|||+||||||.|||.|+||++|+.|||+    +|+|
T Consensus         6 ~~~~~~~--~~w~S~eLa~fl~~iG~~~~~~~sR~-eVvk~lW~YIK~nnLQdp~~Kr~I~cD~kLk~lFg~~~v~~~~m   82 (101)
T 1v32_A            6 SGKRFEF--VGWGSRQLIEFLHSLGKDTSEMISRY-DVSDTIAKYISKEGLLDPSNKKKVVCDKRLVLLFGTRTIFRMKV   82 (101)
T ss_dssp             CSSCCSS--SSSSCHHHHHHHHHHTCCCSSCCCHH-HHHHHHHHHHHHHTCBCSSCTTEEECCSHHHHHTCCSEEETTHH
T ss_pred             CCCccee--cccCCHHHHHHHHHcCCCCccccCHH-HHHHHHHHHHHhhcCcCcccCCeeeccHHHHHHHCCCcccHHHH
Confidence            4578899  9999 9999999999973    9999 999999999999999999999999999999999997    9999


Q ss_pred             HHHHhcccCCCC
Q 045234          274 QGLLNTMEFLPT  285 (299)
Q Consensus       274 ~klL~~H~~~p~  285 (299)
                      +++|++|+..+.
T Consensus        83 ~klL~~Hl~~~~   94 (101)
T 1v32_A           83 YDLLEKHYKENQ   94 (101)
T ss_dssp             HHHHHHHSCSCC
T ss_pred             HHHHHHHcCccc
Confidence            999999998654
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1v31_A Hypothetical protein RAFL11-05-P19; SWI/SNF complex subunit, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.42.1.1 Back     alignment and structure
>1uhr_A SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily...; structural genomics, chromatin remodeling; NMR {Mus musculus} SCOP: a.42.1.1 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3dac_M MDM4 protein; MDMX, MDM4, HDMX, HDM4, MDM-4, MDM-X, MDM2, HDM2, nucleus, oncogene, apoptosis, cell cycle, disease mutation; 1.80A {Danio rerio} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3fea_A MDM4 protein; HDMX, HDM4,human MDM4, human MDMX, protein-protein interaction, metal-binding; HET: PM3 6CW; 1.33A {Homo sapiens} SCOP: a.42.1.0 PDB: 3fe7_A* 3u15_A* 2vyr_A 3lbj_E* 3fdo_A 3dab_A 3jzp_A 3jzo_A 3jzq_A 3eqy_A Back     alignment and structure
>2z5s_M MDM4 protein, zebrafish MDMX; MDMX, MDM4, acetylation, activator, anti-oncogene, apoptosis, cell cycle, cytoplasm, disease mutation, DNA- binding; 2.30A {Danio rerio} PDB: 2z5t_M Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1ycq_A MDM2, MDM2; anti-oncogene, DNA-binding, transcription regulation, nuclear protein, complex (oncogene protein/peptide), phosphorylation, activator; 2.30A {Xenopus laevis} SCOP: a.42.1.1 Back     alignment and structure
>1z1m_A Ubiquitin-protein ligase E3 MDM2; peptide-binding groove, psudosymmetry, alpha-beta domains; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2axi_A Ubiquitin-protein ligase E3 MDM2; drug design, protein-protein interactions, ligase, LIGA inhibitor complex; HET: 6CW MPO; 1.40A {Homo sapiens} SCOP: a.42.1.1 PDB: 1ycr_A 2gv2_A* 1t4f_M* 3jzr_A 3g03_A 3tu1_A* 3jzk_A* 1t4e_A* 3lbl_A* 4dij_A* 3lbk_A* 3v3b_A* 3jzs_A 3eqs_A 3iux_A* 3iwy_A* 3lnj_A* 3lnz_A 1rv1_A* 1ttv_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 299
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 1e-04
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Mi2-beta (CHD4)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.2 bits (86), Expect = 1e-04
 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 3/58 (5%)

Query: 10 EEISEIWCFKCKHGGELRLCDNTRCLKVYHPECVDKDESFLAAKTKWICNWHFCGVCR 67
           +    +C  CK GGEL  CD   C   YH  C++     +    +W+C    C   +
Sbjct: 5  SDHHMEFCRVCKDGGELLCCDT--CPSSYHIHCLNPPLPEI-PNGEWLCPRCTCPALK 59

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
d1v32a_101 Hypothetical protein AT5G08430 (rafl09-47-k03) {Th 99.92
d1uhra_93 SWI/SNF related regulator of chromatin (BRG1-assoc 99.78
d1v31a_93 Hypothetical protein AT5G14170 (rafl11-05-p19) {Th 99.77
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.17
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.92
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.3
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.14
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 97.94
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.86
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.56
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 97.29
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 97.23
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.22
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 97.15
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 96.98
d1ttva_107 MDM2 {African clawed frog (Xenopus laevis) [TaxId: 96.52
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 96.46
d1wema_76 Death associated transcription factor 1, Datf1 (DI 96.3
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 96.05
d2axia185 MDM2 {Human (Homo sapiens) [TaxId: 9606]} 95.97
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 94.91
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 92.14
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 91.13
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 90.77
d1wema_76 Death associated transcription factor 1, Datf1 (DI 90.75
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 85.45
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 82.6
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 82.26
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 80.75
>d1v32a_ a.42.1.1 (A:) Hypothetical protein AT5G08430 (rafl09-47-k03) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: SWIB/MDM2 domain
superfamily: SWIB/MDM2 domain
family: SWIB/MDM2 domain
domain: Hypothetical protein AT5G08430 (rafl09-47-k03)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.92  E-value=4.4e-26  Score=182.47  Aligned_cols=77  Identities=14%  Similarity=0.154  Sum_probs=72.2

Q ss_pred             cccccchhhhH-HHHHHHHHHhhhh----hhhhhhHHHHHHHHhhhcccCCcCCCCeeecchhhHHHHHH----HhhhHH
Q 045234          205 SRSYYMRVRWY-LEMQKMLKLHART----LQEQNNKNTMVACRNHTQEALVKAMQLHVTCHWNMWNLYLR----NHHLQG  275 (299)
Q Consensus       205 ~~~~~~~~gw~-~eL~~fl~~~g~~----lsr~~~v~k~lw~YIk~n~LqdP~~Kr~I~CD~kL~~lF~~----~f~m~k  275 (299)
                      ++.+|  +||| +||++||+.||.+    |||+ +|++.||+|||+||||||.|||.|+||++|+.|||.    +|+|++
T Consensus         8 k~~~~--~g~~S~eL~~FL~~~g~~~~~~~sR~-eVtk~iw~YIK~nnLqdp~nkr~I~~D~~L~~Lfg~~~v~~f~i~k   84 (101)
T d1v32a_           8 KRFEF--VGWGSRQLIEFLHSLGKDTSEMISRY-DVSDTIAKYISKEGLLDPSNKKKVVCDKRLVLLFGTRTIFRMKVYD   84 (101)
T ss_dssp             SCCSS--SSSSCHHHHHHHHHHTCCCSSCCCHH-HHHHHHHHHHHHHTCBCSSCTTEEECCSHHHHHTCCSEEETTHHHH
T ss_pred             Ccccc--cCcCCHHHHHHHHhcCCCCcccCCHH-HHHHHHHHHHHHhcCCCCccCCEEccCHHHHHHhCCCcccHHHHHH
Confidence            45678  9999 9999999999876    9999 999999999999999999999999999999999997    999999


Q ss_pred             HHhcccCCC
Q 045234          276 LLNTMEFLP  284 (299)
Q Consensus       276 lL~~H~~~p  284 (299)
                      +|++||+..
T Consensus        85 ~l~~H~~~~   93 (101)
T d1v32a_          85 LLEKHYKEN   93 (101)
T ss_dssp             HHHHHSCSC
T ss_pred             HHHHHcCCc
Confidence            999998754
>d1uhra_ a.42.1.1 (A:) SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v31a_ a.42.1.1 (A:) Hypothetical protein AT5G14170 (rafl11-05-p19) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ttva_ a.42.1.1 (A:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2axia1 a.42.1.1 (A:25-109) MDM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure