Citrus Sinensis ID: 045270


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MQWRQSTDCCDWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANISSLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLREIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTLSLLDLSNNSFMKKSDAFLNCLLQTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSLH
cccccccccccccEEEEcccccEEEEEccccccEEEccccccccccccccEEEccccccccccccHHHHccccccEEEccccccEEcccHHHHccccccEEEccccccEEEcccHHHcccccccEEEccccEEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEccccccccccccEEEccccEEEEEcccccccccccccEEEcccccccccccccccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccEEEccccccEEEcccccccccEEEcccccccccccHHHHHccccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHHHHcccEEEccccEEEEcccHHHHccccccEEEccccccccccccccccccccc
cccccccccccEEEEEEcccccEEEEEEEcccccccEEccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHcccccccEEEEccccccccccHHHccccccHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHcccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccEEEEEccccccccccHHHcccccccEEEEEccccccccccccccccccEEEEEcccccccccccccccccEEEEccccccccccHHHHHHHHHccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHHHHEccccccccccccHHHHccccccEEEcccccccccccHHHcccHccc
mqwrqstdccdwsgvdcdeaghvigldlstesisGGIENAASLFSLHYLRSLNLartsfngtqipsklanissltylnlsdagfaghiplQISSMARLVALDfsfnqfsgsisSIRWEHLLNLVYAVLsdnslngsiprsmfefpifsnasssaldtldlsgnrlrgsipvSVFELKKLTSLLLSsnnlhgtvqldkilnlgnlakldlsynslavdessrnysfspMLELLNLAScklreipnlknqsQLQYLYLSENqisreipnwIWRVSVVGLHClnlshnllvgfqgpysipalrfidlsshqlrgnihqlpnnliyidfsnnnftssipadtgnfmpRLRYFCAAnngltgiipaslcnattlslldlsnnsfmkkSDAFLNCLLQTLDlngnrlqgtvpksiaNCKMLEVLnlgnnqfsdkfpcwlydapslh
mqwrqstdccdWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANISSLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLREIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTLSLLDLSNNSFMKKSDAFLNCLLQTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSLH
MQWRQSTDCCDWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANISSLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFsnasssaldtldlsGNRLRGSIPVSVFElkkltslllssnnlHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLREIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTlslldlsnnsFMKKSDAFLNCLLQTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSLH
******TDCCDWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANISSLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLREIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTLSLLDLSNNSFMKKSDAFLNCLLQTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYD*****
MQWRQSTDCCDWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANISSLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLREIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTLSLLDLSNNSFMKKSDAFLNCLLQTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSL*
*********CDWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANISSLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLREIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTLSLLDLSNNSFMKKSDAFLNCLLQTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSLH
*QW*QSTDCCDWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANISSLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLREIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTLSLLDLSNNSFMKKSDAFLNCLLQTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQWRQSTDCCDWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANISSLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLREIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTLSLLDLSNNSFMKKSDAFLNCLLQTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query440 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.954 0.495 0.303 3e-42
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.811 0.285 0.333 1e-35
Q9FL28 1173 LRR receptor-like serine/ no no 0.868 0.325 0.318 2e-35
O82318 960 Probably inactive leucine no no 0.831 0.381 0.312 5e-33
Q9ZUI0 980 Putative leucine-rich rep no no 0.897 0.403 0.312 1e-31
C0LGQ5 1249 LRR receptor-like serine/ no no 0.875 0.308 0.323 8e-31
Q9FZ59 1088 Leucine-rich repeat recep no no 0.961 0.388 0.299 1e-30
Q9FRS6 1029 Leucine-rich repeat recep no no 0.952 0.407 0.273 1e-30
Q6XAT2 967 LRR receptor-like serine/ no no 0.922 0.419 0.315 2e-30
C0LGW6 966 LRR receptor-like serine/ no no 0.918 0.418 0.305 3e-30
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  172 bits (437), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 158/521 (30%), Positives = 234/521 (44%), Gaps = 101/521 (19%)

Query: 3   WRQSTDCCDWSGVDC-DEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNG 61
           W +STDCC W+GV C D++G VI LD+    ++  ++  +SLF L YLR L+L   +  G
Sbjct: 65  WNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNLYG 124

Query: 62  TQIPSKLANISSLTYLNLSDAGFAGHIPLQISSM------------------------AR 97
            +IPS L N+S LT +NL    F G IP  I ++                        +R
Sbjct: 125 -EIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSR 183

Query: 98  LVALDFSFNQFSGSI-------SSIR----------------WEHLLNLVYAVLSDNSLN 134
           LV L+   N+  G I         +R                  +L NLV+ VL+ N L 
Sbjct: 184 LVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLV 243

Query: 135 GSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQ 194
           G +P S+         +   L  +    N L G+IP+S   L KL+  +LSSNN   T  
Sbjct: 244 GEVPASI--------GNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFP 295

Query: 195 LDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLR---EIPNLKNQSQL 251
            D  +   NL   D+SYNS +     ++    P LE + L   +     E  N  + ++L
Sbjct: 296 FDMSI-FHNLEYFDVSYNSFS-GPFPKSLLLIPSLESIYLQENQFTGPIEFANTSSSTKL 353

Query: 252 QYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPY--SIPALRFIDLSSHQL 309
           Q L L  N++   IP  I R+  + L  L++SHN   G   P    +  L  +DLS + L
Sbjct: 354 QDLILGRNRLHGPIPESISRL--LNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNL 411

Query: 310 RGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTL 369
            G +      L  +  S+N+F+S    +T      +      +N   G IP  +C  ++L
Sbjct: 412 EGEVPACLWRLNTMVLSHNSFSSF--ENTSQEEALIEELDLNSNSFQGPIPYMICKLSSL 469

Query: 370 SLLDLSNNSFMKKSDAFLNCL------------------------------LQTLDLNGN 399
             LDLSNN F   S +  +C+                              L +LD++ N
Sbjct: 470 GFLDLSNNLF---SGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHN 526

Query: 400 RLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSLH 440
           +L+G  PKS+ NCK LE++N+ +N+  D FP WL   PSLH
Sbjct: 527 QLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLH 567




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
359481300 1054 PREDICTED: leucine-rich repeat receptor 0.947 0.395 0.445 3e-86
359481304 1057 PREDICTED: LRR receptor-like serine/thre 0.95 0.395 0.438 3e-85
359481302 988 PREDICTED: leucine-rich repeat receptor 0.934 0.415 0.437 6e-80
147806063 1032 hypothetical protein VITISV_032508 [Viti 0.947 0.404 0.431 1e-79
147770395 1003 hypothetical protein VITISV_004262 [Viti 0.934 0.409 0.431 4e-79
34761800 1138 verticillium wilt disease resistance pro 0.943 0.364 0.424 5e-79
65332099 1051 verticillium wilt disease resistance pro 0.936 0.392 0.416 7e-77
147806065 738 hypothetical protein VITISV_032510 [Viti 0.931 0.555 0.426 2e-76
359481298 1070 PREDICTED: LRR receptor-like serine/thre 0.95 0.390 0.425 4e-76
37956237 1051 resistance protein SlVe1 precursor [Sola 0.945 0.395 0.417 4e-76
>gi|359481300|ref|XP_002269481.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  325 bits (833), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 209/469 (44%), Positives = 269/469 (57%), Gaps = 52/469 (11%)

Query: 19  EAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANISSLTYLN 78
           + G +  L LS    SG + N  S+ +L  L  + LA   F+G  IP+ +AN++ L YL+
Sbjct: 293 QGGCLETLVLSVTKFSGKLPN--SIANLKRLARIELADCDFSGP-IPTVMANLTQLVYLD 349

Query: 79  LSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIP 138
            S   F+G IP   S    L  +D S N  +G ISS  W   +NLV      NSL GS+P
Sbjct: 350 FSHNKFSGAIP-SFSLSKNLTLIDLSHNNLTGQISSSHWVGFVNLVTIDFCYNSLYGSLP 408

Query: 139 RSMFEFPI-----------------FSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTS 181
             +F  P                  F   SS  +DTLDLSGN L G IPVS+F+L+ L  
Sbjct: 409 MPLFSLPSLQKIKLNNNQFSGPFGEFPATSSHPMDTLDLSGNNLEGPIPVSLFDLQHLNI 468

Query: 182 LLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYS--FSPMLELLNLASCKL 239
           L LSSN  +GTV+L +   LGNL  L LSYN+L+++ S  N +    P+L  L LASCKL
Sbjct: 469 LDLSSNKFNGTVELSQFQKLGNLTTLSLSYNNLSINPSRSNPTSPLLPILSTLKLASCKL 528

Query: 240 REIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYS--IP 297
           R +P+L +QS L  L LS+NQI  +IPNWIW++    L  LNLSHNLL G Q P S   P
Sbjct: 529 RTLPDLSSQSMLVILDLSQNQIPGKIPNWIWKIGNGFLSHLNLSHNLLEGLQEPLSNLPP 588

Query: 298 ALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTG 357
            L  +DL S+QLRG I   P++  Y+D+SNN FTSSIP D G +M    +F  + N +TG
Sbjct: 589 FLSTLDLHSNQLRGPIPTPPSS-TYVDYSNNRFTSSIPDDIGTYMNVTVFFSLSKNNITG 647

Query: 358 IIPASLCNATTLSLLDLSNNSFMKKSDAFL--------------------------NCLL 391
           IIPAS+CNA  L +LD S+NS   K  + L                          +CLL
Sbjct: 648 IIPASICNAHYLQVLDFSDNSLSGKIPSCLIENGDLAVLNLRRNKFKGTIPGEFPGHCLL 707

Query: 392 QTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSLH 440
           QTLDLNGN L+G +P+S+ANCK LEVLNLGNN+ +D FPCWL +  SL 
Sbjct: 708 QTLDLNGNLLEGKIPESLANCKALEVLNLGNNRMNDIFPCWLKNISSLR 756




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359481304|ref|XP_002270356.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481302|ref|XP_003632605.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147806063|emb|CAN76702.1| hypothetical protein VITISV_032508 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770395|emb|CAN78148.1| hypothetical protein VITISV_004262 [Vitis vinifera] Back     alignment and taxonomy information
>gi|34761800|gb|AAQ82053.1| verticillium wilt disease resistance protein precursor [Solanum torvum] Back     alignment and taxonomy information
>gi|65332099|gb|AAY42203.1| verticillium wilt disease resistance protein [Solanum torvum] Back     alignment and taxonomy information
>gi|147806065|emb|CAN76704.1| hypothetical protein VITISV_032510 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481298|ref|XP_003632604.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|37956237|gb|AAP20228.1| resistance protein SlVe1 precursor [Solanum lycopersicoides] gi|37956239|gb|AAP20229.1| resistance protein SlVe1 precursor [Solanum lycopersicoides] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
TAIR|locus:2205005 1019 RLP7 "AT1G47890" [Arabidopsis 0.515 0.222 0.325 1.2e-46
TAIR|locus:2046535 740 RLP28 "receptor like protein 2 0.952 0.566 0.288 5.9e-42
TAIR|locus:2825762 994 RLP6 "AT1G45616" [Arabidopsis 0.915 0.405 0.311 8.3e-42
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.934 0.485 0.302 3e-41
TAIR|locus:2046585 808 RLP27 "receptor like protein 2 0.909 0.495 0.296 6.1e-35
TAIR|locus:2046357 890 RLP23 "receptor like protein 2 0.913 0.451 0.307 2.2e-38
TAIR|locus:2119445 719 AT4G13820 [Arabidopsis thalian 0.938 0.574 0.290 9.7e-37
TAIR|locus:2129246 891 RLP50 "receptor like protein 5 0.795 0.392 0.286 1.4e-36
TAIR|locus:2086979 890 RLP42 "receptor like protein 4 0.906 0.448 0.284 3.1e-36
TAIR|locus:2825389 784 RLP11 "AT1G71390" [Arabidopsis 0.975 0.547 0.298 7.6e-36
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 293 (108.2 bits), Expect = 1.2e-46, Sum P(2) = 1.2e-46
 Identities = 79/243 (32%), Positives = 126/243 (51%)

Query:   199 LNL-GNLAKLDLSYNS-LAVDESSRNYSFSPMLELLNLASCKLREIPN-LKNQSQLQYLY 255
             LN+  +L +L   Y S + +  ++    F   LE L+L SC + + P  ++    LQ L 
Sbjct:   488 LNVFSSLKQLGTLYISRIPISTTNITSDFPSNLEYLSLRSCNITDFPEFIRKGRNLQILD 547

Query:   256 LSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPA-----LRFIDLSSHQLR 310
             LS N+I  ++P+W+WR+    L+ ++LS+N L GF    S+ A     L  +DLSS+  +
Sbjct:   548 LSNNKIKGQVPDWLWRMPT--LNSVDLSNNSLSGFH--VSVKASPESQLTSVDLSSNAFQ 603

Query:   311 GNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIPASLCNATTXX 370
             G +     +L Y   SNNNFT  IP      +  L     +NN L G +P  L    +  
Sbjct:   604 GPLFLPSKSLRYFSGSNNNFTGKIPRSICG-LSSLEILDLSNNNLNGSLPWCLETLMSSL 662

Query:   371 XXXXXXXXFMKKS--DAFLNCL-LQTLDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSD 427
                      +  S  + F+N   L++LD++ NR++G +P S+  C  LEVLN+G+N+ +D
Sbjct:   663 SDLDLRNNSLSGSLPEIFMNATKLRSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRIND 722

Query:   428 KFP 430
              FP
Sbjct:   723 MFP 725


GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2046535 RLP28 "receptor like protein 28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119445 AT4G13820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00001339001
SubName- Full=Chromosome chr8 scaffold_115, whole genome shotgun sequence; (1074 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  159 bits (403), Expect = 4e-42
 Identities = 144/432 (33%), Positives = 208/432 (48%), Gaps = 65/432 (15%)

Query: 3   WRQSTDCCDWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGT 62
           W  S D C W G+ C+ +  V+ +DLS ++ISG I  ++++F L Y++++NL+    +G 
Sbjct: 51  WNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKI--SSAIFRLPYIQTINLSNNQLSG- 107

Query: 63  QIPSKLANIS-SLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLL 121
            IP  +   S SL YLNLS+  F G IP    S+  L  LD S N  SG I +       
Sbjct: 108 PIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPN-DIGSFS 164

Query: 122 NLVYAVLSDNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTS 181
           +L    L  N L G IP S+         + ++L+ L L+ N+L G IP  + ++K L  
Sbjct: 165 SLKVLDLGGNVLVGKIPNSL--------TNLTSLEFLTLASNQLVGQIPRELGQMKSLKW 216

Query: 182 LLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLRE 241
           + L  NNL G +  + I  L +L  LDL YN+L                           
Sbjct: 217 IYLGYNNLSGEIPYE-IGGLTSLNHLDLVYNNLT------------------------GP 251

Query: 242 IP-NLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALR 300
           IP +L N   LQYL+L +N++S  IP  I+  S+  L  L+LS N L G      IP L 
Sbjct: 252 IPSSLGNLKNLQYLFLYQNKLSGPIPPSIF--SLQKLISLDLSDNSLSG-----EIPEL- 303

Query: 301 FIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAANNGLTGIIP 360
                       + QL N  I   FS NNFT  IP    + +PRL+     +N  +G IP
Sbjct: 304 ------------VIQLQNLEILHLFS-NNFTGKIPVALTS-LPRLQVLQLWSNKFSGEIP 349

Query: 361 ASLCNATTLSLLDLSNNSFMKKSDAFL--NCLLQTLDLNGNRLQGTVPKSIANCKMLEVL 418
            +L     L++LDLS N+   +    L  +  L  L L  N L+G +PKS+  C+ L  +
Sbjct: 350 KNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRV 409

Query: 419 NLGNNQFSDKFP 430
            L +N FS + P
Sbjct: 410 RLQDNSFSGELP 421


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 440
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
PLN03150623 hypothetical protein; Provisional 99.34
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.3
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.96
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.94
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.91
PLN03150623 hypothetical protein; Provisional 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.79
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.68
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.55
KOG4341483 consensus F-box protein containing LRR [General fu 98.55
KOG4341483 consensus F-box protein containing LRR [General fu 98.51
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.48
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.29
PRK15386 426 type III secretion protein GogB; Provisional 98.24
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.16
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.1
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.09
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
PRK15386 426 type III secretion protein GogB; Provisional 97.9
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.9
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.77
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.43
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.17
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.07
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.04
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.94
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.8
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.43
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.08
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 94.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.64
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.28
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.01
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.2
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.12
KOG4308 478 consensus LRR-containing protein [Function unknown 91.4
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.2
smart0037026 LRR Leucine-rich repeats, outliers. 91.2
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.35
KOG4308478 consensus LRR-containing protein [Function unknown 81.55
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 80.29
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.1e-45  Score=382.51  Aligned_cols=425  Identities=32%  Similarity=0.490  Sum_probs=229.0

Q ss_pred             CCCCCCCCCcceeeeeeCCCCceEEEeeccceeecccCCCccccccCCCCeEEecCCccCCCccccchh-cCCCCcEEEc
Q 045270            1 MQWRQSTDCCDWSGVDCDEAGHVIGLDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLA-NISSLTYLNL   79 (440)
Q Consensus         1 ~~w~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~l~~~~~-~l~~L~~L~l   79 (440)
                      ++|+...++|.|.||+|+..++|+.|+++++.+.+..+.  .+..+++|+.|++++|.+... +|..+. .+++|++|++
T Consensus        49 ~~w~~~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~--~~~~l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~L  125 (968)
T PLN00113         49 SNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISS--AIFRLPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNL  125 (968)
T ss_pred             CCCCCCCCCCcCcceecCCCCcEEEEEecCCCccccCCh--HHhCCCCCCEEECCCCccCCc-CChHHhccCCCCCEEEC
Confidence            369888999999999999878999999999998887765  788888999999888887654 555443 5666666666


Q ss_pred             ccCcccc----------------------CCcccccccccCceecCCCCcccCccchhhhcccccceEEEecCCccCCCC
Q 045270           80 SDAGFAG----------------------HIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSI  137 (440)
Q Consensus        80 ~~~~~~~----------------------~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~  137 (440)
                      ++|.+.+                      .+|..+.++++|++|++++|.+.+.++. .+..+++|++|++++|.+.+.+
T Consensus       126 s~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~-~~~~l~~L~~L~L~~n~l~~~~  204 (968)
T PLN00113        126 SNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN-SLTNLTSLEFLTLASNQLVGQI  204 (968)
T ss_pred             cCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCCh-hhhhCcCCCeeeccCCCCcCcC
Confidence            6655543                      4444455555555555555555433333 3455555555555555555555


Q ss_pred             CccccccccccccCcccccEEEcCCCccCCccccccccccCccEEeccccccccccchhhHhcCCCCcEEEcCCCccccc
Q 045270          138 PRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVD  217 (440)
Q Consensus       138 ~~~~~~l~~l~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~  217 (440)
                      |..+..+        ++|++|++++|.+.+..|..+..+++|++|++++|.+.+..+ ..+..+++|+.|++++|.+...
T Consensus       205 p~~l~~l--------~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p-~~l~~l~~L~~L~L~~n~l~~~  275 (968)
T PLN00113        205 PRELGQM--------KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIP-SSLGNLKNLQYLFLYQNKLSGP  275 (968)
T ss_pred             ChHHcCc--------CCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccC-hhHhCCCCCCEEECcCCeeecc
Confidence            5554443        456666666666555555556666666666666665543322 3455555555555555555433


Q ss_pred             CCccccCCccccceeecCCCCCC-CCCC-CcccCcccEEeccCcccccccCccccccc----------------------
Q 045270          218 ESSRNYSFSPMLELLNLASCKLR-EIPN-LKNQSQLQYLYLSENQISREIPNWIWRVS----------------------  273 (440)
Q Consensus       218 ~~~~~~~~~~~L~~L~l~~~~l~-~l~~-~~~~~~L~~L~l~~~~~~~~~~~~~~~~~----------------------  273 (440)
                      .+.. +..+++|+.|++++|.+. .+|. +..+++|+.|++++|.+.+..|..+....                      
T Consensus       276 ~p~~-l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~  354 (968)
T PLN00113        276 IPPS-IFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGK  354 (968)
T ss_pred             Cchh-HhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhC
Confidence            2222 334444555555555443 2222 34444444444444444443333332211                      


Q ss_pred             ccceeEEEccCcccccccCC--ccCCceeEEEcCCccccCcccC---CCCCccEEEccCCcccccCCccccccCCCcceE
Q 045270          274 VVGLHCLNLSHNLLVGFQGP--YSIPALRFIDLSSHQLRGNIHQ---LPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYF  348 (440)
Q Consensus       274 ~~~L~~L~l~~~~~~~~~~~--~~~~~L~~L~l~~~~~~~~~~~---~~~~L~~L~L~~~~~~~~~~~~~~~~~~~L~~L  348 (440)
                      .++|+.|++++|.+....+.  ..+++++.+++.+|.+.+..+.   .+++|+.|++++|.+.+.+|..+.. ++.|+.|
T Consensus       355 ~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~-l~~L~~L  433 (968)
T PLN00113        355 HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTK-LPLVYFL  433 (968)
T ss_pred             CCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhc-CCCCCEE
Confidence            12244444444433221111  1122333333333333222211   1234445555555444444433332 4444444


Q ss_pred             ecccccccccchhhhhccC-----------------------CCCEEEcCCCcCCCC-Cchhh-hccccEEECCCCcccC
Q 045270          349 CAANNGLTGIIPASLCNAT-----------------------TLSLLDLSNNSFMKK-SDAFL-NCLLQTLDLNGNRLQG  403 (440)
Q Consensus       349 ~l~~~~l~~~~~~~~~~~~-----------------------~L~~L~l~~n~i~~~-~~~~~-~~~L~~L~l~~n~~~~  403 (440)
                      ++++|.+.+..+..+..++                       +|+.|++++|.+... +..+. ..+|+.|++++|.+.+
T Consensus       434 ~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~  513 (968)
T PLN00113        434 DISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSG  513 (968)
T ss_pred             ECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCccee
Confidence            4444444444443333344                       444444444444433 22211 2346666666666666


Q ss_pred             CchhhhhcCCCCcEEECCCCcccccCcccccCCCCCC
Q 045270          404 TVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSLH  440 (440)
Q Consensus       404 ~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~~~~L~  440 (440)
                      ..|+.+.++++|+.|++++|.+++.+|..+.++++|+
T Consensus       514 ~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~  550 (968)
T PLN00113        514 EIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLS  550 (968)
T ss_pred             eCChHHcCccCCCEEECCCCcccccCChhHhCcccCC
Confidence            6666666666677777777776666666666666553



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-16
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-07
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 70.1 bits (170), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 126/501 (25%), Positives = 199/501 (39%), Gaps = 101/501 (20%) Query: 2 QWRQSTDCCDWSGVDCDEAGHVIGLDLSTESISGG-----------------------IE 38 W + + C + GV C + V +DLS++ ++ G I Sbjct: 32 DWSSNKNPCTFDGVTCRDD-KVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHIN 90 Query: 39 NAASLFSLHY-LRSLNLARTSFNG-TQIPSKLANISSLTYLNLSD--AGFAGHIPLQISS 94 + S F L SL+L+R S +G + L + S L +LN+S F G + + Sbjct: 91 GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLK- 149 Query: 95 MARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFXXXXXXX 154 + L LD S N SG+ N+V VLSD G + Sbjct: 150 LNSLEVLDLSANSISGA----------NVVGWVLSDGC--GELKH--------------- 182 Query: 155 XXXXXXXGNRLRGSIPVSVFEXXXXXXXXXXXXXXHGTVQLDKILNLGNLAKLDLSYNSL 214 GN++ G + VS + + + + + L LD+S N L Sbjct: 183 ---LAISGNKISGDVDVS----RCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKL 235 Query: 215 AVDESSRNYSFSPMLELLNLASCK-LREIPNLKNQSQLQYLYLSENQISREIPNWIWRVS 273 + D SR S L+LLN++S + + IP L +S LQYL L+EN+ + EIP+++ Sbjct: 236 SGD-FSRAISTCTELKLLNISSNQFVGPIPPLPLKS-LQYLSLAENKFTGEIPDFLSGAC 293 Query: 274 VVGLHCLNLSHNLLVGFQGPY---------------------------SIPALRFIDLSS 306 L L+LS N G P+ + L+ +DLS Sbjct: 294 DT-LTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF 352 Query: 307 HQLRGNIHQ----LPNNLIYIDFSNNNFTSSI-PADTGNFMPRLRYFCAANNGLTGIIPA 361 ++ G + + L +L+ +D S+NNF+ I P N L+ NNG TG IP Sbjct: 353 NEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP 412 Query: 362 SLCNATTXXXXXXXXXXFMKKSDAFLNCL--LQTLDLNGNRLQGTVPKSIANCKMLEVLN 419 +L N + + L L L+ L L N L+G +P+ + K LE L Sbjct: 413 TLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 472 Query: 420 LGNNQFSDKFPCWLYDAPSLH 440 L N + + P L + +L+ Sbjct: 473 LDFNDLTGEIPSGLSNCTNLN 493
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-74
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-73
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-63
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-60
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-56
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-53
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-47
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-34
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-29
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-20
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-40
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-40
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-45
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-40
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-37
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-35
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-40
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-39
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-38
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-29
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-31
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-27
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-25
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-19
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-21
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-13
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-09
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  245 bits (628), Expect = 6e-74
 Identities = 121/498 (24%), Positives = 183/498 (36%), Gaps = 99/498 (19%)

Query: 3   WRQSTDCCDWSGVDCDEAGHVIG------------------------------------- 25
           W  + + C + GV C     V                                       
Sbjct: 33  WSSNKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHING 91

Query: 26  -------------LDLSTESISGGIENAASLFSLHYLRSLNLARTSFNGTQIPSKLANIS 72
                        LDLS  S+SG +    SL S   L+ LN++  + +     S    ++
Sbjct: 92  SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLN 151

Query: 73  SLTYLNLSDAGFAGHIPLQI---SSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLS 129
           SL  L+LS    +G   +          L  L  S N+ SG +        +NL +  +S
Sbjct: 152 SLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV---SRCVNLEFLDVS 208

Query: 130 DNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNL 189
            N+ +  IP              SAL  LD+SGN+L G    ++    +L  L +SSN  
Sbjct: 209 SNNFSTGIP---------FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQF 259

Query: 190 HGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELLNLASCKLR-EIPN-LKN 247
            G +       L +L  L L+ N    +           L  L+L+       +P    +
Sbjct: 260 VGPIPPL---PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGS 316

Query: 248 QSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQGPYSIPALRFIDLSSH 307
            S L+ L LS N  S E+P       + GL  L+LS N   G      +P          
Sbjct: 317 CSLLESLALSSNNFSGELPMDTLL-KMRGLKVLDLSFNEFSG-----ELPE--------- 361

Query: 308 QLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNF-MPRLRYFCAANNGLTGIIPASLCNA 366
               ++  L  +L+ +D S+NNF+  I  +        L+     NNG TG IP +L N 
Sbjct: 362 ----SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC 417

Query: 367 TTLSLLDLSNNSFMKKSDAFLNCL-----LQTLDLNGNRLQGTVPKSIANCKMLEVLNLG 421
           + L  L LS N     S    + L     L+ L L  N L+G +P+ +   K LE L L 
Sbjct: 418 SELVSLHLSFNYL---SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD 474

Query: 422 NNQFSDKFPCWLYDAPSL 439
            N  + + P  L +  +L
Sbjct: 475 FNDLTGEIPSGLSNCTNL 492


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.56
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.43
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.43
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.38
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.28
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.28
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.2
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.98
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.92
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.9
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.76
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.71
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.48
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.38
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.36
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.2
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.17
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.55
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-48  Score=395.02  Aligned_cols=424  Identities=29%  Similarity=0.370  Sum_probs=232.7

Q ss_pred             CCCCCCCCCcceeeeeeCCCCceEEEeeccceeecc---cCC---------------------CccccccCCCCeEEecC
Q 045270            1 MQWRQSTDCCDWSGVDCDEAGHVIGLDLSTESISGG---IEN---------------------AASLFSLHYLRSLNLAR   56 (440)
Q Consensus         1 ~~w~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~---~~~---------------------~~~~~~l~~L~~L~l~~   56 (440)
                      ++|+.+++||.|.||+|+ .++|+.|+|+++.+.|.   +++                     ...+..+++|++|++++
T Consensus        31 ~~W~~~~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~  109 (768)
T 3rgz_A           31 PDWSSNKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSR  109 (768)
T ss_dssp             TTCCTTSCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCS
T ss_pred             cCCCCCCCCcCCcceEEC-CCcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCC
Confidence            479988999999999998 68999999999988775   432                     01456666666666666


Q ss_pred             CccCCCcccc--chhcCCCCcEEEcccCccccCCcccc-cccccCceecCCCCcccCccchhh--hcccccceEEEecCC
Q 045270           57 TSFNGTQIPS--KLANISSLTYLNLSDAGFAGHIPLQI-SSMARLVALDFSFNQFSGSISSIR--WEHLLNLVYAVLSDN  131 (440)
Q Consensus        57 ~~~~~~~l~~--~~~~l~~L~~L~l~~~~~~~~~~~~~-~~l~~L~~L~L~~~~~~~~~~~~~--~~~l~~L~~L~l~~~  131 (440)
                      |.+.+. +|.  .++++++|++|++++|.+.+..|..+ .++++|++|++++|.+.+..+...  +..+++|++|++++|
T Consensus       110 n~l~~~-~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n  188 (768)
T 3rgz_A          110 NSLSGP-VTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGN  188 (768)
T ss_dssp             SEEEEE-GGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSS
T ss_pred             CcCCCc-CCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCC
Confidence            666543 454  56666666666666666665555544 566666677776666664443321  455556666666665


Q ss_pred             ccCCCCCccccccccccccCcccccEEEcCCCccCCccccccccccCccEEeccccccccccchhhHhcCCCCcEEEcCC
Q 045270          132 SLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSY  211 (440)
Q Consensus       132 ~~~~~~~~~~~~l~~l~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~  211 (440)
                      .+.+..+.          ..+++|++|++++|.+.+..|. +..+++|++|++++|.+.+. .+..+..+++|+.|++++
T Consensus       189 ~l~~~~~~----------~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~-~~~~l~~l~~L~~L~Ls~  256 (768)
T 3rgz_A          189 KISGDVDV----------SRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGD-FSRAISTCTELKLLNISS  256 (768)
T ss_dssp             EEESCCBC----------TTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSC-HHHHTTTCSSCCEEECCS
T ss_pred             cccccCCc----------ccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCc-ccHHHhcCCCCCEEECCC
Confidence            55433322          2335666666666666544444 56666666666666665522 233455566666666666


Q ss_pred             Cccccc----------------------CCccccCCccccceeecCCCCCC-CCCC-CcccCcccEEeccCcccccccCc
Q 045270          212 NSLAVD----------------------ESSRNYSFSPMLELLNLASCKLR-EIPN-LKNQSQLQYLYLSENQISREIPN  267 (440)
Q Consensus       212 ~~~~~~----------------------~~~~~~~~~~~L~~L~l~~~~l~-~l~~-~~~~~~L~~L~l~~~~~~~~~~~  267 (440)
                      |.+...                      .+......+++|+.|++++|.++ .+|. +..+++|+.|++++|.+.+.+|.
T Consensus       257 n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~  336 (768)
T 3rgz_A          257 NQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPM  336 (768)
T ss_dssp             SCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCH
T ss_pred             CcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCH
Confidence            555432                      22222222355555555555554 2333 55555566666666655544443


Q ss_pred             c-cccccccceeEEEccCcccccccC-C-ccCC-ceeEEEcCCccccCcccCC-----CCCccEEEccCCcccccCCccc
Q 045270          268 W-IWRVSVVGLHCLNLSHNLLVGFQG-P-YSIP-ALRFIDLSSHQLRGNIHQL-----PNNLIYIDFSNNNFTSSIPADT  338 (440)
Q Consensus       268 ~-~~~~~~~~L~~L~l~~~~~~~~~~-~-~~~~-~L~~L~l~~~~~~~~~~~~-----~~~L~~L~L~~~~~~~~~~~~~  338 (440)
                      . +.  ..++|++|++++|.+....+ . ..++ +|++|++++|.+.+..+..     +++|++|++++|.+.+.+|..+
T Consensus       337 ~~l~--~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l  414 (768)
T 3rgz_A          337 DTLL--KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL  414 (768)
T ss_dssp             HHHT--TCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGG
T ss_pred             HHHh--cCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHH
Confidence            3 32  23346666666665542211 1 1222 4555555544443221111     2334444444444443444333


Q ss_pred             cc-----------------------cCCCcceEecccccccccchhhhhccCCCCEEEcCCCcCCCC-Cchhh-hccccE
Q 045270          339 GN-----------------------FMPRLRYFCAANNGLTGIIPASLCNATTLSLLDLSNNSFMKK-SDAFL-NCLLQT  393 (440)
Q Consensus       339 ~~-----------------------~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n~i~~~-~~~~~-~~~L~~  393 (440)
                      ..                       .+++|+.|++++|.+.+..|..+..+++|++|++++|.+... |..+. .++|+.
T Consensus       415 ~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~  494 (768)
T 3rgz_A          415 SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNW  494 (768)
T ss_dssp             GGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             hcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCE
Confidence            33                       144445555555544444444555555555555555555433 32222 233666


Q ss_pred             EECCCCcccCCchhhhhcCCCCcEEECCCCcccccCcccccCCCCCC
Q 045270          394 LDLNGNRLQGTVPKSIANCKMLEVLNLGNNQFSDKFPCWLYDAPSLH  440 (440)
Q Consensus       394 L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~~~~L~  440 (440)
                      |++++|++.+.+|..++.+++|+.|++++|++++.+|..++++++|+
T Consensus       495 L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~  541 (768)
T 3rgz_A          495 ISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLI  541 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCC
T ss_pred             EEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCC
Confidence            66666666655565666666666666666666666666666555553



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 440
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-09
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 77.0 bits (188), Expect = 5e-16
 Identities = 66/372 (17%), Positives = 123/372 (33%), Gaps = 15/372 (4%)

Query: 52  LNLARTSFNGTQIPSKLANISSLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGS 111
             L +T+   T   + L  +++L    L      G     +  +  L  ++FS NQ +  
Sbjct: 27  TVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDG-----VEYLNNLTQINFSNNQLTDI 81

Query: 112 ISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFSNASSSALDTLDLSGNRLRGSIPV 171
                   L++++        +      +        N   + +D L    N  R  +  
Sbjct: 82  TPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSS 141

Query: 172 SVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLEL 231
           +        S L S   L    Q+  +  L NL  L+    S          +    LE 
Sbjct: 142 NTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLES 201

Query: 232 LNLASCKLREIPNLKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNLLVGFQ 291
           L   + ++ +I  L   + L  L L+ NQ+     +     S+  L  L+L++N +    
Sbjct: 202 LIATNNQISDITPLGILTNLDELSLNGNQLK----DIGTLASLTNLTDLDLANNQISNLA 257

Query: 292 GPYSIPALRFIDLSSHQLRGNIHQLPNNLIYIDFSNNNFTSSIPADTGNFMPRLRYFCAA 351
               +  L  + L ++Q+          L  +     N          + +  L Y    
Sbjct: 258 PLSGLTKLTELKLGANQISNISPL--AGLTALTNLELNENQLEDISPISNLKNLTYLTLY 315

Query: 352 NNGLTGIIPASLCNATTLSLLDLSNNSFMKKSDAFLNCLLQTLDLNGNRLQGTVPKSIAN 411
            N ++ I P  + + T L  L  +NN     S       +  L    N++    P  +AN
Sbjct: 316 FNNISDISP--VSSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQISDLTP--LAN 371

Query: 412 CKMLEVLNLGNN 423
              +  L L + 
Sbjct: 372 LTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.05
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.73
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.69
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.16
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=1.5e-30  Score=233.66  Aligned_cols=268  Identities=32%  Similarity=0.488  Sum_probs=216.0

Q ss_pred             CCCCCCCCCcc--eeeeeeCCC---CceEEEeeccceeecc--cCCCccccccCCCCeEEecC-CccCCCccccchhcCC
Q 045270            1 MQWRQSTDCCD--WSGVDCDEA---GHVIGLDLSTESISGG--IENAASLFSLHYLRSLNLAR-TSFNGTQIPSKLANIS   72 (440)
Q Consensus         1 ~~w~~~~~~~~--~~~~~~~~~---~~l~~L~l~~~~~~~~--~~~~~~~~~l~~L~~L~l~~-~~~~~~~l~~~~~~l~   72 (440)
                      ++|..++|+|.  |.||+|+..   .||++|+|+++.+.+.  +|.  +++++++|++|++++ |.+.+. +|..|++++
T Consensus        25 ~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~--~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~  101 (313)
T d1ogqa_          25 SSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS--SLANLPYLNFLYIGGINNLVGP-IPPAIAKLT  101 (313)
T ss_dssp             TTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG--GGGGCTTCSEEEEEEETTEESC-CCGGGGGCT
T ss_pred             CCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCCh--HHhcCccccccccccccccccc-ccccccccc
Confidence            47999999995  999999865   4899999999999874  445  899999999999987 566655 899999999


Q ss_pred             CCcEEEcccCccccCCcccccccccCceecCCCCcccCccchhhhcccccceEEEecCCccCCCCCccccccccccccCc
Q 045270           73 SLTYLNLSDAGFAGHIPLQISSMARLVALDFSFNQFSGSISSIRWEHLLNLVYAVLSDNSLNGSIPRSMFEFPIFSNASS  152 (440)
Q Consensus        73 ~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~~~~  152 (440)
                      +|++|++++|.+.+..+..+..++.|+++++++|.+.+.++. .+..+++++.+++++|.+.+.+|..+..+.       
T Consensus       102 ~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~-~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~-------  173 (313)
T d1ogqa_         102 QLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPP-SISSLPNLVGITFDGNRISGAIPDSYGSFS-------  173 (313)
T ss_dssp             TCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCG-GGGGCTTCCEEECCSSCCEEECCGGGGCCC-------
T ss_pred             ccchhhhccccccccccccccchhhhcccccccccccccCch-hhccCcccceeecccccccccccccccccc-------
Confidence            999999999999988888899999999999999998866665 589999999999999999888998887664       


Q ss_pred             ccccEEEcCCCccCCccccccccccCccEEeccccccccccchhhHhcCCCCcEEEcCCCcccccCCccccCCcccccee
Q 045270          153 SALDTLDLSGNRLRGSIPVSVFELKKLTSLLLSSNNLHGTVQLDKILNLGNLAKLDLSYNSLAVDESSRNYSFSPMLELL  232 (440)
Q Consensus       153 ~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L  232 (440)
                      ..++.+++++|.+.+..+..+..+..+ .+++..+...+..+ ..+..+++++.+++.++.+....+  .+..+++++.|
T Consensus       174 ~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~-~~~~~~~~l~~l~~~~~~l~~~~~--~~~~~~~L~~L  249 (313)
T d1ogqa_         174 KLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDAS-VLFGSDKNTQKIHLAKNSLAFDLG--KVGLSKNLNGL  249 (313)
T ss_dssp             TTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCG-GGCCTTSCCSEEECCSSEECCBGG--GCCCCTTCCEE
T ss_pred             ccccccccccccccccccccccccccc-cccccccccccccc-cccccccccccccccccccccccc--ccccccccccc
Confidence            345889999999887777777665444 68888887764443 456778889999999988765433  25667888888


Q ss_pred             ecCCCCCC-CCCC-CcccCcccEEeccCcccccccCcccccccccceeEEEccCcc
Q 045270          233 NLASCKLR-EIPN-LKNQSQLQYLYLSENQISREIPNWIWRVSVVGLHCLNLSHNL  286 (440)
Q Consensus       233 ~l~~~~l~-~l~~-~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  286 (440)
                      ++++|+++ .+|. +..+++|+.|++++|+++|.+|.. .  ...+|+.+++++|.
T Consensus       250 ~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~-~--~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         250 DLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-G--NLQRFDVSAYANNK  302 (313)
T ss_dssp             ECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-T--TGGGSCGGGTCSSS
T ss_pred             cCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc-c--cCCCCCHHHhCCCc
Confidence            88888887 6776 888888888888888888777742 1  22335556666554



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure