Citrus Sinensis ID: 045291


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680--
YGGLRKLKSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLPLPICISPATMPEASIGNEQDDNLIDMDSFFITFTTSYIIVIFGIVIVLYVNSYWRRRWFYFVEMWITSCSYFVVNNLIATRYCH
ccccccccEEEcccccccccccccccccccccccEEEccccccccccccccHHHcccccccEEEccccccccccHHHHHHccccccEEEccccccccccccccccccccccEEEcccccccccccccHHHHHccccccEEEcccccccccccccccHHHcccccccEEEcccccccccccHHcccccccccccccccccEEEcccccccccccccEEEccccEEEEEcccccccccccccEEEccccEEEEEcccccccccccccccEEEccccccccccccccccccccccEEEEEcccccccccHHHHHccccccEEEccccEEEccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEccccccccccccHHHHccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcEEEEEEEccccccccc
cccccccEEEEcccccccccccccHHHcccccccEEEccccccccccccccHHHccccccEEEEEccccccccccHHHHHHHHHccEEEcccccccccccHHHHHHcccccEEEEccccccccccccHHHHcccccccEEEEccccccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEEccccccccccHHHHcccccccEEEEccccccccccHHHccccccccEEEEEcccccccccccHHHHccccccEEEEEccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHccEEEcccc
ygglrklksfglsgvgirdgskllqsmgsfpslntldlsynnftDIAITTTQElhnftnleyltldESSLHISLLQSIASLFpslknlsisycevngvlrgqgfpsfksLEHLHMSFAPIALNTSFLQIIGEsmpslkylslsgsilgtnssrilDQGLCSLVHLQELRmadndlrgslpwclaNMTSLRILDVSfnqltgsisssplvhlTSIEMLilsdnhfqipisleplfnhsrlkifyadnnelnaeitqshsltapnfqLNRLLlsssygdgfifpkflyhqhdlefvdlshikmngefptwllennaKLETLFLIndsiggpfrlpihphrrlrfldvsnnnfqghmpveigdilpslfsfnistnalhgsipssfgnmkFLQILDlsnnhltgeipeyLAVGCVNLNSLALsnnnlqghmfsrnfnltNLKWLLLEgnrfvgeipqslskcssleglylnnnslsgkiprwlgnltrlqyiimpnnhlegpipvefcQLDLLQildisdnnisgrlipstfsnlkQIESLDLSYnklngkmphqlVELKTLEVFSVAYNNlsgeipewTAQFATfnessyegniflcglplpicispatmpeasigneqddnlidmdSFFITFTTSYIIVIFGIVIVLYVNSYWRRRWFYFVEMWITSCSYFVVNNLIATRYCH
ygglrklksfglsgvGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLPLPICISPATMPEASIGNEQDDNLIDMDSFFITFTTSYIIVIFGIVIVLYVNSYWRRRWFYFVEMWITSCSYFVVNNLIATRYCH
YGGLRKLKSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVnlnslalsnnnlQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCqldllqildiSDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLPLPICISPATMPEASIGNEQDDNLIDMDSFFITFTTSYIIVIFGIVIVLYVNSYWRRRWFYFVEMWITSCSYFVVNNLIATRYCH
***********LSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLPLPICISPATMPEASIG**QDDNLIDMDSFFITFTTSYIIVIFGIVIVLYVNSYWRRRWFYFVEMWITSCSYFVVNNLIATRYC*
YGGLRKLKSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGL***************************DSFFITFTTSYIIVIFGIVIVLYVNSYWRRRWFYFVEMWITSCSYFVVNNLIATRYC*
YGGLRKLKSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLPLPICISPATMPEASIGNEQDDNLIDMDSFFITFTTSYIIVIFGIVIVLYVNSYWRRRWFYFVEMWITSCSYFVVNNLIATRYCH
*GGLRKLKSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLPLPICISPATMPEASIGNEQDDNLIDMDSFFITFTTSYIIVIFGIVIVLYVNSYWRRRWFYFVEMWITSCSYFVVNNLIATRYCH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YGGLRKLKSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLPLPICISPATMPEASIGNEQDDNLIDMDSFFITFTTSYIIVIFGIVIVLYVNSYWRRRWFYFVEMWITSCSYFVVNNLIATRYCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query682 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.793 0.432 0.313 3e-52
C0LGQ5 1249 LRR receptor-like serine/ no no 0.856 0.467 0.301 7e-50
C0LGS2 1136 Probable LRR receptor-lik no no 0.824 0.494 0.302 3e-46
Q9FL28 1173 LRR receptor-like serine/ no no 0.589 0.342 0.340 4e-46
Q9LYN8 1192 Leucine-rich repeat recep no no 0.851 0.487 0.291 2e-41
Q9LRT1 1016 Probably inactive leucine no no 0.717 0.481 0.283 3e-41
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.953 0.538 0.289 4e-41
Q9LVP0 1102 Probable leucine-rich rep no no 0.778 0.481 0.285 5e-41
Q9ZPS9 1143 Serine/threonine-protein no no 0.853 0.509 0.296 1e-40
O65440 992 Leucine-rich repeat recep no no 0.791 0.544 0.296 1e-40
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  207 bits (526), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 200/637 (31%), Positives = 309/637 (48%), Gaps = 96/637 (15%)

Query: 25  QSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPS 84
           + +    +L TLDLS NN T +     +E      LE+L L ++ L  SL ++I S   S
Sbjct: 282 KRLTELANLQTLDLSSNNLTGV---IHEEFWRMNQLEFLVLAKNRLSGSLPKTICSNNTS 338

Query: 85  LKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSG 144
           LK L +S  +++G +                   P  ++         +  SLK L LS 
Sbjct: 339 LKQLFLSETQLSGEI-------------------PAEIS---------NCQSLKLLDLSN 370

Query: 145 SILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSIS 204
           + L   + +I D  L  LV L  L + +N L G+L   ++N+T+L+   +  N L G + 
Sbjct: 371 NTL---TGQIPDS-LFQLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVP 426

Query: 205 SSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNF 264
              +  L  +E++ L +N F   + +E + N +RL+      N L+ EI  S        
Sbjct: 427 KE-IGFLGKLEIMYLYENRFSGEMPVE-IGNCTRLQEIDWYGNRLSGEIPSSIGRLK--- 481

Query: 265 QLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPT----------WLLENNA 314
            L RL L  +   G I P  L + H +  +DL+  +++G  P+          +++ NN+
Sbjct: 482 DLTRLHLRENELVGNI-PASLGNCHQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNS 540

Query: 315 ----------KLETLFLINDSIGGPFRLPIHP----HRRLRFLDVSNNNFQGHMPVEIGD 360
                      L+ L  IN S    F   I P       L F DV+ N F+G +P+E+G 
Sbjct: 541 LQGNLPDSLINLKNLTRINFS-SNKFNGSISPLCGSSSYLSF-DVTENGFEGDIPLELGK 598

Query: 361 ----------------ILPSLFS-------FNISTNALHGSIPSSFGNMKFLQILDLSNN 397
                            +P  F         +IS N+L G IP   G  K L  +DL+NN
Sbjct: 599 STNLDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNN 658

Query: 398 HLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLS 457
           +L+G IP +L    + L  L LS+N   G + +  F+LTN+  L L+GN   G IPQ + 
Sbjct: 659 YLSGVIPTWLGKLPL-LGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIG 717

Query: 458 KCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCQL-DLLQILDIS 516
              +L  L L  N LSG +P  +G L++L  + +  N L G IPVE  QL DL   LD+S
Sbjct: 718 NLQALNALNLEENQLSGPLPSTIGKLSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLS 777

Query: 517 DNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEW 576
            NN +GR IPST S L ++ESLDLS+N+L G++P Q+ ++K+L   +++YNNL G++ + 
Sbjct: 778 YNNFTGR-IPSTISTLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKLKK- 835

Query: 577 TAQFATFNESSYEGNIFLCGLPLPICISPATMPEASI 613
             QF+ +   ++ GN  LCG PL  C    +  + S+
Sbjct: 836 --QFSRWQADAFVGNAGLCGSPLSHCNRAGSKNQRSL 870




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query682
224102049577 predicted protein [Populus trichocarpa] 0.752 0.889 0.490 1e-137
224120284 929 predicted protein [Populus trichocarpa] 0.948 0.696 0.4 1e-119
255581263 912 serine-threonine protein kinase, plant-t 0.681 0.509 0.492 1e-119
224134597 947 predicted protein [Populus trichocarpa] 0.906 0.652 0.394 1e-115
224144186 973 predicted protein [Populus trichocarpa] 0.920 0.645 0.394 1e-113
224134609676 predicted protein [Populus trichocarpa] 0.854 0.862 0.402 1e-111
224142723 923 predicted protein [Populus trichocarpa] 0.885 0.654 0.383 1e-109
224142721 926 predicted protein [Populus trichocarpa] 0.925 0.681 0.371 1e-109
224106948658 predicted protein [Populus trichocarpa] 0.819 0.849 0.407 1e-109
224142717 876 predicted protein [Populus trichocarpa] 0.888 0.691 0.392 1e-108
>gi|224102049|ref|XP_002334215.1| predicted protein [Populus trichocarpa] gi|222870030|gb|EEF07161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  494 bits (1273), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 281/573 (49%), Positives = 361/573 (63%), Gaps = 60/573 (10%)

Query: 159 LCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLI 218
           LC L  LQEL ++ N++ GSLP C +N+T+L+ LD+SFN  TG+IS SP+  LTSI  L 
Sbjct: 7   LCELKQLQELDISYNNITGSLPSCFSNLTNLQALDISFNHFTGNISLSPIGSLTSIRDLN 66

Query: 219 LSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDG 278
           LSDNHFQIPISL P FN S LK    D NEL       H+L  P FQL RL L+ + G G
Sbjct: 67  LSDNHFQIPISLGPFFNLSNLKNLNGDRNELYESTELVHNLI-PRFQLQRLSLAYT-GSG 124

Query: 279 FIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHR 338
             F K LY+QHDL+FVDLSHIKM GEFP+WLL+NN KLE L+L+N+S  G F+L  H   
Sbjct: 125 GTFLKSLYYQHDLQFVDLSHIKMTGEFPSWLLQNNTKLEELYLVNNSFSGSFQLANHSLD 184

Query: 339 RLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNH 398
           RL  LD+S N+    +P EIG   P L   N+S N   GSIPSS  NM  L+ILDLSNN 
Sbjct: 185 RLSHLDISRNHIHNQIPTEIGACFPRLVFLNLSRNDFGGSIPSSISNMSSLEILDLSNNE 244

Query: 399 LTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSK 458
           L+G IPE+L   C++L  L LSNN+L+G  F RNFNL  L  L+L GN+  G +P SLS 
Sbjct: 245 LSGNIPEHLVEDCLSLRGLVLSNNHLKGQFFWRNFNLAYLTDLILSGNQLTGILPNSLSN 304

Query: 459 CSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFC------------- 505
            S LE L ++ N+LSGKIPRW+ N++ L+Y+ +  N+L G +P  FC             
Sbjct: 305 GSRLEALDVSLNNLSGKIPRWIRNMSSLEYLDLSENNLFGSLPSSFCSSMMMTEVYLSKN 364

Query: 506 -----------------QLDL------------------LQILDISDNNISGRLIPSTFS 530
                            +LDL                  +Q+L++S N+++G  IP TFS
Sbjct: 365 KLEGSLIDAFDGCLSLNKLDLSHNSLTGEIPFKLGYLGNIQVLNLSHNSLTGP-IPPTFS 423

Query: 531 NLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEG 590
           NLK+IESLD+SYN LNG++P+QLV+L +L  FSVAYNNLSG+ PE  AQFATFN SSYEG
Sbjct: 424 NLKKIESLDISYNNLNGEIPYQLVDLDSLSAFSVAYNNLSGKTPERAAQFATFNRSSYEG 483

Query: 591 NIFLCGLPLPICISPATMPE--ASIGNEQDDNLIDMDSFFITFTTSYIIVIFGIVIVLYV 648
           N  LCG PL    +   +P   +S G       IDM +F++TF+ +YII +  I  VLY+
Sbjct: 484 NPLLCGPPLTNNCTGEILPSPLSSYG------FIDMQAFYVTFSVAYIINLLAIGAVLYI 537

Query: 649 NSYWRRRWFYFVEMWITSCSYFVVNNL-IATRY 680
           N +WRR WFYF+   I +C YF+V+NL +  R+
Sbjct: 538 NPHWRRAWFYFIRESINNCYYFLVDNLHVPARF 570




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224134597|ref|XP_002327443.1| predicted protein [Populus trichocarpa] gi|222835997|gb|EEE74418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144186|ref|XP_002336117.1| predicted protein [Populus trichocarpa] gi|222873047|gb|EEF10178.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134609|ref|XP_002327446.1| predicted protein [Populus trichocarpa] gi|222836000|gb|EEE74421.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142723|ref|XP_002324704.1| predicted protein [Populus trichocarpa] gi|222866138|gb|EEF03269.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142721|ref|XP_002324703.1| predicted protein [Populus trichocarpa] gi|222866137|gb|EEF03268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106948|ref|XP_002333588.1| predicted protein [Populus trichocarpa] gi|222837496|gb|EEE75875.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142717|ref|XP_002324701.1| predicted protein [Populus trichocarpa] gi|222866135|gb|EEF03266.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query682
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.856 0.539 0.333 2e-69
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.846 0.597 0.328 5.6e-68
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.831 0.567 0.331 3.4e-64
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.868 0.651 0.317 3.5e-61
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.774 0.592 0.329 9.8e-61
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.837 0.585 0.314 1.2e-57
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.824 0.601 0.306 2.8e-52
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.804 0.438 0.310 3.9e-50
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.895 0.489 0.285 6.3e-47
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.803 0.482 0.291 2.8e-46
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 709 (254.6 bits), Expect = 2.0e-69, P = 2.0e-69
 Identities = 207/620 (33%), Positives = 309/620 (49%)

Query:     5 RKLKSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLT 64
             R L+   LS  G+ D S+   S+ S   L TLDL++N  +D +    + L +   L+ L 
Sbjct:   184 RDLEVLDLSFNGVND-SEASHSL-STAKLKTLDLNFNPLSDFS--QLKGLESLQELQVLK 239

Query:    65 LDESSLHISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNT 124
             L  +  + +L   +      L+ L +S      +  G+     +S +          + T
Sbjct:   240 LRGNKFNHTLSTHVLKDLKMLQELDLSDNGFTNLDHGRDVDESRSEKRFDFREVVQKVET 299

Query:   125 SFLQI---IGESMPSLKYLSLSGS-ILGTN---SSRILD----Q---------GLCSLVH 164
              ++ +      S+   K +++ G+  LG     S ++LD    Q         G+C L+ 
Sbjct:   300 LWIGLRLSFQMSITHHKSVTVGGNGFLGLEIPTSLQVLDFKRNQLSLTHEGYLGICRLMK 359

Query:   165 LQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSI-EMLILSDNH 223
             L+EL ++ N L  SLP+CL N+T LR LD+S NQL G++SS  +  L S+ E L L DN+
Sbjct:   360 LRELDLSSNALT-SLPYCLGNLTHLRTLDLSNNQLNGNLSSF-VSGLPSVLEYLSLLDNN 417

Query:   224 FQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSS-SYGDGFIFP 282
             F        L N +RL +F   ++++     Q+ S  AP FQL  L LS+ S G   +  
Sbjct:   418 FDGSFLFNSLVNQTRLTVFKL-SSKVGVIQVQTESSWAPLFQLKMLYLSNCSLGSTML-- 474

Query:   283 KFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRF 342
              FL HQ DL FVDLSH K+ G FPTWL++NN +L+T+ L  +S+    +LPI  H  L+ 
Sbjct:   475 GFLVHQRDLCFVDLSHNKLTGTFPTWLVKNNTRLQTILLSGNSLT-KLQLPILVHG-LQV 532

Query:   343 LDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGE 402
             LD+S+N     +  +IG + P+L   N S+N   G+IPSS G MK LQ+LD+S+N L G+
Sbjct:   533 LDISSNMIYDSIQEDIGMVFPNLRFMNFSSNHFQGTIPSSIGEMKSLQVLDMSSNGLYGQ 592

Query:   403 IPEYLAVGCVXXXXXXXXXXXXQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSL 462
             +P     GC             QG +FS++ NLT L  L L+GN F G + + L K  +L
Sbjct:   593 LPIMFLSGCYSLRVLKLSNNQLQGKIFSKHANLTGLVGLFLDGNNFTGSLEEGLLKSKNL 652

Query:   463 EGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLEGPIPVEFCXXXXXXXXXXSDNNISG 522
               L +++N  SG +P W+G ++RL Y+ M  N L+GP P              S N+ SG
Sbjct:   653 TLLDISDNRFSGMLPLWIGRISRLSYLYMSGNQLKGPFPF-LRQSPWVEVMDISHNSFSG 711

Query:   523 RLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFAT 582
               IP    N   +  L L  N+  G +P  L +   LEV  +  NN SG+I     Q + 
Sbjct:   712 S-IPRNV-NFPSLRELRLQNNEFTGLVPGNLFKAAGLEVLDLRNNNFSGKILNTIDQTSK 769

Query:   583 FNESSYEGNIFLCGLPLPIC 602
                     N F   +P  IC
Sbjct:   770 LRILLLRNNSFQTYIPGKIC 789


GO:0005575 "cellular_component" evidence=ND
GO:0007165 "signal transduction" evidence=IC
GO:0006457 "protein folding" evidence=RCA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.11450001
hypothetical protein (577 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query682
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-43
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-36
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  166 bits (422), Expect = 6e-43
 Identities = 166/579 (28%), Positives = 261/579 (45%), Gaps = 128/579 (22%)

Query: 22  KLLQSMGSFPSLNTLDLSYNNFT-DIAITTTQELHNFTNLEYLTLDESSLHISLLQSIAS 80
           ++   +GSF SL  LDL  N     I  + T    N T+LE+LTL  + L   + + +  
Sbjct: 155 EIPNDIGSFSSLKVLDLGGNVLVGKIPNSLT----NLTSLEFLTLASNQLVGQIPRELGQ 210

Query: 81  LFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYL 140
           +  SLK + + Y  ++G +  +      SL HL                       L Y 
Sbjct: 211 M-KSLKWIYLGYNNLSGEIPYE-IGGLTSLNHL----------------------DLVYN 246

Query: 141 SLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLT 200
           +L+G I            L +L +LQ L +  N L G +P  + ++  L  LD+S N L+
Sbjct: 247 NLTGPI---------PSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLS 297

Query: 201 GSISSSPLVHLTSIEMLILSDNHF--QIPISLEPLFNHSRLKIFYADNNELNAEITQSHS 258
           G I    ++ L ++E+L L  N+F  +IP++L  L    RL++    +N+ + EI     
Sbjct: 298 GEIPEL-VIQLQNLEILHLFSNNFTGKIPVALTSL---PRLQVLQLWSNKFSGEI----- 348

Query: 259 LTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLET 318
                                  PK L   ++L  +DLS   + GE P  L  +      
Sbjct: 349 -----------------------PKNLGKHNNLTVLDLSTNNLTGEIPEGLCSS------ 379

Query: 319 LFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGS 378
                                            G+           LF   + +N+L G 
Sbjct: 380 ---------------------------------GN-----------LFKLILFSNSLEGE 395

Query: 379 IPSSFGNMKFLQILDLSNNHLTGEIP-EYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTN 437
           IP S G  + L+ + L +N  +GE+P E+  +  V    L +SNNNLQG + SR +++ +
Sbjct: 396 IPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYF--LDISNNNLQGRINSRKWDMPS 453

Query: 438 LKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQYIIMPNNHLE 497
           L+ L L  N+F G +P S      LE L L+ N  SG +PR LG+L+ L  + +  N L 
Sbjct: 454 LQMLSLARNKFFGGLPDS-FGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLS 512

Query: 498 GPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELK 557
           G IP E      L  LD+S N +SG+ IP++FS +  +  LDLS N+L+G++P  L  ++
Sbjct: 513 GEIPDELSSCKKLVSLDLSHNQLSGQ-IPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVE 571

Query: 558 TLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCG 596
           +L   ++++N+L G +P  T  F   N S+  GNI LCG
Sbjct: 572 SLVQVNISHNHLHGSLPS-TGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 682
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.35
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.25
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.13
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
PLN03150623 hypothetical protein; Provisional 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.04
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.78
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.69
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.59
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.55
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.54
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.47
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.29
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.29
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.23
KOG4341483 consensus F-box protein containing LRR [General fu 98.13
KOG4341483 consensus F-box protein containing LRR [General fu 98.09
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.9
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.83
PRK15386426 type III secretion protein GogB; Provisional 97.76
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.75
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.74
PRK15386426 type III secretion protein GogB; Provisional 97.68
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.62
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.13
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.06
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.04
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.03
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.63
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.39
KOG4308478 consensus LRR-containing protein [Function unknown 95.84
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.28
KOG4308478 consensus LRR-containing protein [Function unknown 93.99
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.85
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.32
smart0037026 LRR Leucine-rich repeats, outliers. 89.32
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.98
smart0037026 LRR Leucine-rich repeats, outliers. 88.98
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 87.53
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.72
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.17
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.46
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.13
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 81.7
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.7e-59  Score=543.63  Aligned_cols=541  Identities=30%  Similarity=0.493  Sum_probs=458.5

Q ss_pred             CCCcEEeCCCCCcCCCCccccccCCCCCCCEEecCCCCCCCccccCcccc-CCCCCCCEEeCCCCCCCcchhHHHhhccC
Q 045291            5 RKLKSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQEL-HNFTNLEYLTLDESSLHISLLQSIASLFP   83 (682)
Q Consensus         5 ~~L~~L~L~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l-~~l~~L~~L~L~~n~~~~~~~~~~~~l~~   83 (682)
                      .+++.|+|+++++  .+.++..+..+++|++|+|++|++.+..   |..+ .++++|++|++++|.+++..|.  ..+..
T Consensus        69 ~~v~~L~L~~~~i--~~~~~~~~~~l~~L~~L~Ls~n~~~~~i---p~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~  141 (968)
T PLN00113         69 SRVVSIDLSGKNI--SGKISSAIFRLPYIQTINLSNNQLSGPI---PDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPN  141 (968)
T ss_pred             CcEEEEEecCCCc--cccCChHHhCCCCCCEEECCCCccCCcC---ChHHhccCCCCCEEECcCCccccccCc--cccCC
Confidence            4678888888887  5667777888888888888888876431   4443 3788888888888887766554  34677


Q ss_pred             cceeeccCccccCcccCCCCCCCCCCCceeecCCCccccccchhHHHhhcCCCCcEEEccCCCC-CCCCCCcccccccCC
Q 045291           84 SLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSIL-GTNSSRILDQGLCSL  162 (682)
Q Consensus        84 L~~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~l~~~l~~L~~L~L~~~~l-~~~~~~i~~~~l~~l  162 (682)
                      |+++++.+|...+.+|..  ++.+++|++|++++  +.+.+..|..+.. +++|++|++++|.+ +.    +|. .++++
T Consensus       142 L~~L~Ls~n~~~~~~p~~--~~~l~~L~~L~L~~--n~l~~~~p~~~~~-l~~L~~L~L~~n~l~~~----~p~-~l~~l  211 (968)
T PLN00113        142 LETLDLSNNMLSGEIPND--IGSFSSLKVLDLGG--NVLVGKIPNSLTN-LTSLEFLTLASNQLVGQ----IPR-ELGQM  211 (968)
T ss_pred             CCEEECcCCcccccCChH--HhcCCCCCEEECcc--CcccccCChhhhh-CcCCCeeeccCCCCcCc----CCh-HHcCc
Confidence            888888877776666654  77788888888887  5555667777766 88888888888877 33    454 77788


Q ss_pred             CCCCEEEccCCCCcccCchhhcCCCCCCEEeccCCccccccCCchhcccCCCcEEecCCCcCccccCccccccCCCCcEE
Q 045291          163 VHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIF  242 (682)
Q Consensus       163 ~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~L~~L  242 (682)
                      ++|++|++++|.+.+..|..++++++|++|++++|.+++.+ |..+..+++|+.|++++|.+++..+. .+..+++|+.|
T Consensus       212 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~-p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L  289 (968)
T PLN00113        212 KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPI-PSSLGNLKNLQYLFLYQNKLSGPIPP-SIFSLQKLISL  289 (968)
T ss_pred             CCccEEECcCCccCCcCChhHhcCCCCCEEECcCceecccc-ChhHhCCCCCCEEECcCCeeeccCch-hHhhccCcCEE
Confidence            88888888888888778888888888888888888877666 66778888888888888887755543 36677788888


Q ss_pred             EccCCcccccccccCCCCCCcccccceeccccCCCCCCCCcccccCCCCCEEEcCCCCCcCcCchHHHhcCCCCcEEEcC
Q 045291          243 YADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGEFPTWLLENNAKLETLFLI  322 (682)
Q Consensus       243 ~l~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~l~~~~~L~~L~ls~~~~~~~~~~~~~~~~~~L~~L~l~  322 (682)
                      ++++|.+.                            +.+|.++..+++|+.|++++|.+.+..|.. +..+++|+.|+++
T Consensus       290 ~Ls~n~l~----------------------------~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~-~~~l~~L~~L~L~  340 (968)
T PLN00113        290 DLSDNSLS----------------------------GEIPELVIQLQNLEILHLFSNNFTGKIPVA-LTSLPRLQVLQLW  340 (968)
T ss_pred             ECcCCeec----------------------------cCCChhHcCCCCCcEEECCCCccCCcCChh-HhcCCCCCEEECc
Confidence            88777654                            346778889999999999999999888887 6789999999999


Q ss_pred             CCCCcccCCCCCCCCCCccEEEccCCcCCCCCChhhhhcCCCceEEEecCCcCCcCCCcccCCCCCCCEEEccCCcCCCc
Q 045291          323 NDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGE  402 (682)
Q Consensus       323 ~~~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~l~~n~~~~~  402 (682)
                      +|.+.+..+..+..+++|+.|++++|.+.+.+|..+.. +++|+.|++++|.+.+..|..+..+++|+.|++++|++.+.
T Consensus       341 ~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~-~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~  419 (968)
T PLN00113        341 SNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS-SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGE  419 (968)
T ss_pred             CCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhC-cCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeE
Confidence            99999888888889999999999999999888888766 88999999999999999999999999999999999999988


Q ss_pred             CchhhhhCCCCCCEEEccCCcCCCcccccCCCCCCccEEECCCCcCcccCCccccCCCCCCEEeccCCcCCCCchhhhcC
Q 045291          403 IPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGN  482 (682)
Q Consensus       403 ~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~  482 (682)
                      +|..+. .+++|+.|++++|++.+..+..+..+++|+.|++++|.+.+..|..+ ..++|+.|++++|++.+..|..+..
T Consensus       420 ~p~~~~-~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~  497 (968)
T PLN00113        420 LPSEFT-KLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGS  497 (968)
T ss_pred             CChhHh-cCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhh
Confidence            877654 79999999999999999888888889999999999999998888765 4689999999999999999999999


Q ss_pred             CCCCCeecCCCCcCcCCcchhccCCCCCCEEEccCCcCCCCcchhhccCCCCCcEEECCCCcCCCCchhhhhcCCCCCEE
Q 045291          483 LTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVF  562 (682)
Q Consensus       483 l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L  562 (682)
                      +++|++|+|++|.+.+..|..+..+++|+.|+|++|.+++ .+|..+..+++|+.|++++|++++.+|..+..+++|+.+
T Consensus       498 l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~-~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l  576 (968)
T PLN00113        498 LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSG-QIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQV  576 (968)
T ss_pred             hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccc-cCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEE
Confidence            9999999999999999999999999999999999999997 789999999999999999999999999999999999999


Q ss_pred             EccCccCcccCCcccccccccCcccccCCCCCCCCC
Q 045291          563 SVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLP  598 (682)
Q Consensus       563 ~l~~n~l~~~~~~~~~~~~~l~~~~~~~n~~~c~~~  598 (682)
                      ++++|++.+.+|. ...+..+....+.+|+..|+.+
T Consensus       577 ~ls~N~l~~~~p~-~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        577 NISHNHLHGSLPS-TGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             eccCCcceeeCCC-cchhcccChhhhcCCccccCCc
Confidence            9999999999998 5778888888899999999743



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query682
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-31
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-28
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-31
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-28
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-21
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 133 bits (334), Expect = 4e-31, Method: Compositional matrix adjust. Identities = 143/499 (28%), Positives = 230/499 (46%), Gaps = 91/499 (18%) Query: 32 SLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLDESSLHISLLQSIASLFPSLKNLSIS 91 SL +LDLS N+ + +TT L + + L++L + ++L FP Sbjct: 101 SLTSLDLSRNSLSG-PVTTLTSLGSCSGLKFLNVSSNTLD----------FPG------- 142 Query: 92 YCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNS 151 +V+G L+ SLE L +S I+ ++ + LK+L++SG+ + Sbjct: 143 --KVSGGLK------LNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKI---- 190 Query: 152 SRILDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVHL 211 S +D C V+L+ L ++ N+ +P+ L + ++L+ LD+S N+L+G S + + Sbjct: 191 SGDVDVSRC--VNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA-ISTC 246 Query: 212 TSIEMLILSDNHFQIPISLEPLFNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLL 271 T +++L +S N F PI PL L+ N+ EI L+ L L L Sbjct: 247 TELKLLNISSNQFVGPIPPLPL---KSLQYLSLAENKFTGEIPDF--LSGACDTLTGLDL 301 Query: 272 SSSYGDGFIFPKF------------------------LYHQHDLEFVDLSHIKMNGEFPT 307 S ++ G + P F L L+ +DLS + +GE P Sbjct: 302 SGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE 361 Query: 308 WLLENNAKLETLFLINDSIGGPF--RLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSL 365 L +A L TL L +++ GP L +P L+ L + NN F G +P + + L Sbjct: 362 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC-SEL 420 Query: 366 FSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVXXXXXXXXXXXXQ 425 S ++S N L G+IPSS G++ L+ L L N L GEIP+ L Sbjct: 421 VSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL------------------ 462 Query: 426 GHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTR 485 M+ + L+ L+L+ N GEIP LS C++L + L+NN L+G+IP+W+G L Sbjct: 463 --MYVKT-----LETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLEN 515 Query: 486 LQYIIMPNNHLEGPIPVEF 504 L + + NN G IP E Sbjct: 516 LAILKLSNNSFSGNIPAEL 534
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query682
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-109
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-77
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-71
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-64
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-59
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-63
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-56
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-45
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-54
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-44
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-53
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-38
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-46
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-44
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-42
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-37
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-23
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-14
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-14
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  345 bits (888), Expect = e-109
 Identities = 157/598 (26%), Positives = 256/598 (42%), Gaps = 35/598 (5%)

Query: 7   LKSFGLSGVGIRDGSKLLQSMGSFPSLNTLDLSYNNFTDIAITTTQELHNFTNLEYLTLD 66
           L S  L+       S +  S+ S   L +L LS ++       +        +L  L L 
Sbjct: 57  LSSKPLNV----GFSAVSSSLLSLTGLESLFLSNSHING----SVSGFKCSASLTSLDLS 108

Query: 67  ESSLH--ISLLQSIASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNT 124
            +SL   ++ L S+ S    LK L++S   ++   +  G     SLE L +S   I+   
Sbjct: 109 RNSLSGPVTTLTSLGSC-SGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGAN 167

Query: 125 SFLQIIGESMPSLKYLSLSGSILGTNSSRILDQGLCSLVHLQELRMADNDLRGSLPWCLA 184
               ++ +    LK+L++SG+ +   S  +    +   V+L+ L ++ N+    +P+ L 
Sbjct: 168 VVGWVLSDGCGELKHLAISGNKI---SGDV---DVSRCVNLEFLDVSSNNFSTGIPF-LG 220

Query: 185 NMTSLRILDVSFNQLTGSISSSPLVHLTSIEMLILSDNHFQIPISLEPLFNHSRLKIFYA 244
           + ++L+ LD+S N+L+G  S + +   T +++L +S N F  PI   P      L+    
Sbjct: 221 DCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFVGPI---PPLPLKSLQYLSL 276

Query: 245 DNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQHDLEFVDLSHIKMNGE 304
             N+   EI    S       L  L LS ++  G + P F      LE + LS    +GE
Sbjct: 277 AENKFTGEIPDFLSGACDT--LTGLDLSGNHFYGAV-PPFFGSCSLLESLALSSNNFSGE 333

Query: 305 FPTWLLENNAKLETLFLINDSIGGPFRLPI-HPHRRLRFLDVSNNNFQGHMPVEIGDI-L 362
            P   L     L+ L L  +   G     + +    L  LD+S+NNF G +   +     
Sbjct: 334 LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 393

Query: 363 PSLFSFNISTNALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNLNSLALSNN 422
            +L    +  N   G IP +  N   L  L LS N+L+G IP  L      L  L L  N
Sbjct: 394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG-SLSKLRDLKLWLN 452

Query: 423 NLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGN 482
            L+G +      +  L+ L+L+ N   GEIP  LS C++L  + L+NN L+G+IP+W+G 
Sbjct: 453 MLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGR 512

Query: 483 LTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSY 542
           L  L  + + NN   G IP E      L  LD++ N  +G  IP+         S  ++ 
Sbjct: 513 LENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGT-IPAAMFKQ----SGKIAA 567

Query: 543 NKLNGKMPHQLVELKTLEVFSVAYN--NLSGEIPEWTAQFATFNESSYEGNIFLCGLP 598
           N + GK    +      +    A N     G   E   + +T N  +    ++     
Sbjct: 568 NFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTS 625


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query682
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.35
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.28
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.51
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.15
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.99
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.64
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.63
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.36
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.29
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-65  Score=580.69  Aligned_cols=573  Identities=30%  Similarity=0.396  Sum_probs=470.4

Q ss_pred             CCCCCCCcEEeCCCCCcCCCCcccc--ccCCCCCCCEEecCCCCCCCccccCcccc-CCCCCCCEEeCCCCCCCcchhHH
Q 045291            1 YGGLRKLKSFGLSGVGIRDGSKLLQ--SMGSFPSLNTLDLSYNNFTDIAITTTQEL-HNFTNLEYLTLDESSLHISLLQS   77 (682)
Q Consensus         1 ~~~l~~L~~L~L~~~~~~~~~~~~~--~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l-~~l~~L~~L~L~~n~~~~~~~~~   77 (682)
                      |+++++|++|+|++|.+  .+.+|.  .++++++|++|||++|.+.+..   +..+ .++++|++|++++|.+++..+..
T Consensus        96 ~~~l~~L~~L~Ls~n~l--~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~---~~~~~~~l~~L~~L~Ls~n~l~~~~~~~  170 (768)
T 3rgz_A           96 FKCSASLTSLDLSRNSL--SGPVTTLTSLGSCSGLKFLNVSSNTLDFPG---KVSGGLKLNSLEVLDLSANSISGANVVG  170 (768)
T ss_dssp             CCCCTTCCEEECCSSEE--EEEGGGGGGGGGCTTCCEEECCSSEEECCS---SCCSCCCCTTCSEEECCSSCCEEETHHH
T ss_pred             hccCCCCCEEECCCCcC--CCcCCChHHHhCCCCCCEEECcCCccCCcC---CHHHhccCCCCCEEECCCCccCCcCChh
Confidence            46789999999999998  677777  8999999999999999887653   3343 78999999999999998877776


Q ss_pred             ---HhhccCcceeeccCccccCcccCCCCCCCCCCCceeecCCCccccccchhHHHhhcCCCCcEEEccCCCCCCCCCCc
Q 045291           78 ---IASLFPSLKNLSISYCEVNGVLRGQGFPSFKSLEHLHMSFAPIALNTSFLQIIGESMPSLKYLSLSGSILGTNSSRI  154 (682)
Q Consensus        78 ---~~~l~~L~~l~~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~l~~~l~~L~~L~L~~~~l~~~~~~i  154 (682)
                         +.++..|+++++.+|...+..+    +..+++|++|++++  +.+.+..|. +.. +++|++|++++|.+..   .+
T Consensus       171 ~~~~~~l~~L~~L~Ls~n~l~~~~~----~~~l~~L~~L~Ls~--n~l~~~~~~-l~~-l~~L~~L~Ls~n~l~~---~~  239 (768)
T 3rgz_A          171 WVLSDGCGELKHLAISGNKISGDVD----VSRCVNLEFLDVSS--NNFSTGIPF-LGD-CSALQHLDISGNKLSG---DF  239 (768)
T ss_dssp             HHHTTCCTTCCEEECCSSEEESCCB----CTTCTTCCEEECCS--SCCCSCCCB-CTT-CCSCCEEECCSSCCCS---CH
T ss_pred             hhhhccCCCCCEEECCCCcccccCC----cccCCcCCEEECcC--CcCCCCCcc-ccc-CCCCCEEECcCCcCCC---cc
Confidence               6788889999888888765444    46788888888888  445555555 555 8888888888888843   04


Q ss_pred             ccccccCCCCCCEEEccCCCCcccCchhhcCCCCCCEEeccCCccccccCCchhcc-cCCCcEEecCCCcCccccCcccc
Q 045291          155 LDQGLCSLVHLQELRMADNDLRGSLPWCLANMTSLRILDVSFNQLTGSISSSPLVH-LTSIEMLILSDNHFQIPISLEPL  233 (682)
Q Consensus       155 ~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~i~~~~~~~-l~~L~~L~L~~n~l~~~~~~~~~  233 (682)
                      + ..++++++|++|++++|.+.+..|..  .+++|++|++++|.+++.+ |..+.. +++|++|++++|.+++..+. .+
T Consensus       240 ~-~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~i-p~~~~~~~~~L~~L~Ls~n~l~~~~p~-~~  314 (768)
T 3rgz_A          240 S-RAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEI-PDFLSGACDTLTGLDLSGNHFYGAVPP-FF  314 (768)
T ss_dssp             H-HHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESC-CCCSCTTCTTCSEEECCSSEEEECCCG-GG
T ss_pred             c-HHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCcc-CHHHHhhcCcCCEEECcCCcCCCccch-HH
Confidence            4 37888888888888888888766654  7788888888888888777 444444 58888888888888765553 47


Q ss_pred             ccCCCCcEEEccCCcccccccccCCCCCCcccccceeccccCCCCCCCCcccccCC-CCCEEEcCCCCCcCcCchHHHhc
Q 045291          234 FNHSRLKIFYADNNELNAEITQSHSLTAPNFQLNRLLLSSSYGDGFIFPKFLYHQH-DLEFVDLSHIKMNGEFPTWLLEN  312 (682)
Q Consensus       234 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~l~~~~-~L~~L~ls~~~~~~~~~~~~~~~  312 (682)
                      ..+++|+.|++++|.+.+......  ......++.+.+ ..+...+.+|..+..++ +|+.|++++|.+.+.+|..+ ..
T Consensus       315 ~~l~~L~~L~L~~n~l~~~ip~~~--l~~l~~L~~L~L-s~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~-~~  390 (768)
T 3rgz_A          315 GSCSLLESLALSSNNFSGELPMDT--LLKMRGLKVLDL-SFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNL-CQ  390 (768)
T ss_dssp             GGCTTCCEEECCSSEEEEECCHHH--HTTCTTCCEEEC-CSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTT-TC
T ss_pred             hcCCCccEEECCCCcccCcCCHHH--HhcCCCCCEEeC-cCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhh-hh
Confidence            788888888888888764432110  122345777777 55556667787787776 88888888888887777663 33


Q ss_pred             --CCCCcEEEcCCCCCcccCCCCCCCCCCccEEEccCCcCCCCCChhhhhcCCCceEEEecCCcCCcCCCcccCCCCCCC
Q 045291          313 --NAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQ  390 (682)
Q Consensus       313 --~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~l~~L~  390 (682)
                        +++|++|++++|.+.+..+..+..+++|++|++++|.+++.+|..+.. +++|+.|++++|.+.+..|..+..+++|+
T Consensus       391 ~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~~~~l~~L~  469 (768)
T 3rgz_A          391 NPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLE  469 (768)
T ss_dssp             STTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGG-CTTCCEEECCSSCCCSCCCGGGGGCTTCC
T ss_pred             cccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhc-CCCCCEEECCCCcccCcCCHHHcCCCCce
Confidence              678899999998888877778888889999999999888788877765 88899999999998888888888889999


Q ss_pred             EEEccCCcCCCcCchhhhhCCCCCCEEEccCCcCCCcccccCCCCCCccEEECCCCcCcccCCccccCCCCCCEEeccCC
Q 045291          391 ILDLSNNHLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSLEGLYLNNN  470 (682)
Q Consensus       391 ~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n  470 (682)
                      +|++++|++.+.+|..+. .+++|++|++++|++++..|..+..+++|++|++++|.+.+.+|..+..+++|+.|++++|
T Consensus       470 ~L~L~~N~l~~~~p~~l~-~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N  548 (768)
T 3rgz_A          470 TLILDFNDLTGEIPSGLS-NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN  548 (768)
T ss_dssp             EEECCSSCCCSCCCGGGG-GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSS
T ss_pred             EEEecCCcccCcCCHHHh-cCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCC
Confidence            999999988877776654 7889999999999998888888888899999999999988888888888999999999998


Q ss_pred             cCCCCchhhh----------------------------------------------------------------------
Q 045291          471 SLSGKIPRWL----------------------------------------------------------------------  480 (682)
Q Consensus       471 ~~~~~~~~~~----------------------------------------------------------------------  480 (682)
                      ++.+.+|..+                                                                      
T Consensus       549 ~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~  628 (768)
T 3rgz_A          549 LFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF  628 (768)
T ss_dssp             EEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSC
T ss_pred             ccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhh
Confidence            8876666543                                                                      


Q ss_pred             cCCCCCCeecCCCCcCcCCcchhccCCCCCCEEEccCCcCCCCcchhhccCCCCCcEEECCCCcCCCCchhhhhcCCCCC
Q 045291          481 GNLTRLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLE  560 (682)
Q Consensus       481 ~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~  560 (682)
                      ..+++|++|+|++|++++.+|..+..+++|+.|+|++|++++ .+|..++.+++|+.|||++|++++.+|..+..+++|+
T Consensus       629 ~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g-~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~  707 (768)
T 3rgz_A          629 DNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG-SIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLT  707 (768)
T ss_dssp             SSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCS-CCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCS
T ss_pred             hccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCC-CCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCC
Confidence            335779999999999999999999999999999999999998 7899999999999999999999999999999999999


Q ss_pred             EEEccCccCcccCCcccccccccCcccccCCCCCCCCCCCCC
Q 045291          561 VFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLPLPIC  602 (682)
Q Consensus       561 ~L~l~~n~l~~~~~~~~~~~~~l~~~~~~~n~~~c~~~~~~~  602 (682)
                      +|++++|+++|.+|+ ..++.++....+.|||.+|+.|+..|
T Consensus       708 ~L~ls~N~l~g~iP~-~~~~~~~~~~~~~gN~~Lcg~~l~~C  748 (768)
T 3rgz_A          708 EIDLSNNNLSGPIPE-MGQFETFPPAKFLNNPGLCGYPLPRC  748 (768)
T ss_dssp             EEECCSSEEEEECCS-SSSGGGSCGGGGCSCTEEESTTSCCC
T ss_pred             EEECcCCcccccCCC-chhhccCCHHHhcCCchhcCCCCcCC
Confidence            999999999999998 67889999999999999999988744



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 682
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-08
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 6e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 9e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 91.4 bits (225), Expect = 1e-20
 Identities = 73/288 (25%), Positives = 110/288 (38%), Gaps = 46/288 (15%)

Query: 337 HRRLRFLDVSNNNFQGHMPVEIGDILPSLFSFNISTNALHGSIPSSFGNMKFLQILDLSN 396
             R+  LD+S  N     P                       IPSS  N+ +L  L +  
Sbjct: 49  TYRVNNLDLSGLNLPKPYP-----------------------IPSSLANLPYLNFLYIGG 85

Query: 397 NHLTGEIPEYLAVGCVNLNSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSL 456
            +               L+ L +++ N+ G +      +  L  L    N   G +P S+
Sbjct: 86  INNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSI 145

Query: 457 SKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQY-IIMPNNHLEGPIPVEFCQLDLLQILD- 514
           S   +L G+  + N +SG IP   G+ ++L   + +  N L G IP  F  L+L  +   
Sbjct: 146 SSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLS 205

Query: 515 --------------------ISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLV 554
                               I     S           K +  LDL  N++ G +P  L 
Sbjct: 206 RNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLT 265

Query: 555 ELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNIFLCGLPLPIC 602
           +LK L   +V++NNL GEIP+       F+ S+Y  N  LCG PLP C
Sbjct: 266 QLKFLHSLNVSFNNLCGEIPQGG-NLQRFDVSAYANNKCLCGSPLPAC 312


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query682
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.51
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.96
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.62
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.32
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=5.7e-29  Score=248.52  Aligned_cols=259  Identities=32%  Similarity=0.529  Sum_probs=231.2

Q ss_pred             CCccEEEccCCcCCC--CCChhhhhcCCCceEEEecC-CcCCcCCCcccCCCCCCCEEEccCCcCCCcCchhhhhCCCCC
Q 045291          338 RRLRFLDVSNNNFQG--HMPVEIGDILPSLFSFNIST-NALHGSIPSSFGNMKFLQILDLSNNHLTGEIPEYLAVGCVNL  414 (682)
Q Consensus       338 ~~L~~L~l~~n~~~~--~~~~~~~~~l~~L~~L~l~~-n~i~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~L  414 (682)
                      ..++.|+++++.+.+  .+|..+.. +++|++|++++ |.+.+.+|..|.++++|++|++++|++.+..+ ..+..+.+|
T Consensus        50 ~~v~~L~L~~~~l~g~~~lp~~l~~-L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~-~~~~~~~~L  127 (313)
T d1ogqa_          50 YRVNNLDLSGLNLPKPYPIPSSLAN-LPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP-DFLSQIKTL  127 (313)
T ss_dssp             CCEEEEEEECCCCSSCEECCGGGGG-CTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECC-GGGGGCTTC
T ss_pred             EEEEEEECCCCCCCCCCCCChHHhc-Cccccccccccccccccccccccccccccchhhhcccccccccc-ccccchhhh
Confidence            368889999998876  47787776 99999999986 78888899999999999999999999985444 445579999


Q ss_pred             CEEEccCCcCCCcccccCCCCCCccEEECCCCcCcccCCccccCCCCC-CEEeccCCcCCCCchhhhcCCCCCCeecCCC
Q 045291          415 NSLALSNNNLQGHMFSRNFNLTNLKWLLLEGNRFVGEIPQSLSKCSSL-EGLYLNNNSLSGKIPRWLGNLTRLQYIIMPN  493 (682)
Q Consensus       415 ~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L-~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~  493 (682)
                      +.++++.|.+.+..|..+..++.++.+++++|.+.+.+|..+..+.++ +.+++++|++.+..|..+..+..+ .+++++
T Consensus       128 ~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~  206 (313)
T d1ogqa_         128 VTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSR  206 (313)
T ss_dssp             CEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCS
T ss_pred             cccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-cccccc
Confidence            999999999998888999999999999999999998899988888776 889999999998888888877655 799999


Q ss_pred             CcCcCCcchhccCCCCCCEEEccCCcCCCCcchhhccCCCCCcEEECCCCcCCCCchhhhhcCCCCCEEEccCccCcccC
Q 045291          494 NHLEGPIPVEFCQLDLLQILDISDNNISGRLIPSTFSNLKQIESLDLSYNKLNGKMPHQLVELKTLEVFSVAYNNLSGEI  573 (682)
Q Consensus       494 n~l~~~~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~l~~~~  573 (682)
                      +...+..|..+..+++++.+++++|.+.+  .+..+..+++|+.|++++|++++.+|+.+..+++|++|+|++|+++|.+
T Consensus       207 ~~~~~~~~~~~~~~~~l~~l~~~~~~l~~--~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~i  284 (313)
T d1ogqa_         207 NMLEGDASVLFGSDKNTQKIHLAKNSLAF--DLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEI  284 (313)
T ss_dssp             SEEEECCGGGCCTTSCCSEEECCSSEECC--BGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEEC
T ss_pred             ccccccccccccccccccccccccccccc--cccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccC
Confidence            99999999999999999999999999986  4557888999999999999999999999999999999999999999999


Q ss_pred             CcccccccccCcccccCCCCCCCCCCCCC
Q 045291          574 PEWTAQFATFNESSYEGNIFLCGLPLPIC  602 (682)
Q Consensus       574 ~~~~~~~~~l~~~~~~~n~~~c~~~~~~~  602 (682)
                      |+ ...+++++.+++.+|+..|+.|++.|
T Consensus       285 P~-~~~L~~L~~l~l~~N~~l~g~plp~c  312 (313)
T d1ogqa_         285 PQ-GGNLQRFDVSAYANNKCLCGSPLPAC  312 (313)
T ss_dssp             CC-STTGGGSCGGGTCSSSEEESTTSSCC
T ss_pred             CC-cccCCCCCHHHhCCCccccCCCCCCC
Confidence            98 67889999999999999999887755



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure